BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_J23 (941 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 54 1e-07 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 54 2e-07 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 50 4e-06 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 47 3e-05 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 46 3e-05 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 46 3e-05 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 46 4e-05 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 46 4e-05 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) 45 8e-05 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 45 8e-05 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 44 2e-04 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 44 2e-04 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 44 2e-04 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 43 3e-04 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 43 4e-04 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 42 5e-04 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 42 5e-04 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 42 7e-04 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 42 0.001 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 41 0.002 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 41 0.002 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 41 0.002 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 41 0.002 SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) 41 0.002 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 40 0.004 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 39 0.005 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 39 0.005 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 38 0.009 SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) 38 0.009 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 38 0.012 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.016 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.016 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.016 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 37 0.021 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 37 0.021 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 37 0.021 SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) 37 0.021 SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) 37 0.021 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 37 0.021 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 37 0.021 SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 37 0.027 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 37 0.027 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 37 0.027 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 37 0.027 SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) 37 0.027 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 36 0.036 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 36 0.036 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 36 0.036 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 36 0.036 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 36 0.036 SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.047 SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) 36 0.047 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 36 0.047 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.047 SB_7159| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.047 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 36 0.063 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.063 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.063 SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.063 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 36 0.063 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.063 SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) 36 0.063 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 35 0.083 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 35 0.083 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 35 0.083 SB_19081| Best HMM Match : Metallothio_2 (HMM E-Value=4.4) 35 0.083 SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) 35 0.11 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 35 0.11 SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 35 0.11 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 35 0.11 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 35 0.11 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.12 SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) 34 0.14 SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) 34 0.14 SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_36422| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) 34 0.19 SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) 34 0.19 SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_1966| Best HMM Match : GRP (HMM E-Value=0.53) 34 0.19 SB_52684| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) 33 0.25 SB_5429| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_37850| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_45079| Best HMM Match : RRM_1 (HMM E-Value=0.0027) 33 0.33 SB_30029| Best HMM Match : Extensin_2 (HMM E-Value=0.45) 33 0.33 SB_27977| Best HMM Match : ARID (HMM E-Value=1.6e-26) 33 0.33 SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) 33 0.33 SB_6008| Best HMM Match : CPSase_L_D2 (HMM E-Value=0) 33 0.33 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_21796| Best HMM Match : COLFI (HMM E-Value=0) 29 0.34 SB_53480| Best HMM Match : Sigma70_r1_1 (HMM E-Value=5.7) 33 0.44 SB_50380| Best HMM Match : PMC2NT (HMM E-Value=2.4) 33 0.44 SB_38546| Best HMM Match : Trypsin (HMM E-Value=1.90577e-43) 33 0.44 SB_19562| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.44 SB_9718| Best HMM Match : Metallothio_2 (HMM E-Value=1.3) 33 0.44 SB_7559| Best HMM Match : Metallothio_2 (HMM E-Value=2) 33 0.44 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.44 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 33 0.44 SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74) 32 0.59 SB_59765| Best HMM Match : Metallothio_2 (HMM E-Value=4.3) 32 0.59 SB_49744| Best HMM Match : Tubulin_C (HMM E-Value=6.7) 32 0.59 SB_37025| Best HMM Match : Homeobox (HMM E-Value=1.3e-16) 32 0.59 SB_36275| Best HMM Match : Extensin_2 (HMM E-Value=0.062) 32 0.59 SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.59 SB_14695| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.59 SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) 32 0.59 SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) 32 0.59 SB_3427| Best HMM Match : Homeobox (HMM E-Value=4e-24) 32 0.59 SB_42661| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.72 SB_51714| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.77 SB_47181| Best HMM Match : Pkinase (HMM E-Value=7.7e-31) 32 0.77 SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) 32 0.77 SB_45113| Best HMM Match : CemA (HMM E-Value=6) 32 0.77 SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.77 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 32 0.77 SB_28631| Best HMM Match : Drf_FH1 (HMM E-Value=0.35) 32 0.77 SB_23868| Best HMM Match : Gal_Lectin (HMM E-Value=1.4e-05) 32 0.77 SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) 32 0.77 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.77 SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.77 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 32 0.77 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.77 SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) 32 0.77 SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.77 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 32 0.77 SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) 32 0.77 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.77 SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_48061| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_17372| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_55443| Best HMM Match : Homeobox (HMM E-Value=2.3e-26) 31 1.0 SB_50215| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_45593| Best HMM Match : ArfGap (HMM E-Value=3.3e-37) 31 1.0 SB_18074| Best HMM Match : Trypan_PARP (HMM E-Value=0.081) 31 1.0 SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_14693| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_44353| Best HMM Match : GRP (HMM E-Value=4.9) 31 1.4 SB_41312| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_36310| Best HMM Match : DEAD (HMM E-Value=1.4) 31 1.4 SB_32409| Best HMM Match : Oxidored_q2 (HMM E-Value=0.081) 31 1.4 SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) 31 1.4 SB_19172| Best HMM Match : GRP (HMM E-Value=4.9) 31 1.4 SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) 31 1.4 SB_3426| Best HMM Match : Homeobox (HMM E-Value=3.4e-22) 31 1.4 SB_2796| Best HMM Match : RR_TM4-6 (HMM E-Value=1.9) 31 1.4 SB_58920| Best HMM Match : GRP (HMM E-Value=0.35) 31 1.8 SB_55248| Best HMM Match : Adeno_E1A (HMM E-Value=7.5) 31 1.8 SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_2886| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) 31 1.8 SB_34751| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_23696| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_56224| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_52294| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_35308| Best HMM Match : VWA (HMM E-Value=1.1e-20) 30 2.4 SB_34754| Best HMM Match : TSP_1 (HMM E-Value=7.4e-12) 30 2.4 SB_25716| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_18621| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 30 2.4 SB_13751| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) 30 2.4 SB_44477| Best HMM Match : IBR (HMM E-Value=0.00086) 30 2.4 SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) 30 2.4 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_43367| Best HMM Match : SAM_1 (HMM E-Value=0.085) 30 3.1 SB_38159| Best HMM Match : Peptidase_M28 (HMM E-Value=4.7e-09) 30 3.1 SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) 30 3.1 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) 29 4.1 SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_35820| Best HMM Match : TRAP_240kDa (HMM E-Value=0.006) 29 4.1 SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) 29 4.1 SB_22536| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_59680| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 29 4.1 SB_52712| Best HMM Match : Dynein_light (HMM E-Value=3) 29 4.1 SB_37928| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_26965| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_17676| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_8478| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_7859| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_128| Best HMM Match : SH3BP5 (HMM E-Value=3.3) 29 4.1 SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) 29 5.5 SB_30560| Best HMM Match : Herpes_UL73 (HMM E-Value=4.5) 29 5.5 SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_51163| Best HMM Match : Adeno_PIX (HMM E-Value=0.96) 29 7.2 SB_39126| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.2 SB_38223| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.2 SB_33219| Best HMM Match : RhoGAP (HMM E-Value=0.0014) 29 7.2 SB_30230| Best HMM Match : CH (HMM E-Value=0.0035) 29 7.2 SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) 29 7.2 SB_28577| Best HMM Match : Chitin_bind_3 (HMM E-Value=0.00012) 29 7.2 SB_7383| Best HMM Match : SapA (HMM E-Value=1.2e-13) 29 7.2 SB_53084| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.2 SB_49222| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.2 SB_36777| Best HMM Match : VWA (HMM E-Value=0) 29 7.2 SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) 29 7.2 SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.2 SB_19709| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.2 SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) 29 7.2 SB_1052| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.6 SB_21275| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 8.5 SB_58047| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_55729| Best HMM Match : YajC (HMM E-Value=0.56) 28 9.5 SB_55147| Best HMM Match : TPR_2 (HMM E-Value=1.8e-10) 28 9.5 SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) 28 9.5 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 28 9.5 SB_37296| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_36932| Best HMM Match : HTH_8 (HMM E-Value=1.4) 28 9.5 SB_36007| Best HMM Match : Collagen (HMM E-Value=9e-25) 28 9.5 SB_31182| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_16908| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_4764| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_58404| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_56161| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_47680| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_45391| Best HMM Match : DUF1509 (HMM E-Value=1.9) 28 9.5 SB_37711| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_34511| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_29063| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 54.4 bits (125), Expect = 1e-07 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP PPP PP PPPP Sbjct: 387 PSPPPPPQPPPPPPPPPPPPPPPPPPPP 414 Score = 53.6 bits (123), Expect = 2e-07 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP PPP PP PPPP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPP 393 Score = 53.6 bits (123), Expect = 2e-07 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP PPP PP PPPP Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 53.6 bits (123), Expect = 2e-07 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP PPP PP PPPP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 53.6 bits (123), Expect = 2e-07 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP PPP PP PPPP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 53.6 bits (123), Expect = 2e-07 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP PPP PP PPPP Sbjct: 400 PPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 53.6 bits (123), Expect = 2e-07 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP PPP PP PPPP Sbjct: 404 PPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 50.4 bits (115), Expect = 2e-06 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PP PPP PP PPPP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPP 392 Score = 50.4 bits (115), Expect = 2e-06 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP P P PPP PP PPPP Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPP 402 Score = 50.4 bits (115), Expect = 2e-06 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP P P PPP PPP PP PPPP Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPP 406 Score = 50.4 bits (115), Expect = 2e-06 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP P P PPP PP PPPP Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPP 408 Score = 50.4 bits (115), Expect = 2e-06 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P P PPP PPP PPP PP PPPP Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPP 410 Score = 50.4 bits (115), Expect = 2e-06 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP P P PPP PPP PP PPPP Sbjct: 385 PPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 50.4 bits (115), Expect = 2e-06 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PP PPP PPP PP PPPP Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 50.4 bits (115), Expect = 2e-06 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P P PPP PPP PPP PP PPPP Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 50.4 bits (115), Expect = 2e-06 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PPP PPP PPP PP PPPP Sbjct: 390 PPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 50.4 bits (115), Expect = 2e-06 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP PPP PP PP P Sbjct: 393 PQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 Score = 50.4 bits (115), Expect = 2e-06 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP PPP PP PPP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 50.4 bits (115), Expect = 2e-06 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP PPP P PPPP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 50.4 bits (115), Expect = 2e-06 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP PPP P PPPP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 50.4 bits (115), Expect = 2e-06 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP PP PP PPPP Sbjct: 401 PPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 50.4 bits (115), Expect = 2e-06 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP P P PP PPPP Sbjct: 402 PPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 50.4 bits (115), Expect = 2e-06 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP PP PP PPPP Sbjct: 403 PPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 50.4 bits (115), Expect = 2e-06 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PP PPP PP PPPP Sbjct: 405 PPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 49.2 bits (112), Expect = 5e-06 Identities = 19/29 (65%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPP-PXPPXXPPPP 941 P PPP PPP PPP PP P PP PPPP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPP 398 Score = 47.2 bits (107), Expect = 2e-05 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PP PPP PPP PP P PP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPP 396 Score = 47.2 bits (107), Expect = 2e-05 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P P PPP PPP PP PP PPPP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPP 399 Score = 47.2 bits (107), Expect = 2e-05 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PPP PPP PPP P PPPP Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPP 400 Score = 47.2 bits (107), Expect = 2e-05 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PP PP PPP PP PPPP Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPP 407 Score = 46.4 bits (105), Expect = 3e-05 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P PP PSP P P P PP P P PPP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 45.6 bits (103), Expect = 6e-05 Identities = 17/37 (45%), Positives = 20/37 (54%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P ++ + G P PPP PPP PP PP PPPP Sbjct: 350 PRAIVTDISAGINMSPPPPPPPPPPPPSPPPPPPPPP 386 Score = 44.8 bits (101), Expect = 1e-04 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P PP P P P P P PP P P PPP Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P PP P P P P P PP P P PPP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P PP P P P P P PP P P PPP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P PP P P P P P PP P P PPP Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P P P P S P P P PP P P PPP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPP 414 Score = 41.5 bits (93), Expect = 0.001 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P PP P P P P P PP P P PPP Sbjct: 365 PPPPPPPPPPPPSPPPPPP-PPPPSPPPPPQPPPPPPPPPPPPPPPP 410 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P P P P P P P PP P P PPP Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP PP P P P P P PP P P PPP Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P PP P P P P P PP P P PPP Sbjct: 389 PPPPPQPPPPPPPPPPPPP----PPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 37.9 bits (84), Expect = 0.012 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P PP P P P P P PP P PP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 37.1 bits (82), Expect = 0.021 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +1 Query: 802 SPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 SPP P PP P P S P P P PP P P PPP Sbjct: 364 SPPPPPPP-----PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPP 403 Score = 37.1 bits (82), Expect = 0.021 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P PP P P P P P PP P P PPP Sbjct: 392 PPQPPPPPPPPPPPPPPPP----PPPPPPPPAPPPP--PPPPPPPPP 432 Score = 35.5 bits (78), Expect = 0.063 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P P PPP PPP PPP PP Sbjct: 414 PPPPPAPPPPPPPPPPPPPALRLACAPP 441 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 54.0 bits (124), Expect = 2e-07 Identities = 19/27 (70%), Positives = 19/27 (70%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PPP PPP PPP PPP PP PPPP Sbjct: 461 GQAPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 53.6 bits (123), Expect = 2e-07 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP PPP PP PPPP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPP 492 Score = 53.6 bits (123), Expect = 2e-07 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP PPP PP PPPP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 50.4 bits (115), Expect = 2e-06 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP PPP PP PP P Sbjct: 469 PPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 49.2 bits (112), Expect = 5e-06 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP PPP PP PPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPP 491 Score = 47.6 bits (108), Expect = 1e-05 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G P PPP PPP PPP PP PPPP Sbjct: 459 GVGQAPPPPPPPPPPPPPPPPPPPPPP 485 Score = 46.4 bits (105), Expect = 3e-05 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP PPP PPP PPP P PPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 33.9 bits (74), Expect = 0.19 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXP 912 PP PP P PP P P P P P PP P P Sbjct: 464 PPPPPPPPPPPPPPPPPP------PPPPPPFPPPPPPTP 496 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 51.6 bits (118), Expect = 9e-07 Identities = 18/33 (54%), Positives = 21/33 (63%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 + ++P PPP PPP PPP PPP P PPPP Sbjct: 678 IQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPP 710 Score = 48.0 bits (109), Expect = 1e-05 Identities = 20/39 (51%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXP--PPP 941 P + L + PPP PPP PPP PPP PP P PPP Sbjct: 670 PIQILPIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPP 708 Score = 44.4 bits (100), Expect = 1e-04 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP PPP PPP P P P PPP Sbjct: 685 PPPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/37 (48%), Positives = 21/37 (56%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P +++ P PPP PPP PPP P PP PPPP Sbjct: 677 PIQTMVPPPPPPPPPPPPPPPPPPPQPSTPP--PPPP 711 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXP--PPXPPXXPPP 938 P PPP PPP PPP P PP PP PP Sbjct: 687 PPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 31.9 bits (69), Expect = 0.77 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPP 897 PP PP P PP P P S P P P PP Sbjct: 684 PPPPPPPPPPPPPPPPPPQPS--TPPPPPPSTPP 715 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 2/28 (7%) Frame = +3 Query: 858 PGXXPPPXP--PPXPPPXPPPXPPXXPP 935 P PPP P PP PPP PP P Sbjct: 695 PPPPPPPQPSTPPPPPPSTPPVQQSGAP 722 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG GG GG GG G Sbjct: 566 GGNNNGGNTGGNNGGNTGGNNNGGNTGG 593 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG GG GG GG G Sbjct: 592 GGNNNGGNTGGNNGGNTGGNNNGGNTGG 619 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG GG GG GG G Sbjct: 618 GGNNNGGNTGGNNGGNTGGNNNGGNSGG 645 Score = 28.7 bits (61), Expect = 7.2 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = -2 Query: 934 GGXXGGX--GGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GG GG GG GG GG GG G T G Sbjct: 562 GGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGG 598 Score = 28.7 bits (61), Expect = 7.2 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = -2 Query: 934 GGXXGGX--GGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GG GG GG GG GG GG G T G Sbjct: 588 GGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGG 624 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG GG GG GG G Sbjct: 571 GGNTGGNNGGNTGGNNNGGNTGGNNNG 597 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG GG GG GG G Sbjct: 583 GGNNNGGNTGGNNNGGNTGGNNGGNTGG 610 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG GG GG GG G Sbjct: 597 GGNTGGNNGGNTGGNNNGGNTGGNNNG 623 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG GG GG GG G Sbjct: 609 GGNNNGGNTGGNNNGGNTGGNNGGNTGG 636 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 49.6 bits (113), Expect = 4e-06 Identities = 35/98 (35%), Positives = 35/98 (35%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXGG 761 GGGG GG GGG GGG GGG GGG G G G G G Sbjct: 779 GGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGD 838 Query: 760 XLGXEPPHXPRGGXEKGXXCGG*GXLRGXXGPXXGXGG 647 G GG G GG G G G G GG Sbjct: 839 GGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 47.2 bits (107), Expect = 2e-05 Identities = 35/98 (35%), Positives = 35/98 (35%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXGG 761 GGGG GG GGG G G GGG GGG G G G G GG Sbjct: 770 GGGGGDGGDGGGGGDG-GGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGG 828 Query: 760 XLGXEPPHXPRGGXEKGXXCGG*GXLRGXXGPXXGXGG 647 G GG G GG G G G G GG Sbjct: 829 GYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGG 866 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 48.4 bits (110), Expect = 8e-06 Identities = 24/67 (35%), Positives = 25/67 (37%) Frame = +3 Query: 741 GGSXPXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPPXP 920 GG+ P PP P P S PG PP PPP PPP P Sbjct: 927 GGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPP 986 Query: 921 PXXPPPP 941 P PPPP Sbjct: 987 PPPPPPP 993 Score = 35.9 bits (79), Expect = 0.047 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 5/32 (15%) Frame = +3 Query: 861 GXXPPPXPP-----PXPPPXPPPXPPXXPPPP 941 G PPP PP P PPP P P PPPP Sbjct: 917 GSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPP 948 Score = 33.5 bits (73), Expect = 0.25 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP P PPP P P PPPP Sbjct: 910 PSASPPGGSVPPPPPPPGGNAPLPPPPP 937 Score = 33.1 bits (72), Expect = 0.33 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P P P S P P P P P PPP Sbjct: 920 PPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPP 966 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 48.4 bits (110), Expect = 8e-06 Identities = 18/34 (52%), Positives = 20/34 (58%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 S+ +P PPP PPP P PPP PP PPPP Sbjct: 1151 SVRDQIPPPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 44.0 bits (99), Expect = 2e-04 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PP P P PPP PP PP P Sbjct: 1159 PPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 31.9 bits (69), Expect = 0.77 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXT 918 P PP P PP PSP P P P PP P T Sbjct: 1157 PPPPPPPPPPPPSSPSPP-----PPPPPPPPPPTPTTTTT 1191 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 46.8 bits (106), Expect = 3e-05 Identities = 20/37 (54%), Positives = 21/37 (56%), Gaps = 3/37 (8%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPPPXPPPXPP---PXPPXXPPPP 941 S S + PPP PPP PPP PP P PP PPPP Sbjct: 197 SPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPP 233 Score = 45.6 bits (103), Expect = 6e-05 Identities = 18/29 (62%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPPPXPPPXP-PPXPPPXPPXXPPPP 941 P PPP PPP P PP PPP PP PP P Sbjct: 212 PPSPPPPPPPPSPSPPRPPPPPPPSPPRP 240 Score = 43.6 bits (98), Expect = 2e-04 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PPP PPP P P P PPPP Sbjct: 208 PPRPPPSPPPPPPPPSPSPPRPPPPPPP 235 Score = 37.9 bits (84), Expect = 0.012 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = +1 Query: 772 PXSXFXWXPPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P S P PP P PP P P S P P P PP P P P P Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPS-PSPPRPPPPPPPSPPRPLAAKLPEP 248 Score = 37.1 bits (82), Expect = 0.021 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPP 933 PP PP P P P P S P P P PP P PP Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPP 250 Score = 36.3 bits (80), Expect = 0.036 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPP-PXPPXXPPPP 941 P PP PPP PPP PP P P PP Sbjct: 221 PPSPSPPRPPPPPPPSPPRPLAAKLPEPP 249 Score = 35.9 bits (79), Expect = 0.047 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXP 930 PSPP P PP P P + P P P PP P P Sbjct: 224 PSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPPTLGYLP 267 Score = 34.3 bits (75), Expect = 0.14 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 10/33 (30%) Frame = +3 Query: 870 PPPXPPPXPP-------PXPPP---XPPXXPPP 938 PPP PPP PP P PPP PP PPP Sbjct: 229 PPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPP 261 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PP PPP PP P PPP Sbjct: 224 PSPPRPPPPPPPSPPRPLAAKLPEPPP 250 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 46.4 bits (105), Expect = 3e-05 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG GGG G Sbjct: 141 GGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG GGG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 159 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG GGG G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 160 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG GGG G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 161 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG GGG G Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 162 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG GGG G Sbjct: 136 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 163 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG GGG G Sbjct: 137 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 164 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG GGG G Sbjct: 138 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG GGG G Sbjct: 139 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGG 155 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGG 156 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGG 157 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGG 158 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 136 GGGGGGGGGGGGGGGGGGGGGGGG 159 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 137 GGGGGGGGGGGGGGGGGGGGGGGG 160 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 138 GGGGGGGGGGGGGGGGGGGGGGGG 161 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 139 GGGGGGGGGGGGGGGGGGGGGGGG 162 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 140 GGGGGGGGGGGGGGGGGGGGGGGG 163 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 141 GGGGGGGGGGGGGGGGGGGGGGGG 164 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 142 GGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 143 GGGGGGGGGGGGGGGGGGGGGGGG 166 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 46.4 bits (105), Expect = 3e-05 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG GGG G Sbjct: 676 GGGGGGGGGGGGGGGGGGGGGGGGGGAG 703 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG GGG G Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 689 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG GGG G Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 690 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG GGG G Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 691 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG GGG G Sbjct: 665 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 692 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG GGG G Sbjct: 666 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 693 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG GGG G Sbjct: 667 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 694 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG GGG G Sbjct: 668 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 695 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG GGG G Sbjct: 669 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 696 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG GGG G Sbjct: 670 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 697 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG GGG G Sbjct: 671 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 698 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG GGG G Sbjct: 672 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 699 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG GGG G Sbjct: 673 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 700 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG GGG G Sbjct: 674 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG GGG G Sbjct: 677 GGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG GG G Sbjct: 679 GGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG GG G Sbjct: 681 GGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 43.2 bits (97), Expect = 3e-04 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GG GGG GGG GGG GGG G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGG 684 Score = 43.2 bits (97), Expect = 3e-04 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG GGG GGG GGG GGG G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGG 686 Score = 43.2 bits (97), Expect = 3e-04 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GG GGG GGG GGG GGG G Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGG 687 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GG G G G Sbjct: 683 GGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GG G G G G G Sbjct: 687 GGGGGGGGGGGGGGGAGGAGAGAGDDDG 714 Score = 35.9 bits (79), Expect = 0.047 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GG G G G G Sbjct: 689 GGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGG 682 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGG 683 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGG 685 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGG 686 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGG 687 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 665 GGGGGGGGGGGGGGGGGGGGGGGG 688 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 666 GGGGGGGGGGGGGGGGGGGGGGGG 689 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 667 GGGGGGGGGGGGGGGGGGGGGGGG 690 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 668 GGGGGGGGGGGGGGGGGGGGGGGG 691 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 669 GGGGGGGGGGGGGGGGGGGGGGGG 692 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 670 GGGGGGGGGGGGGGGGGGGGGGGG 693 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 671 GGGGGGGGGGGGGGGGGGGGGGGG 694 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 672 GGGGGGGGGGGGGGGGGGGGGGGG 695 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 673 GGGGGGGGGGGGGGGGGGGGGGGG 696 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 674 GGGGGGGGGGGGGGGGGGGGGGGG 697 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 675 GGGGGGGGGGGGGGGGGGGGGGGG 698 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 676 GGGGGGGGGGGGGGGGGGGGGGGG 699 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 677 GGGGGGGGGGGGGGGGGGGGGGGG 700 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 678 GGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 28.7 bits (61), Expect = 7.2 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = -3 Query: 936 GGGXXXGXGXXXXGGXXGXXXXXXXXXXXXXXXGXGXXGGGGXGGGGXPXEXAXRGGG 763 GGG G G GG G G GGGG GGGG A G G Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGG---------GGGGGGGGGGGGGGAGGAGAGAG 710 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GG G Sbjct: 683 GGGGGGGGGGGGGGGGGGGAGGAG 706 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 46.0 bits (104), Expect = 4e-05 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PP PPP PPP PPP PP PP P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 43.6 bits (98), Expect = 2e-04 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPP 923 + P PPP PPP PPP PPP PP Sbjct: 1305 IQPPESPPPPPPPPPPPPPPPLPP 1328 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXP 908 P PPP PPP PP P Sbjct: 1314 PPPPPPPPPPPPLPPTP 1330 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG GGG G Sbjct: 89 GGGGFGGGGGGGFGGGGGGGFGGGGGGG 116 Score = 43.2 bits (97), Expect = 3e-04 Identities = 21/36 (58%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG-GGXXPGRTXERXR 836 GGGG GG GGG GGG GGG G GG G R R Sbjct: 97 GGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFGSRAR 132 Score = 42.3 bits (95), Expect = 5e-04 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG GGG GGG GGG GGG G Sbjct: 85 GGFGGGGGFGGGGGGGFGGGGGGGFGGG 112 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/31 (61%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Frame = -2 Query: 940 GGGGXXGGXGG---GXGGGXGGGXGGGXXPG 857 GGGG GG GG G GGG GGG GGG G Sbjct: 96 GGGGGFGGGGGGGFGGGGGGGGGFGGGGGGG 126 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G G GGG GGG GGG GGG G Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGG 108 Score = 38.7 bits (86), Expect = 0.007 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GGG GG GGG GGG G Sbjct: 94 GGGGGGGFGGGGGGGFGGGGGGGGGFGG 121 Score = 38.7 bits (86), Expect = 0.007 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GGG G G GGG GGG G Sbjct: 95 GGGGGGFGGGGGGGFGGGGGGGGGFGGG 122 Score = 37.9 bits (84), Expect = 0.012 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXP 860 GG G GG GGG GGG GGG G P Sbjct: 107 GGFGGGGGGGGGFGGGGGGGFGSRARP 133 Score = 35.5 bits (78), Expect = 0.063 Identities = 17/28 (60%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXG-GGXGGGXXPG 857 GGG GG G G GGG G GG GGG G Sbjct: 84 GGGFGGGGGFGGGGGGGFGGGGGGGFGG 111 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 94 GGGGGGGFGGGGGGGFGGGGGGGG 117 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 102 GGGGGGGFGGGGGGGGGFGGGGGG 125 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 45.6 bits (103), Expect = 6e-05 Identities = 18/29 (62%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPPPXPP-PXPPPXPPPXPPXXPPPP 941 P PPP PP P PPP PPP P PPPP Sbjct: 92 PPYPPPPYPPYPPPPPYPPPPNPPYPPPP 120 Score = 45.2 bits (102), Expect = 8e-05 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP PP PPP P PPPP Sbjct: 176 PPPYPPPPNPPYPPPPNPPYPPPP 199 Score = 44.0 bits (99), Expect = 2e-04 Identities = 19/48 (39%), Positives = 22/48 (45%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 PP+PP P PP P P + P P P PP P P PPP+ Sbjct: 182 PPNPPYPPPPNPPYPPPP--NAPNPPPPNPPYPPPPNAPNPPYPPPPN 227 Score = 42.7 bits (96), Expect = 4e-04 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PP PPP PPPP Sbjct: 101 PYPPPPPYPPPPNPPYPPPPNAPYPPPP 128 Score = 42.7 bits (96), Expect = 4e-04 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP P PPP PPP P PPPP Sbjct: 164 PPNPPPPNAPYPPPPYPPPPNPPYPPPP 191 Score = 42.3 bits (95), Expect = 5e-04 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 P PP P PP P P P P P PP P P PPP+ Sbjct: 162 PPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPN 208 Score = 41.9 bits (94), Expect = 7e-04 Identities = 20/48 (41%), Positives = 23/48 (47%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 PP+PP P PP PSP + P P P PP P P PPP+ Sbjct: 127 PPNPPYPPPPNAPYPPSP--NAPYPPPPNPPYPP-PLYPPPPNPPPPN 171 Score = 41.9 bits (94), Expect = 7e-04 Identities = 19/49 (38%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXP-XPXPXXPPXPXXPXTXXXPPPH 939 PP+PP P PP P P P P P PP P P PPP+ Sbjct: 190 PPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPPN 238 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/49 (36%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXX-PXPXPXXPPXPXXPXTXXXPPPH 939 PP PP P PP P+P + P P P PP P P P P+ Sbjct: 97 PPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPN 145 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/65 (33%), Positives = 23/65 (35%), Gaps = 2/65 (3%) Frame = +3 Query: 753 PXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPP--PXPPPXPPPXPPPXPPX 926 P NPP P + P P PP P PPP P PPP P Sbjct: 151 PPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPP 210 Query: 927 XPPPP 941 PPPP Sbjct: 211 YPPPP 215 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/63 (33%), Positives = 22/63 (34%), Gaps = 1/63 (1%) Frame = +3 Query: 753 PXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXP-PPXPPPXPPPXPPXX 929 P NPP P + P P PP P PP PPP P PP Sbjct: 164 PPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYP 223 Query: 930 PPP 938 PPP Sbjct: 224 PPP 226 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/31 (58%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPP-PXPP--PXPPPXPPXXPPPP 941 P PPP PP P PP P PPP P PPPP Sbjct: 106 PPYPPPPNPPYPPPPNAPYPPPPNPPYPPPP 136 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/56 (35%), Positives = 22/56 (39%) Frame = +1 Query: 772 PXSXFXWXPPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 P + F PP PP P PP P P P P P P P P PPP+ Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYP--PPPNPPYPPPPNAPYPPPPNPPYPPPPN 137 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PP P PP PPP PP PPPP Sbjct: 81 GGHPPTNFSPNPPYPPPPYPPYPPPPP 107 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/48 (37%), Positives = 20/48 (41%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 PP+PP P PP P P P P P P P P PPP+ Sbjct: 111 PPNPPYPPPPNAPYPPPP-----NPPYPPPPNAPYPPSPNAPYPPPPN 153 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PPP PP P P PP P PP Sbjct: 149 PPPPNPPYPPPLYPPPPNPPPPNAPYPP 176 Score = 37.9 bits (84), Expect = 0.012 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 P P P PPP PP PP PPPP Sbjct: 142 PSPNAPYPPPPNPPYPPPLYPPPP 165 Score = 36.7 bits (81), Expect = 0.027 Identities = 16/48 (33%), Positives = 18/48 (37%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 PP+ P P PP P P P PP P P PPP+ Sbjct: 119 PPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPN 166 Score = 35.9 bits (79), Expect = 0.047 Identities = 18/48 (37%), Positives = 21/48 (43%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 PP+PP P PP P+P P P P PP P P PP+ Sbjct: 151 PPNPPYP-PPLYPPPPNPP--PPNAPYPPPPYPPPPNPPYPPPPNPPY 195 Score = 35.5 bits (78), Expect = 0.063 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P PPP PP PP PP PPP Sbjct: 142 PSPNAPYPPPPNPPYPPPLYPPPPNPPP 169 Score = 35.5 bits (78), Expect = 0.063 Identities = 16/48 (33%), Positives = 18/48 (37%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 PP+ P P PP P P P P P P P PPP+ Sbjct: 169 PPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPN 216 Score = 35.1 bits (77), Expect = 0.083 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PPP P P P PP P PP Sbjct: 205 PPPNPPYPPPPNAPNPPYPPPPNAPNPP 232 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/48 (35%), Positives = 20/48 (41%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 PPSP P PP P+P + P P PP P PPP+ Sbjct: 141 PPSPNAPYPP----PPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPN 184 Score = 34.3 bits (75), Expect = 0.14 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXPPP--XPPPXPPXXPPP 938 P PP PP PPP PPP P PPP Sbjct: 150 PPPNPPYPPPLYPPPPNPPPPNAPYPPPP 178 Score = 34.3 bits (75), Expect = 0.14 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PP PPP P P PP Sbjct: 212 PPPPNAPNPPYPPPPNAPNPPYPP 235 Score = 33.9 bits (74), Expect = 0.19 Identities = 18/54 (33%), Positives = 19/54 (35%), Gaps = 7/54 (12%) Frame = +1 Query: 799 PSPPXPXP-------PXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 P PP P P P P P P P P PP P P PPP+ Sbjct: 147 PYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPN 200 Score = 33.1 bits (72), Expect = 0.33 Identities = 16/48 (33%), Positives = 18/48 (37%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 PP+ P P P P P P P PP P P PPP+ Sbjct: 135 PPNAPYPPSPNAPYPPPPN---PPYPPPLYPPPPNPPPPNAPYPPPPY 179 Score = 31.5 bits (68), Expect = 1.0 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXP 932 P PP PPP P PP PP P Sbjct: 215 PNAPNPPYPPPPNAPNPPYPPPPNP 239 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP P P PP P + P P PP P P PP Sbjct: 117 PPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPP 163 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = +3 Query: 858 PGXXPP--PXPPPXPPPXPPPXPPXXPPP 938 P PP P PP PPP P PP PPP Sbjct: 210 PYPPPPNAPNPPYPPPPN-APNPPYPPPP 237 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 45.2 bits (102), Expect = 8e-05 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 P P PP PPP PPP PP PPPP Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 43.2 bits (97), Expect = 3e-04 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPP 923 P PPP PPP PPP PPP PP Sbjct: 864 PRRPPPPPPPPPPPPPPPPPPP 885 Score = 41.5 bits (93), Expect = 0.001 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 P P P PPP PPP PP PPPP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPP 883 Score = 28.7 bits (61), Expect = 7.2 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 +S P P P P P P P P P P P Sbjct: 470 ISNPSPRPHPSPHPSSNPSPNPSPNPSSDPSP 501 >SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) Length = 131 Score = 45.2 bits (102), Expect = 8e-05 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG GGG GGG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGG 76 Score = 45.2 bits (102), Expect = 8e-05 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG GGG GGG Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/27 (66%), Positives = 18/27 (66%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GGG GGG G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG GGG G G Sbjct: 56 GGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG G G Sbjct: 57 GGGGGGGGGGGGGGGGGGGGGDGDDDDG 84 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGG 76 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGG 77 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 45.2 bits (102), Expect = 8e-05 Identities = 18/37 (48%), Positives = 19/37 (51%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P + S P PPP PPP PPP PPP PPP Sbjct: 182 PLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAPPP 218 Score = 42.7 bits (96), Expect = 4e-04 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PPP PPP PPP PP PPPP Sbjct: 193 GGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 33.1 bits (72), Expect = 0.33 Identities = 26/100 (26%), Positives = 29/100 (29%), Gaps = 4/100 (4%) Frame = +1 Query: 649 PPXPFXAPXTPAXTLNPHTXXXXXXXXXXXXXXXXXXXXXXPXSXFXWXP----PSPPXP 816 PP P AP TP+ +P P P P PP P Sbjct: 110 PPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPP 169 Query: 817 XPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P P+P L P P P P P PPP Sbjct: 170 IAPAATV-PAPAVPLAAASPPPPSGGPPPPPPPPPPPPPP 208 Score = 33.1 bits (72), Expect = 0.33 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 6/30 (20%) Frame = +3 Query: 870 PPPXPPPXP----PPXPPPXPP--XXPPPP 941 PPP PP P PP PPP P PPPP Sbjct: 138 PPPPPPIAPATGGPPPPPPIAPATGGPPPP 167 Score = 32.7 bits (71), Expect = 0.44 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 6/34 (17%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPX--PPPXPPXXP----PPP 941 P P P PPP P PPP PP P PPP Sbjct: 120 PSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPP 153 Score = 32.3 bits (70), Expect = 0.59 Identities = 23/96 (23%), Positives = 27/96 (28%) Frame = +1 Query: 646 APPXPFXAPXTPAXTLNPHTXXXXXXXXXXXXXXXXXXXXXXPXSXFXWXPPSPPXPXPP 825 AP P AP P +P T P + PP PP P Sbjct: 116 APETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPP--PIAPATGGPPPPPPIAPA 173 Query: 826 XXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPP 933 P+ + P P PP P P PP Sbjct: 174 ATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPP 209 Score = 31.9 bits (69), Expect = 0.77 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP PPP PPP P PPP Sbjct: 195 PPPPPPPPPPPPPPPILELAAP--PPP 219 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P ++ S P P PP PPP P PPPP Sbjct: 120 PSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPP 156 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 5/35 (14%) Frame = +3 Query: 852 VLPGXXPPPXPPPXP-----PPXPPPXPPXXPPPP 941 V P PPP P P PP PP P PPP Sbjct: 106 VAPTPPPPPRAPETPSQAPSPPPPPTSPATRAPPP 140 Score = 30.7 bits (66), Expect = 1.8 Identities = 23/84 (27%), Positives = 25/84 (29%), Gaps = 19/84 (22%) Frame = +3 Query: 747 SXPXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPP---------------- 878 S P P P R P ++ G PPP Sbjct: 125 SPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLA 184 Query: 879 ---XPPPXPPPXPPPXPPXXPPPP 941 PPP P PPP PP PPPP Sbjct: 185 AASPPPPSGGPPPPPPPPPPPPPP 208 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/46 (30%), Positives = 15/46 (32%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P+P P P P P PP P P T PPP Sbjct: 96 PTPTPMVAQSVAPTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPP 141 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 44.0 bits (99), Expect = 2e-04 Identities = 34/106 (32%), Positives = 35/106 (33%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXGG 761 GGGG GG GG GGG G GGG G G G G GG Sbjct: 242 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGG 301 Query: 760 XLGXEPPHXPRGGXEKGXXCGG*GXLRGXXGPXXGXGGRXXXXXGL 623 G GG G GG G G G G GG G+ Sbjct: 302 ATGGGGGATGVGGGATG---GGGGATGGGVGATGGGGGATGGGGGV 344 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GGG GG GG GGG PG Sbjct: 332 GGGGGATGGGGGVTGGGGGATGGGGGPG 359 Score = 37.1 bits (82), Expect = 0.021 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGGG GG GG GGG G G GG Sbjct: 340 GGGGVTGGGGGATGGGGGPGSGG 362 Score = 36.3 bits (80), Expect = 0.036 Identities = 18/33 (54%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGG-GXGGGXXPGRTXE 845 GGGG GG GG GGG G G GGG G E Sbjct: 333 GGGGATGGGGGVTGGGGGATGGGGGPGSGGCGE 365 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG G GGG G GGG G Sbjct: 319 GGGGATGGGVGATGGGGGATGGGGGVTG 346 Score = 33.5 bits (73), Expect = 0.25 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG GG GGG G GGG G Sbjct: 326 GGVGATGGGGGATGGGGGVTGGGGGATG 353 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGG G GGG GG GG GGG Sbjct: 325 GGGVGATGGGGGATGGGGGVTGGG 348 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = -3 Query: 936 GGGXXXGXGXXXXGGXXGXXXXXXXXXXXXXXXGXGXXGGGGXGGGGXPXEXAXRGGGG 760 GGG G G GG G G G G GGG GGGG Sbjct: 291 GGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGG 349 Score = 28.7 bits (61), Expect = 7.2 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRT 851 GGGG G GGG G GGG G G T Sbjct: 318 GGGG--GATGGGVGATGGGGGATGGGGGVT 345 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 44.0 bits (99), Expect = 2e-04 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P PP PPP PPP PP PPPP Sbjct: 93 PACPPACCAPPPPPPPPPPPPPPPPPPP 120 Score = 37.5 bits (83), Expect = 0.016 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 +P P PP P PPP PP PPPP Sbjct: 87 MPTSCAPACPPACCAPPPPPPPPPPPPPP 115 Score = 34.7 bits (76), Expect = 0.11 Identities = 18/53 (33%), Positives = 19/53 (35%), Gaps = 5/53 (9%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXP-----XPXPXXPPXPXXPXTXXXPPPH 939 PP PP P PP P P +L P PP P P PP H Sbjct: 102 PPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAPCMPPCH 154 Score = 30.3 bits (65), Expect = 2.4 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 873 PPXPPPXPPPXPPP 914 PP PPP P P PPP Sbjct: 168 PPGPPPAPMPAPPP 181 Score = 29.9 bits (64), Expect = 3.1 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPP 914 PPP PPP P P PP Sbjct: 138 PPPPPPPPPAPCMPP 152 Score = 29.5 bits (63), Expect = 4.1 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 885 PPXPPPXPPPXPPXXPP 935 P PPP PPP P PP Sbjct: 136 PAPPPPPPPPPAPCMPP 152 Score = 29.5 bits (63), Expect = 4.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPP 923 P PPP PPP P P P Sbjct: 136 PAPPPPPPPPPAPCMP 151 Score = 29.1 bits (62), Expect = 5.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 888 PXPPPXPPPXPPXXPPP 938 P PPP PPP P PP Sbjct: 136 PAPPPPPPPPPAPCMPP 152 Score = 28.7 bits (61), Expect = 7.2 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPP 923 P PPP PPP P PP Sbjct: 136 PAPPPPPPPPPAPCMPP 152 Score = 28.7 bits (61), Expect = 7.2 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXP 932 P P PPP PPP P P Sbjct: 136 PAPPPPPPPPPAPCMPP 152 Score = 28.3 bits (60), Expect(2) = 0.020 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPP 911 +S V+ PPP PPP P PP Sbjct: 130 VSHVMHPAPPPPPPPPPAPCMPP 152 Score = 27.9 bits (59), Expect(2) = 0.020 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 885 PPXPPPXPPPXPPXXPPP 938 PP PPP P P PP P Sbjct: 168 PPGPPPAPMPAPPPMVVP 185 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 43.6 bits (98), Expect = 2e-04 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPP 935 PPP PPP PPP PPP PP P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSP 75 Score = 42.3 bits (95), Expect = 5e-04 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP PPP P P P Sbjct: 55 PPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 40.3 bits (90), Expect = 0.002 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPP 938 PP PPP PPP PPP PP P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSP 75 Score = 38.7 bits (86), Expect = 0.007 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXP 932 P PPP PPP PPP PP P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 38.7 bits (86), Expect = 0.007 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +3 Query: 888 PXPPPXPPPXPPXXPPPP 941 P PPP PPP PP PPPP Sbjct: 54 PPPPPPPPPPPPPPPPPP 71 Score = 37.1 bits (82), Expect = 0.021 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP PP P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSP 75 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 43.6 bits (98), Expect = 2e-04 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPPP 941 P PP PPP PPP PP PPPP Sbjct: 62 PIPPTLPPPPPPPPPPLPPPPP 83 Score = 38.7 bits (86), Expect = 0.007 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 L V P PP PP PPP PPP PP PPP Sbjct: 54 LLMVGPTVPIPPTLPPPPPPPPPPLPP--PPP 83 Score = 28.3 bits (60), Expect = 9.5 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPP 902 P + LP PPP PP PPP Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPP 82 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 43.6 bits (98), Expect = 2e-04 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPPP 941 P PP PPP PPP PP PPPP Sbjct: 286 PIPPTLPPPPPPPPPPLPPPPP 307 Score = 38.7 bits (86), Expect = 0.007 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 L V P PP PP PPP PPP PP PPP Sbjct: 278 LLMVGPTVPIPPTLPPPPPPPPPPLPP--PPP 307 Score = 28.3 bits (60), Expect = 9.5 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPP 902 P + LP PPP PP PPP Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPP 306 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 43.6 bits (98), Expect = 2e-04 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G P P PPP P PPP PP PPPP Sbjct: 299 GSAPAPPPPPPPGGAPPPPPPPPPPPP 325 Score = 43.2 bits (97), Expect = 3e-04 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PPP PPP PPP P PPPP Sbjct: 310 PGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPP---XXPPPP 941 P S P PPP P PPP PPP PP PPPP Sbjct: 295 PPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPP 334 Score = 37.5 bits (83), Expect = 0.016 Identities = 18/34 (52%), Positives = 18/34 (52%), Gaps = 7/34 (20%) Frame = +3 Query: 861 GXXPPPXPP-----PXPPPXPPP--XPPXXPPPP 941 G PP PP P PPP PPP PP PPPP Sbjct: 288 GAPVPPPPPADGSAPAPPPPPPPGGAPPPPPPPP 321 Score = 37.1 bits (82), Expect = 0.021 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 4/34 (11%) Frame = +3 Query: 852 VLPGXXPPPXPPPX----PPPXPPPXPPXXPPPP 941 V G P P PPP P P PPP P PPPP Sbjct: 284 VTGGGAPVPPPPPADGSAPAPPPPPPPGGAPPPP 317 Score = 33.1 bits (72), Expect = 0.33 Identities = 15/45 (33%), Positives = 17/45 (37%) Frame = +1 Query: 802 SPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 +P P PP P+P P P PP P P PPP Sbjct: 289 APVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPP 333 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P PP P P P P P P PP P PPP Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPP 335 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P PP P P P P P P PP P PPP Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 43.2 bits (97), Expect = 3e-04 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG GGG GGG GGG GGG G Sbjct: 457 GGDGIDGGDGGGDGGGDGGGDGGGDGGG 484 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/30 (63%), Positives = 19/30 (63%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXGGXG--GGXGGGXGGGXGGGXXPG 857 GGGG GG G GG GGG GGG GGG G Sbjct: 451 GGGGDGGGDGIDGGDGGGDGGGDGGGDGGG 480 Score = 37.9 bits (84), Expect = 0.012 Identities = 18/30 (60%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXGGXGGGXG--GGXGGGXGGGXXPG 857 GG G GG GGG G GG GGG GGG G Sbjct: 447 GGDGGGGGDGGGDGIDGGDGGGDGGGDGGG 476 Score = 35.1 bits (77), Expect = 0.083 Identities = 17/30 (56%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXG--GGXGGGXXPG 857 GG G G GGG GGG G GG GGG G Sbjct: 443 GGDGGGDGGGGGDGGGDGIDGGDGGGDGGG 472 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG GGG GGG G G G G G Sbjct: 437 GVGDGRGGDGGGDGGGGGDGGGDGIDGG 464 Score = 29.5 bits (63), Expect = 4.1 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = -1 Query: 911 GXXGXGGXXGXGXGXXSRENXGEGXXXXXGGXGXGGEGG 795 G G GG G G G + G+G GG GG+GG Sbjct: 441 GRGGDGGGDGGGGG----DGGGDGIDGGDGGGDGGGDGG 475 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG GGG GGG G G G Sbjct: 433 GCSSGVGDGRGGDGGGDGGGGGDGGGDG 460 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 43.2 bits (97), Expect = 3e-04 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP P PPP P PPPP Sbjct: 370 PTNKPPPPPPPTNGPPPPPPPTNGPPPP 397 Score = 43.2 bits (97), Expect = 3e-04 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP P PPP P PPPP Sbjct: 380 PTNGPPPPPPPTNGPPPPPPPTNGPPPP 407 Score = 40.3 bits (90), Expect = 0.002 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PPP P PPP P PPPP Sbjct: 360 PTNNTPPPPPPTNKPPPPPPPTNGPPPP 387 Score = 39.9 bits (89), Expect = 0.003 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PPP P PPP PPP PPPP Sbjct: 383 GPPPPPPPTNGPPPPPPPTNGPPPPPP 409 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/49 (38%), Positives = 21/49 (42%), Gaps = 2/49 (4%) Frame = +1 Query: 796 PPS--PPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP+ PP P PP P P + P P P P P P T PPP Sbjct: 349 PPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPP 397 Score = 39.1 bits (87), Expect = 0.005 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PP PP PPP PPPP Sbjct: 365 PPPPPPTNKPPPPPPPTNGPPPPP 388 Score = 38.7 bits (86), Expect = 0.007 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PP PP PPP PPPP Sbjct: 375 PPPPPPTNGPPPPPPPTNGPPPPP 398 Score = 38.3 bits (85), Expect = 0.009 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PPP PPP PPPP Sbjct: 366 PPPPPTNKPPPPPPPTNGPPPPPP 389 Score = 38.3 bits (85), Expect = 0.009 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PPP PPP PPPP Sbjct: 376 PPPPPTNGPPPPPPPTNGPPPPPP 399 Score = 37.9 bits (84), Expect = 0.012 Identities = 18/34 (52%), Positives = 18/34 (52%), Gaps = 7/34 (20%) Frame = +3 Query: 861 GXXPPPXP---PPXPPPX----PPPXPPXXPPPP 941 G PPP P PP PPP PPP PP PPP Sbjct: 343 GVNPPPPPTNNPPSPPPPTNNTPPPPPPTNKPPP 376 Score = 37.9 bits (84), Expect = 0.012 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPPPX---PPPXPPPXPPXXPPPP 941 P PP PPP PPP PP P PPPP Sbjct: 350 PTNNPPSPPPPTNNTPPPPPPTNKPPPPPPP 380 Score = 37.5 bits (83), Expect = 0.016 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P PPP PPP P PPP P PP Sbjct: 390 PTNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 37.1 bits (82), Expect = 0.021 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = +1 Query: 796 PPSP----PXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP P P P PP P P + P P P P P P T PPP Sbjct: 357 PPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPP 407 Score = 36.7 bits (81), Expect = 0.027 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PP PP PP PPP PPPP Sbjct: 342 GGVNPPPPPTNNPPSPPPPTNNTPPPP 368 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/45 (33%), Positives = 17/45 (37%) Frame = +1 Query: 802 SPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 +PP P P P P + P P PP P P PPP Sbjct: 364 TPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPP 408 Score = 34.3 bits (75), Expect = 0.14 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP PP P P + P P PP P P PPP Sbjct: 346 PPPPPTNNPPS----PPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPP 388 Score = 33.9 bits (74), Expect = 0.19 Identities = 19/63 (30%), Positives = 20/63 (31%) Frame = +3 Query: 753 PXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXP 932 P +PP P P P PP PPP P PPP PP Sbjct: 354 PPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPP-PTNGPPPPPPPTN 412 Query: 933 PPP 941 PP Sbjct: 413 GPP 415 Score = 33.9 bits (74), Expect = 0.19 Identities = 17/47 (36%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +1 Query: 796 PPS--PPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXP 930 PP+ PP P PP P P + P P P P P P T P Sbjct: 369 PPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 31.9 bits (69), Expect = 0.77 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPP 923 P P PPP PP PP PP Sbjct: 75 PAPPPPPPPPSSGPPLPP 92 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPP 935 P P P PPP PP P PP Sbjct: 72 PSTPAPPPPPPPPSSGPPLPP 92 Score = 29.9 bits (64), Expect = 3.1 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXP 932 + G P PP PPP P PP P Sbjct: 67 ITGGAPSTPAPPPPPPPPSSGPPLPP 92 Score = 28.7 bits (61), Expect = 7.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 885 PPXPPPXPPPXPPXXPPP 938 P P P PPP PP PP Sbjct: 72 PSTPAPPPPPPPPSSGPP 89 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 888 PXPPPXPPPXPPXXPPPP 941 P PPP PPP P PP Sbjct: 75 PAPPPPPPPPSSGPPLPP 92 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 42.7 bits (96), Expect = 4e-04 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGR 854 GGG GG GGG G G GGG GGG GR Sbjct: 88 GGGGDGGGGGGGGDGGGGGGGGGGGVGR 115 Score = 42.7 bits (96), Expect = 4e-04 Identities = 18/29 (62%), Positives = 18/29 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGR 854 GGG GG GGG GGG GGG GGG R Sbjct: 89 GGGDGGGGGGGGDGGGGGGGGGGGVGRAR 117 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GG GGG GGG Sbjct: 88 GGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GGG GG G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDG 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG 875 GGGG GG GGG GGG GGG G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGG 83 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG G G Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGG 90 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG G G Sbjct: 64 GGGGGGGGGGGGGGGGGGGGDDGDGGGG 91 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG G GGG G Sbjct: 67 GGGGGGGGGGGGGGGGGDDGDGGGGDGG 94 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG G GGG G Sbjct: 68 GGGGGGGGGGGGGGGGDDGDGGGGDGGG 95 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG G GGG GGG G Sbjct: 72 GGGGGGGGGGGGDDGDGGGGDGGGGGGG 99 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG G GGG GGG GGG G Sbjct: 76 GGGGGGGGDDGDGGGGDGGGGGGGGDGG 103 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GGG GGG GGG GG G Sbjct: 80 GGGGDDGDGGGGDGGGGGGGGDGGGGGG 107 Score = 38.7 bits (86), Expect = 0.007 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = -1 Query: 935 GGGXXXVXGXXGXGGXXGXGXGXXSRENXGEGXXXXXGGXGXGGEGG 795 GGG G G GG G G G G+G GG G GG GG Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGG 108 Score = 38.3 bits (85), Expect = 0.009 Identities = 18/30 (60%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXGGXGG--GXGGGXGGGXGGGXXPG 857 GGGG GG GG G GGG GG GGG G Sbjct: 73 GGGGGGGGGGGDDGDGGGGDGGGGGGGGDG 102 Score = 37.9 bits (84), Expect = 0.012 Identities = 18/30 (60%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXGGXGGGXGG--GXGGGXGGGXXPG 857 GGGG GG GGG GG G GGG GG G Sbjct: 69 GGGGGGGGGGGGGGGDDGDGGGGDGGGGGG 98 Score = 37.9 bits (84), Expect = 0.012 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G GGG GGG GGG GGG G Sbjct: 86 GDGGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 37.5 bits (83), Expect = 0.016 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G G G GG GGG GGG G Sbjct: 77 GGGGGGGDDGDGGGGDGGGGGGGGDGGG 104 Score = 37.5 bits (83), Expect = 0.016 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GGG GG GGG G G G Sbjct: 79 GGGGGDDGDGGGGDGGGGGGGGDGGGGG 106 Score = 35.9 bits (79), Expect = 0.047 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRT 851 GGGG GG GGG GGG GGG G G T Sbjct: 93 GGGGGGGGDGGG-GGGGGGGGVGRARFGST 121 Score = 29.9 bits (64), Expect = 3.1 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGGX*XXNLPTXPGGG 721 G GGGG GGGG GGGG GGG Sbjct: 68 GGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGG 104 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 42.3 bits (95), Expect = 5e-04 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG GGG G Sbjct: 308 GGGGGDGGGGGG-GGGGGGGDGGGDGDG 334 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG G G G G G Sbjct: 309 GGGGDGGGGGGGGGGGGGDGGGDGDGDG 336 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG GGG GGG GGG G G G Sbjct: 311 GGDGGGGGGGGGGGGGDGGGDGDGDGDG 338 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG G G G G G Sbjct: 315 GGGGGGGGGGGGDGGGDGDGDGDGDGDG 342 Score = 38.3 bits (85), Expect = 0.009 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G GGG GGG GGG GGG G Sbjct: 302 GDGDGDGGGGGDGGGGGGGGGGGGGDG 328 Score = 38.3 bits (85), Expect = 0.009 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG GGG GGG GGG G G G Sbjct: 306 GDGGGGGDGGGGGGGGGGGGGDGGGDG 332 Score = 37.9 bits (84), Expect = 0.012 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG G G GGG GGG GGG G Sbjct: 304 GDGDGGGGGDGGGGGGGGGGGGGDGGG 330 Score = 37.9 bits (84), Expect = 0.012 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG G G G G G G G Sbjct: 319 GGGGGGGGDGGGDGDGDGDGDGDGDGDG 346 Score = 37.5 bits (83), Expect = 0.016 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG GG GGG GGG GGG G Sbjct: 302 GDGDGDGGGGGDGGGGGGGGGGGGGDGG 329 Score = 35.5 bits (78), Expect = 0.063 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG G G G G G G G Sbjct: 314 GGGGGGGGGGGGGDGGGDGDGDGDGDG 340 Score = 32.3 bits (70), Expect = 0.59 Identities = 17/47 (36%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = -1 Query: 935 GGGXXXVXGXXGXGGXXGXGXGXXSRENXGEGXXXXXG-GXGXGGEG 798 GGG G G GG G G G + G+G G G G G +G Sbjct: 309 GGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDGDGDDG 355 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = -1 Query: 935 GGGXXXVXGXXGXGGXXGXGXGXXSRENXGEGXXXXXGGXGXG 807 GGG G G GG G G G + G+G G G G Sbjct: 315 GGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDGDGDDGWG 357 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/45 (31%), Positives = 17/45 (37%) Frame = -1 Query: 932 GGXXXVXGXXGXGGXXGXGXGXXSRENXGEGXXXXXGGXGXGGEG 798 GG G G GG G G G + G+G G G+G Sbjct: 308 GGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDGDG 352 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 42.3 bits (95), Expect = 5e-04 Identities = 32/98 (32%), Positives = 34/98 (34%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXGG 761 GGGG G GGG GG GG GGG G T + G GG Sbjct: 63 GGGGGATGGGGGATGGHGGATGGGG--GATGDGGGATGGGGGATGGGGGATGGHGGATGG 120 Query: 760 XLGXEPPHXPRGGXEKGXXCGG*GXLRGXXGPXXGXGG 647 +G H G G GG G G G G GG Sbjct: 121 GVGATGGHGGATGGH-GGATGGHGGATGGGGGATGGGG 157 Score = 36.3 bits (80), Expect = 0.036 Identities = 31/100 (31%), Positives = 31/100 (31%), Gaps = 2/100 (2%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG--GXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGX 767 G GG GG GG GGG GG GG G G T G Sbjct: 45 GHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGAT 104 Query: 766 GGXLGXEPPHXPRGGXEKGXXCGG*GXLRGXXGPXXGXGG 647 GG G H G G G G G G G GG Sbjct: 105 GGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGG 144 Score = 35.1 bits (77), Expect = 0.083 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GG GG GGG G GGG G Sbjct: 134 GHGGATGGHGGATGGGGGATGGGGGATG 161 Score = 35.1 bits (77), Expect = 0.083 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GG GG GGG G GGG G Sbjct: 141 GHGGATGGGGGATGGGGGATGGGGGATG 168 Score = 34.7 bits (76), Expect = 0.11 Identities = 32/101 (31%), Positives = 32/101 (31%), Gaps = 3/101 (2%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXGG 761 G GG GG GG GGG GG GGG G G G G G Sbjct: 38 GHGGATGGHGGATGGG-GGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGA 96 Query: 760 XLGXEPPHXPRG---GXEKGXXCGG*GXLRGXXGPXXGXGG 647 G G G G GG G G G G GG Sbjct: 97 TGGGGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGG 137 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGGG G GGG GG GG GG Sbjct: 147 GGGGGATGGGGGATGGGGGATGG 169 Score = 33.1 bits (72), Expect = 0.33 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GG G G GGG GG GG GGG Sbjct: 140 GGHGGATGGGGGATGGGGGATGGG 163 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPGRT 851 GG G GGG G GGG G G T Sbjct: 140 GGHGGATGGGGGATGGGGGATGGGGGAT 167 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 41.9 bits (94), Expect = 7e-04 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP PP PP PPP P PPP Sbjct: 72 PAAPPPPAAPPAAPPPPPPLPAPPPPP 98 Score = 39.9 bits (89), Expect = 0.003 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP PPP P P PPP P PPP Sbjct: 85 PPPPPPLPAPPPPPAQPAPQPPP 107 Score = 38.3 bits (85), Expect = 0.009 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P S P PPP P PP PP PP PPPP Sbjct: 53 PPPSPPAAAPAAPPPPAAAPAAPP-PPAAPPAAPPPP 88 Score = 38.3 bits (85), Expect = 0.009 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P PPP PP PP PP P PP Sbjct: 68 PAAAPAAPPPPAAPPAAPPPPPPLPAPP 95 Score = 37.5 bits (83), Expect = 0.016 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PP PPP P P PP P P Sbjct: 76 PPPAAPPAAPPPPPPLPAPPPPPAQPAP 103 Score = 37.5 bits (83), Expect = 0.016 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP P P PPP P P PP P Sbjct: 82 PAAPPPPPPLPAPPPPPAQPAPQPPPAP 109 Score = 37.1 bits (82), Expect = 0.021 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPPP 941 P PP PP PPP PP PPP Sbjct: 75 PPPPAAPPAAPPPPPPLPAPPP 96 Score = 37.1 bits (82), Expect = 0.021 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP PP PP PP P PPP Sbjct: 81 PPAAPPPPPPLPAPPPPPAQPAPQPPP 107 Score = 35.9 bits (79), Expect = 0.047 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +3 Query: 870 PPPXPPPXPPP-XPPPXPPXXPP 935 PPP P P PPP P P PP PP Sbjct: 88 PPPLPAPPPPPAQPAPQPPPAPP 110 Score = 35.1 bits (77), Expect = 0.083 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 885 PPXPPPXPPPXPPXXPPPP 941 PP PPP PP P PPPP Sbjct: 50 PPPPPPSPPAAAPAAPPPP 68 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 6/29 (20%) Frame = +3 Query: 873 PPXPPPXPP------PXPPPXPPXXPPPP 941 PP PPP PP P PP P PPPP Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPP 78 Score = 34.3 bits (75), Expect = 0.14 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P PP PP P P PPP PP P Sbjct: 89 PPLPAPPPPPAQPAPQPPPAPPHFLP 114 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P P P + P P P P P PPP Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPP 96 Score = 32.3 bits (70), Expect = 0.59 Identities = 17/50 (34%), Positives = 20/50 (40%), Gaps = 2/50 (4%) Frame = +1 Query: 796 PPSPPXPXP-PXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXP-PPH 939 P +PP P P P+ + P P P PP P P P PPH Sbjct: 62 PAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPPH 111 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 41.9 bits (94), Expect = 7e-04 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXR 836 GG G GG GGG GGG GGG GG G R R Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGR 371 Score = 36.7 bits (81), Expect = 0.027 Identities = 18/34 (52%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXG-GGXGGGXXPGRTXER 842 GGGG GG GGG GGG G G G P R+ R Sbjct: 348 GGGGGGGGGGGGRGGGGGFSSRGRGPPPRRSDFR 381 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 822 GGGGXGGGGXPXEXAXRGGGG 760 GGGG GGGG RGGGG Sbjct: 344 GGGGGGGGGGGGGGGGRGGGG 364 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 342 GGGGGGGGGGGGGGGGGGRGGGGG 365 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG G G GGG GGG Sbjct: 80 GGGGCGGGGGGGGGVGGGGGGGGG 103 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GG G GG GGG GGG GGG GGG Sbjct: 82 GGCGGGGGGGGGVGGGGGGGGGGG 105 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/31 (61%), Positives = 19/31 (61%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRTXE 845 GGG GG GGG GGG GGG GGG G E Sbjct: 80 GGGGCGGGGGG-GGGVGGGGGGGGGGGDDCE 109 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG G G GGG GGG GGG G Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGG 101 Score = 35.5 bits (78), Expect = 0.063 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG GGG Sbjct: 90 GGGGVGGGGGGGGGGGDDCEDGGG 113 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG G G GGG GGG G G Sbjct: 85 GGGGGGGGGVGGGGGGGGGGGDDCEDG 111 Score = 34.3 bits (75), Expect = 0.14 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GG G Sbjct: 89 GGGGGVGGGGGGGGGGGDDCEDGGGDDG 116 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 82 GGCGGGGGGGGGVGGGGGGGGGGG 105 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 822 GGGGXGGGGXPXEXAXRGGGGX*XXNLPTXPGGG 721 GGGG GGGG GGGG GGG Sbjct: 80 GGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGG 113 Score = 29.1 bits (62), Expect = 5.5 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = -2 Query: 940 GGGGXXGGXGGGX---GGGXGGGXGGGXXPG 857 GGGG GG GG GGG G GG G Sbjct: 95 GGGGGGGGGGGDDCEDGGGDDGEDGGSDNDG 125 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GGG G G G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDG 67 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG G G G G Sbjct: 42 GGGGGGGGGGGGGGGGGGDGDGDG 65 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG G G G G Sbjct: 44 GGGGGGGGGGGGGGGGDGDGDGDG 67 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG G G G G G Sbjct: 48 GGGGGGGGGGGGDGDGDGDGDANANADG 75 Score = 32.3 bits (70), Expect = 0.59 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 6/34 (17%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGX------GGGXGGGXXPG 857 GGGG GG G G G G GGG GGG G Sbjct: 52 GGGGGGGGDGDGDGDGDANANADGGGGGGGGGDG 85 Score = 29.5 bits (63), Expect = 4.1 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 6/34 (17%) Frame = -2 Query: 940 GGGGXXGGXGGGX------GGGXGGGXGGGXXPG 857 GGGG G G G GGG GGG G G G Sbjct: 56 GGGGDGDGDGDGDANANADGGGGGGGGGDGDGDG 89 Score = 29.1 bits (62), Expect = 5.5 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGGX*XXNLPTXPGGG 721 G GGGG GGGG G G N GGG Sbjct: 42 GGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGG 78 Score = 28.7 bits (61), Expect = 7.2 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGGX*XXNLPTXPGGG 721 G GGGG GGGG G G N GGG Sbjct: 44 GGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGG 80 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G GGG GGG G G G Sbjct: 65 GDGDANANADGGGGGGGGGDGDGDGDG 91 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 9/46 (19%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPP----XPPPXPPPXP-----PXXPPPP 941 P LS LP PPP PPP PPP P P P P PPPP Sbjct: 701 PPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPP 746 Score = 36.7 bits (81), Expect = 0.027 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 6/29 (20%) Frame = +3 Query: 870 PPPXPPPXPP------PXPPPXPPXXPPP 938 PPP PPP PP P PPP PP PPP Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPP--PPP 720 Score = 36.3 bits (80), Expect = 0.036 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 3/26 (11%) Frame = +3 Query: 873 PPXPPPXPPP---XPPPXPPXXPPPP 941 PP PPP PPP P PP PPPP Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPP 719 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 7/34 (20%) Frame = +3 Query: 861 GXXPPPXPP-------PXPPPXPPPXPPXXPPPP 941 G PPP P P PPP PPP PPPP Sbjct: 724 GLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPP 757 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG P PPP PPP PP PPPP Sbjct: 734 PGCAGLPPPPPPPPPGCAGLPP--PPPP 759 Score = 32.7 bits (71), Expect = 0.44 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P PP P PP P P S P PP P PPP Sbjct: 712 PPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPP 757 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 5/29 (17%) Frame = +3 Query: 861 GXXPPPXPPP-----XPPPXPPPXPPXXP 932 G PPP PPP PPP PP P P Sbjct: 738 GLPPPPPPPPPGCAGLPPPPPPIDVPMKP 766 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 6/29 (20%) Frame = +3 Query: 873 PPXPPPXPP------PXPPPXPPXXPPPP 941 PP PPP P PPP PP PPPP Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPPP--PPPP 703 Score = 28.7 bits (61), Expect = 7.2 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 8/54 (14%) Frame = +1 Query: 796 PPSPPXPX--------PPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPP 933 PP PP P PP P P S P P P PP P PP Sbjct: 678 PPPPPLPVIEGSSLSVPPPPPPPPPPLLS-GTLPMPPPPPPPPPGCAGLPPPPP 730 Score = 28.3 bits (60), Expect = 9.5 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 1/48 (2%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXP-XXPXTXXXPPP 936 PP PP P P P P P PP P P PPP Sbjct: 695 PPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPP 742 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GGG G G GGG GGG G Sbjct: 82 GGGGDGDGGGGGDGDGGGGGDGGGGGDG 109 Score = 38.3 bits (85), Expect = 0.009 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG G G GGG G G GGG G Sbjct: 77 GGGCDGGGGDGDGGGGGDGDGGGGGDG 103 Score = 38.3 bits (85), Expect = 0.009 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GGG GGG G G GG G Sbjct: 90 GGGGDGDGGGGGDGGGGGDGGGGNDDDG 117 Score = 37.5 bits (83), Expect = 0.016 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG G G GGG G G GGG G Sbjct: 84 GGDGDGGGGGDGDGGGGGDGGGGGDGGG 111 Score = 36.7 bits (81), Expect = 0.027 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG G GGG GG GG GGG Sbjct: 89 GGGGGDGDGGGGGDGGGGGDGGGG 112 Score = 35.1 bits (77), Expect = 0.083 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GG G G GGG G G G Sbjct: 73 GGGDGGGCDGGGGDGDGGGGGDGDGGG 99 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG GG G G GGG G G GGG G Sbjct: 78 GGCDGGGGDGDGGGGGDGDGGGGGDGGG 105 Score = 33.1 bits (72), Expect = 0.33 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GG G G GGG G Sbjct: 70 GDDGGGDGGGCDGGGGDGDGGGGGDG 95 Score = 32.3 bits (70), Expect = 0.59 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G GGG GGG GG G G G Sbjct: 65 GDGNVGDDGGGDGGGCDGGGGDGDGGG 91 Score = 29.5 bits (63), Expect = 4.1 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = -2 Query: 940 GGGGXXGGXGGGXGG-GXGGGXGGGXXPG 857 GGG G GGG G G GGG G G G Sbjct: 73 GGGDGGGCDGGGGDGDGGGGGDGDGGGGG 101 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = -1 Query: 902 GXGGXXGXGXGXXSRENXGEGXXXXXGGXGXGGEGG 795 G GG G G G+G G G GG+GG Sbjct: 75 GDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGG 110 Score = 28.3 bits (60), Expect = 9.5 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = -3 Query: 936 GGGXXXGXGXXXXGGXXGXXXXXXXXXXXXXXXGXGXXGGGGXGGGGXPXEXAXRGGGG 760 GGG G G G G GG G GGGG GGGG Sbjct: 54 GGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGG 112 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/25 (72%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = -2 Query: 940 GGGGXXGGXGGGX-GGGXGGGXGGG 869 GGGG GG GGG GGG GGG GGG Sbjct: 116 GGGGYGGGRGGGGYGGGRGGGYGGG 140 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/30 (63%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGX-GGGXGGGXXPGR 854 GGG GG GGG GGG GGG GGG GR Sbjct: 112 GGGRGGGGYGGGRGGGGYGGGRGGGYGGGR 141 Score = 36.7 bits (81), Expect = 0.027 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GG GGG GGG GG G Sbjct: 99 GGGGYGGSSRGGYGGGRGGGGYGGGRGG 126 Score = 36.7 bits (81), Expect = 0.027 Identities = 17/28 (60%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGX-GGGXGGGXXPG 857 GG GG GGG GGG GGG GGG G Sbjct: 104 GGSSRGGYGGGRGGGGYGGGRGGGGYGG 131 Score = 35.9 bits (79), Expect = 0.047 Identities = 17/27 (62%), Positives = 17/27 (62%), Gaps = 3/27 (11%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGG---XGGGXGGG 869 GGGG GG GGG GGG GGG GG Sbjct: 125 GGGGYGGGRGGGYGGGRRDYGGGSKGG 151 Score = 33.1 bits (72), Expect = 0.33 Identities = 16/27 (59%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = -2 Query: 934 GGXXGGXGGGX-GGGXGGGXGGGXXPG 857 GG GG GGG GGG GGG GG G Sbjct: 109 GGYGGGRGGGGYGGGRGGGGYGGGRGG 135 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 GGG GG GGG GG GGG Sbjct: 130 GGGRGGGYGGGRRDYGGGSKGGG 152 Score = 29.5 bits (63), Expect = 4.1 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 3/30 (10%) Frame = -2 Query: 937 GGGXXGGX---GGGXGGGXGGGXGGGXXPG 857 GG GG GGG GG GG GGG G Sbjct: 89 GGSRAGGYRSGGGGYGGSSRGGYGGGRGGG 118 Score = 28.3 bits (60), Expect = 9.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGR 854 G GG G GGG GG GG GR Sbjct: 87 GAGGSRAGGYRSGGGGYGGSSRGGYGGGR 115 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/32 (53%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = +3 Query: 852 VLPGXXPPPXPP--PXPPPXPPPXPPXXPPPP 941 V P PPP PP PPP PP P PPPP Sbjct: 548 VTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPP 579 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/27 (59%), Positives = 16/27 (59%), Gaps = 3/27 (11%) Frame = +3 Query: 870 PPPXPP---PXPPPXPPPXPPXXPPPP 941 PPP PP P PPP PP P PPPP Sbjct: 564 PPPLPPSEDPKPPPPPPEPPEECPPPP 590 Score = 36.3 bits (80), Expect = 0.036 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXP---PPP 941 PG PP PP P PPP PP P PPP Sbjct: 559 PGVDIPPPLPPSEDPKPPPPPPEPPEECPPP 589 Score = 35.1 bits (77), Expect = 0.083 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 +P PP P PPP P P PPPP Sbjct: 563 IPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 >SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) Length = 292 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GG GGG G Sbjct: 175 GGGMGGGMGGGMGGGMEGGMGGGMMEG 201 Score = 37.5 bits (83), Expect = 0.016 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GGG GGG GGG GGG G Sbjct: 167 GGGMMSMAGGGMGGGMGGGMGGGMEGG 193 Score = 34.3 bits (75), Expect = 0.14 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGG GG GGG GG GGG GG Sbjct: 145 GGGMSMGGMGGGMGGMMGGGSMGG 168 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GGG G Sbjct: 162 GGGSMGGGMMSMAGGGMGGGMGGGMGGG 189 Score = 33.1 bits (72), Expect = 0.33 Identities = 16/28 (57%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -2 Query: 937 GGGXXGGXG-GGXGGGXGGGXGGGXXPG 857 GGG GG GG GGG GG GGG G Sbjct: 141 GGGMGGGMSMGGMGGGMGGMMGGGSMGG 168 Score = 29.9 bits (64), Expect = 3.1 Identities = 16/27 (59%), Positives = 16/27 (59%), Gaps = 3/27 (11%) Frame = -2 Query: 940 GGGGXXGGX--GGGXGGGXG-GGXGGG 869 G GG GG GGG GGG GG GGG Sbjct: 130 GEGGMGGGMSMGGGMGGGMSMGGMGGG 156 Score = 29.9 bits (64), Expect = 3.1 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 6/30 (20%) Frame = -2 Query: 940 GGGGXXGGXGGGXG------GGXGGGXGGG 869 GGG GG GGG G GG GG GGG Sbjct: 209 GGGMMGGGMGGGMGFNGMEDGGKEGGMGGG 238 Score = 28.7 bits (61), Expect = 7.2 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 5/32 (15%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGX-----GGGXGGGXXPG 857 GGG G GGG GG GGG GGG G Sbjct: 154 GGGMGGMMGGGSMGGGMMSMAGGGMGGGMGGG 185 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GGG G G GGG GGG G Sbjct: 97 GGGGDGDGGGGGDGDGGGGGDGGGGGDG 124 Score = 38.3 bits (85), Expect = 0.009 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG G G GGG G G GGG G Sbjct: 92 GGGCDGGGGDGDGGGGGDGDGGGGGDG 118 Score = 38.3 bits (85), Expect = 0.009 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GGG GGG G G GG G Sbjct: 105 GGGGDGDGGGGGDGGGGGDGGGGNDDDG 132 Score = 37.5 bits (83), Expect = 0.016 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG G G GGG G G GGG G Sbjct: 99 GGDGDGGGGGDGDGGGGGDGGGGGDGGG 126 Score = 36.7 bits (81), Expect = 0.027 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG G GGG GG GG GGG Sbjct: 104 GGGGGDGDGGGGGDGGGGGDGGGG 127 Score = 35.1 bits (77), Expect = 0.083 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GG G G GGG G G G Sbjct: 88 GGGDGGGCDGGGGDGDGGGGGDGDGGG 114 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG GG G G GGG G G GGG G Sbjct: 93 GGCDGGGGDGDGGGGGDGDGGGGGDGGG 120 Score = 33.1 bits (72), Expect = 0.33 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GG G G GGG G Sbjct: 85 GDDGGGDGGGCDGGGGDGDGGGGGDG 110 Score = 32.3 bits (70), Expect = 0.59 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G GGG GGG GG G G G Sbjct: 80 GDGNVGDDGGGDGGGCDGGGGDGDGGG 106 Score = 29.5 bits (63), Expect = 4.1 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = -2 Query: 940 GGGGXXGGXGGGXGG-GXGGGXGGGXXPG 857 GGG G GGG G G GGG G G G Sbjct: 88 GGGDGGGCDGGGGDGDGGGGGDGDGGGGG 116 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = -1 Query: 902 GXGGXXGXGXGXXSRENXGEGXXXXXGGXGXGGEGG 795 G GG G G G+G G G GG+GG Sbjct: 90 GDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGG 125 Score = 28.3 bits (60), Expect = 9.5 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = -3 Query: 936 GGGXXXGXGXXXXGGXXGXXXXXXXXXXXXXXXGXGXXGGGGXGGGGXPXEXAXRGGGG 760 GGG G G G G GG G GGGG GGGG Sbjct: 69 GGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGG 127 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 40.3 bits (90), Expect = 0.002 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPP 938 PP PPP PP PPP P PPP Sbjct: 1031 PPTPPPTEPPTPPPTEPPTPPP 1052 Score = 39.9 bits (89), Expect = 0.003 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 PPP PP PPP PP PP PP Sbjct: 1034 PPPTEPPTPPPTEPPTPPPTDPP 1056 Score = 37.5 bits (83), Expect = 0.016 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PP PP PP PP PP P Sbjct: 1023 PPTEPPTDPPTPPPTEPPTPPPTEPPTP 1050 Score = 35.5 bits (78), Expect = 0.063 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP--PP 941 P PP PP PP PP PP PP PP Sbjct: 1027 PPTDPPTPPPTEPPTPPPTEPPTPPPTDPP 1056 Score = 35.1 bits (77), Expect = 0.083 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P PP PPP PP PPP P P Sbjct: 1034 PPPTEPPTPPPTEPPTPPPTDPPTQP 1059 Score = 33.5 bits (73), Expect = 0.25 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 P PP PP PP PP PP P Sbjct: 1020 PTDPPTEPPTDPPTPPPTEPPTP 1042 Score = 32.7 bits (71), Expect = 0.44 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 P P PP PP PP PP PP Sbjct: 1018 PLPTDPPTEPPTDPPTPPPTEPP 1040 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPP 938 P P P PP PP P PPP Sbjct: 1016 PDPLPTDPPTEPPTDPPTPPP 1036 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/30 (56%), Positives = 17/30 (56%), Gaps = 6/30 (20%) Frame = +3 Query: 870 PPPXPPPXPP------PXPPPXPPXXPPPP 941 PPP PPP PP P PPP P PPPP Sbjct: 195 PPPPPPPPPPGFPGGAPPPPPPPFGAPPPP 224 Score = 34.3 bits (75), Expect = 0.14 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PPP PPP P PPP Sbjct: 190 PMAGMPPPPPPPPPPGFPGGAPPP 213 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PPP PP PP P PP Sbjct: 204 PGFPGGAPPPPPPPFGAPPPPALNGGPP 231 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/39 (48%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = -2 Query: 940 GGGGXXGGXG--GGXGGGXGGGXGGGXXPGRTXERXRXG 830 GGGG GG G GG GG GGG GGG G + + G Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGGGGGGGGGDEDDSGKNG 63 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGR 854 GGGG GG GGG G G G G+ Sbjct: 41 GGGGGGGGGGGGGGDEDDSGKNGKEYSGK 69 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 39.5 bits (88), Expect = 0.004 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PPP P PP PPPP Sbjct: 225 PPPPAAPAPPPPPAAAPPPPPPPP 248 Score = 37.9 bits (84), Expect = 0.012 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PP P P PPP P PP PPP Sbjct: 223 PTPPPPAAPAPPPPPAAAPPPPPPPPP 249 Score = 37.1 bits (82), Expect = 0.021 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPPP 941 P PPP P PPP P PPPP Sbjct: 223 PTPPPPAAPAPPPPPAAAPPPP 244 Score = 36.3 bits (80), Expect = 0.036 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PPP PP PPPP Sbjct: 226 PPPAAPAPPPPPAAAPPPPPPPPP 249 Score = 35.9 bits (79), Expect = 0.047 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P PP PP PP PPP PP P Sbjct: 228 PAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 34.7 bits (76), Expect = 0.11 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P PPP P PPP PP P Sbjct: 227 PPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 32.7 bits (71), Expect = 0.44 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP P P PPP P PPPP Sbjct: 215 PPEPDYLEPTPPPPAAPAPPPPP 237 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/29 (62%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGX-GGGXGGGXXPG 857 GGG GG GGG GGG GGG GGG G Sbjct: 203 GGGSGGGGYGGGRGGGGYGGGHGGGGYGG 231 Score = 37.9 bits (84), Expect = 0.012 Identities = 18/29 (62%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = -2 Query: 940 GGGGXXGGXGGG-XGGGXGGGXGGGXXPG 857 G GG GG GGG GGG GGG GGG G Sbjct: 194 GYGGSKGGYGGGSGGGGYGGGRGGGGYGG 222 Score = 37.5 bits (83), Expect = 0.016 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GG GG GGG GGG G Sbjct: 191 GGGGYGGSKGGYGGGSGGGGYGGGRGGG 218 Score = 36.7 bits (81), Expect = 0.027 Identities = 17/26 (65%), Positives = 17/26 (65%), Gaps = 2/26 (7%) Frame = -2 Query: 940 GGGGXXGGXGGGX--GGGXGGGXGGG 869 GGGG GG GGG GG GGG GGG Sbjct: 207 GGGGYGGGRGGGGYGGGHGGGGYGGG 232 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -2 Query: 940 GGGGXXGGXG-GGXGGGXGGGXGGGXXPG 857 GGG GG G GG GG GGG GGG G Sbjct: 185 GGGYRSGGGGYGGSKGGYGGGSGGGGYGG 213 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GGG GGG GGG GG G Sbjct: 200 GGYGGGSGGGGYGGGRGGGGYGGGHGG 226 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG 875 GGG GG GGG GGG GG G Sbjct: 212 GGGRGGGGYGGGHGGGGYGGGG 233 Score = 33.5 bits (73), Expect = 0.25 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXER 842 GGGG GG GGG GG G GG G +R Sbjct: 216 GGGGYGGGHGGGGYGGGGRHDYGGGSKGGGYDR 248 Score = 33.1 bits (72), Expect = 0.33 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 3/31 (9%) Frame = -2 Query: 940 GGGGXXGGX---GGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GG GG GGG G Sbjct: 179 GGGGSQGGGYRSGGGGYGGSKGGYGGGSGGG 209 Score = 30.7 bits (66), Expect = 1.8 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 2/61 (3%) Frame = -3 Query: 936 GGGXXXGXGXXXX--GGXXGXXXXXXXXXXXXXXXGXGXXGGGGXGGGGXPXEXAXRGGG 763 GGG G G GG G G GGGG GGGG GG Sbjct: 185 GGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGGGSKGG 244 Query: 762 G 760 G Sbjct: 245 G 245 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG G G GGG GGG GG G Sbjct: 198 GGGGGYGGSGYGGGGGYGGGGYGGGRSG 225 Score = 37.5 bits (83), Expect = 0.016 Identities = 18/30 (60%), Positives = 18/30 (60%), Gaps = 3/30 (10%) Frame = -2 Query: 937 GGGXXGGXGGGXGG---GXGGGXGGGXXPG 857 GGG GG GGG GG G GGG GGG G Sbjct: 192 GGGGYGGGGGGYGGSGYGGGGGYGGGGYGG 221 Score = 37.1 bits (82), Expect = 0.021 Identities = 33/98 (33%), Positives = 33/98 (33%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXGG 761 GGG GG GGG GGG G GGG G R G G G GG Sbjct: 124 GGGRRGGGYGGGRGGGGGYRSGGGYRGG---GGYRGGGGGYRGRGRGGGGYGGGGYGGGG 180 Query: 760 XLGXEPPHXPRGGXEKGXXCGG*GXLRGXXGPXXGXGG 647 G GG G GG G G G GG Sbjct: 181 YGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGG 218 Score = 35.1 bits (77), Expect = 0.083 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRT 851 G GG GG GG GG GG GGG GR+ Sbjct: 195 GYGGGGGGYGGSGYGGGGGYGGGGYGGGRS 224 Score = 32.3 bits (70), Expect = 0.59 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GG G GG G G GG GG GGG Sbjct: 204 GGSGYGGGGGYGGGGYGGGRSGGG 227 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG 875 GGGG GG GG GGG GG G Sbjct: 209 GGGGGYGG--GGYGGGRSGGGG 228 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 38.7 bits (86), Expect = 0.007 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = -1 Query: 932 GGXXXVXGXXGXGGXXGXGXGXXSRENXGEGXXXXXGGXGXGGEGG 795 GG + G GG G G G GEG GG G GGEGG Sbjct: 1793 GGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGG 1838 Score = 38.3 bits (85), Expect = 0.009 Identities = 17/25 (68%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = -2 Query: 940 GGGGXXGGXGGGXG-GGXGGGXGGG 869 GGGG GG GGG G G GGG GGG Sbjct: 1759 GGGGGGGGMGGGGGMAGGGGGMGGG 1783 Score = 38.3 bits (85), Expect = 0.009 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GG GGG G Sbjct: 1799 GGGGMAGG-GGGMGGGGGGMGGGGEGMG 1825 Score = 36.7 bits (81), Expect = 0.027 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GGG GG GG GGG G Sbjct: 1761 GGGGGGMGGGGGMAGGGGGMGGGGMAAG 1788 Score = 35.9 bits (79), Expect = 0.047 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXG-GGXGGGXXPG 857 GGGG GG GG GGG G G GGG G Sbjct: 1806 GGGGMGGGGGGMGGGGEGMGAAGGGMGAG 1834 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG GG GGG GGG G GGG G Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGGMGG 1782 Score = 33.9 bits (74), Expect = 0.19 Identities = 17/26 (65%), Positives = 17/26 (65%), Gaps = 2/26 (7%) Frame = -2 Query: 940 GGGGXX-GGXGGGXG-GGXGGGXGGG 869 GGGG G GGG G GG GGG GGG Sbjct: 1818 GGGGEGMGAAGGGMGAGGEGGGAGGG 1843 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GG G GG G GGG GGG GG Sbjct: 1794 GGEGMGGGGMAGGGGGMGGGGGG 1816 Score = 33.1 bits (72), Expect = 0.33 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXER 842 GGG G GGG G G GG GG G + ++ Sbjct: 1819 GGGEGMGAAGGGMGAGGEGGGAGGGGGGYSAQK 1851 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = -3 Query: 939 VGGGXXXGXGXXXXGGXXGXXXXXXXXXXXXXXXGXGXXGGGGXGGGG 796 +GGG G G GG G G G GGG GGGG Sbjct: 1798 MGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGG 1845 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = +3 Query: 870 PPPXPPPXPPPXP-PPXPPXXPPP 938 PPP PPP PPP P P P PPP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXP--PPP 941 P PPP P P PPP P P PPP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXP 860 GGGG GG GG GGG GG G P Sbjct: 77 GGGGFSGGGGGSMGGGGLGGLFAGGMP 103 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +3 Query: 837 RSLSXVLPGXXPPPX--PPPXPPPXPPPXPPXXPPPP 941 RS PG P P PPP PP PP PPPP Sbjct: 354 RSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPP 390 Score = 31.9 bits (69), Expect = 0.77 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP PP PP PP PPP Sbjct: 367 PLGGPPPPPPGRRPPSGKINPPPPPPP 393 Score = 31.5 bits (68), Expect = 1.0 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPX--XPPXP-XXPXTXXXPPP 936 PP PP P P P S P P P PP P P + PPP Sbjct: 216 PPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPP 265 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPP 935 +P PPP PP PPP P P PP Sbjct: 1 MPPPPPPPGPP--PPPSAPSGPVKPPP 25 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 2/26 (7%) Frame = -2 Query: 940 GGGGXXGGXGGG--XGGGXGGGXGGG 869 GGGG G GGG GGG GG GG Sbjct: 76 GGGGGFSGGGGGSMGGGGLGGLFAGG 101 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GG GG GGG GG G Sbjct: 76 GGG--GGFSGGGGGSMGGGGLGGLFAG 100 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 837 RSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 R L PG PP P P P PP PPP Sbjct: 238 RPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPP 272 Score = 29.9 bits (64), Expect = 3.1 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPP 914 PPP PP PP PPP Sbjct: 464 PPPVPPSRGPPPPPP 478 Score = 29.5 bits (63), Expect = 4.1 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 5/33 (15%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPP-----XXPPPP 941 P P PPP PPP PP PPPP Sbjct: 302 PSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPP 334 Score = 29.1 bits (62), Expect = 5.5 Identities = 16/59 (27%), Positives = 16/59 (27%) Frame = +3 Query: 762 PPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 PP P R P PPP P P PPP PPP Sbjct: 195 PPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPP 253 Score = 29.1 bits (62), Expect = 5.5 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 5/42 (11%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXP-----PPXPPXXPPPP 941 P S LP P PP P P PP P PPPP Sbjct: 232 PPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPP 273 Score = 28.7 bits (61), Expect = 7.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP PPP P P PPPP Sbjct: 371 PPPPPPGRRPPSGKINPPPPPPP 393 Score = 28.3 bits (60), Expect = 9.5 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 4/29 (13%) Frame = +3 Query: 861 GXXPPPXPPPXPP----PXPPPXPPXXPP 935 G PPP P PP PPP P PP Sbjct: 261 GEPPPPKNAPPPPKRGSSNPPPPPTRGPP 289 Score = 28.3 bits (60), Expect = 9.5 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%) Frame = +3 Query: 870 PPPXPP---PXPPPXPPPXPPXXPPPP 941 PPP PP P P PP PPPP Sbjct: 318 PPPPPPSRDQVPLPPPPLRGQIAPPPP 344 Score = 28.3 bits (60), Expect = 9.5 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 11/40 (27%) Frame = +3 Query: 855 LPGXXPPPXPP-----------PXPPPXPPPXPPXXPPPP 941 L G PP PP P PPP P P PPPP Sbjct: 335 LRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPP 374 >SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) Length = 491 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGG 881 GGGG GG GGG GGG GGG Sbjct: 320 GGGGGGGGGGGGGGGGGGGG 339 Score = 36.3 bits (80), Expect = 0.036 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = -2 Query: 922 GGXGGGXGGGXGGGXGGG 869 GG GGG GGG GGG GGG Sbjct: 320 GGGGGGGGGGGGGGGGGG 337 Score = 36.3 bits (80), Expect = 0.036 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = -2 Query: 922 GGXGGGXGGGXGGGXGGG 869 GG GGG GGG GGG GGG Sbjct: 321 GGGGGGGGGGGGGGGGGG 338 Score = 36.3 bits (80), Expect = 0.036 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = -2 Query: 922 GGXGGGXGGGXGGGXGGG 869 GG GGG GGG GGG GGG Sbjct: 322 GGGGGGGGGGGGGGGGGG 339 Score = 35.9 bits (79), Expect = 0.047 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GGG GGG GGG GG Sbjct: 320 GGG--GGGGGGGGGGGGGGGGG 339 Score = 32.7 bits (71), Expect = 0.44 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -2 Query: 913 GGGXGGGXGGGXGGGXXPG 857 GGG GGG GGG GGG G Sbjct: 320 GGGGGGGGGGGGGGGGGGG 338 Score = 32.7 bits (71), Expect = 0.44 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -2 Query: 913 GGGXGGGXGGGXGGGXXPG 857 GGG GGG GGG GGG G Sbjct: 321 GGGGGGGGGGGGGGGGGGG 339 Score = 31.9 bits (69), Expect = 0.77 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGGG GG GGG GGG G Sbjct: 324 GGGGGGGGGGGGGGGGDXXXXNG 346 Score = 29.5 bits (63), Expect = 4.1 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GG G G Sbjct: 325 GGGGGGGGGGGGGGGDXXXXNGDDDDDG 352 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 38.3 bits (85), Expect = 0.009 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GGG G GGG GGG GGG G G G R G Sbjct: 316 GGGYRSGGGGGYGGGRGGGRGYGGGRGGGGRRDYGG 351 Score = 37.5 bits (83), Expect = 0.016 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG G GGG GGG GGG G Sbjct: 312 GGGRGGGYRSGGGGGYGGGRGGGRGYG 338 Score = 36.7 bits (81), Expect = 0.027 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GG GGG GGG GG G Sbjct: 104 GGGGYGGSSRGGYGGGRGGGGYGGGRGG 131 Score = 36.3 bits (80), Expect = 0.036 Identities = 17/28 (60%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGX-GGGXGGGXXPG 857 GG GG GGG GGG GGG GGG G Sbjct: 109 GGSSRGGYGGGRGGGGYGGGRGGGGSYG 136 Score = 35.9 bits (79), Expect = 0.047 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGGG GG GGG G G G G GG Sbjct: 323 GGGGYGGGRGGGRGYGGGRGGGG 345 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG G G G G GGG GGG Sbjct: 322 GGGGGYGG-GRGGGRGYGGGRGGG 344 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -2 Query: 922 GGXGGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GG GGG G GGG GGG GR R G Sbjct: 313 GGRGGGYRSGGGGGYGGGRGGGRGYGGGRGG 343 Score = 33.5 bits (73), Expect = 0.25 Identities = 17/32 (53%), Positives = 17/32 (53%), Gaps = 4/32 (12%) Frame = -2 Query: 940 GGGGXXGGX----GGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GG GG GGG G Sbjct: 92 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGG 123 Score = 32.3 bits (70), Expect = 0.59 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGG GG GGG GGG G GGG Sbjct: 117 GGGRGGGGYGGGRGGG--GSYGGG 138 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G G GGG GGG GGG G Sbjct: 329 GGRGGGRGYGGGRGGGGRRDYGGGSRSG 356 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 913 GGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GGG GGG G GGG GR R G Sbjct: 312 GGGRGGGYRSGGGGGYGGGRGGGRGYGG 339 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG G G GG Sbjct: 121 GGGGYGGGRGGGGSYGGGRRDYGG 144 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 37.9 bits (84), Expect = 0.012 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 4/30 (13%) Frame = +3 Query: 858 PGXXPPPXPPPXPP----PXPPPXPPXXPP 935 P PP PPP PP P PPP PP PP Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPPPVMPP 106 Score = 34.3 bits (75), Expect = 0.14 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXPPPP 941 PPP PPP P P PPPP Sbjct: 82 PPPPPPPPPASNVPAPPPPP 101 Score = 31.5 bits (68), Expect = 1.0 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PPP PP PPPP Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPP 100 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXPPPP 941 PPP PPP P PPPP Sbjct: 83 PPPPPPPPASNVPAPPPPPP 102 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 37.9 bits (84), Expect = 0.012 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +3 Query: 837 RSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 R S V P PPP P P PPP PPP P P P Sbjct: 417 RRRSLVQPPPPPPPAPLP-PPPPPPPQPTTALPDP 450 Score = 36.7 bits (81), Expect = 0.027 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P R L PPP P P PPP PPP P P Sbjct: 413 PNRRRRRSLVQPPPPPPPAPLPPPPPPPPQPTTALP 448 Score = 28.3 bits (60), Expect = 9.5 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXP 932 P PPP PPP P P P P Sbjct: 430 PAPLPPPPPPPPQPTTALPDPLQGP 454 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 37.5 bits (83), Expect = 0.016 Identities = 20/37 (54%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGG--XGGGXGGGXXPGRTXERXR 836 GGG GG G G GGG GGG G G G T ER R Sbjct: 173 GGGEGGGGRGRGTGGGSRGGGGDGRGRGRGGTEERTR 209 Score = 37.1 bits (82), Expect = 0.021 Identities = 20/39 (51%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -2 Query: 940 GGGGXXGGXGG--GXGGGXGGGXGGGXXPGRTXERXRXG 830 G GG GG GG G GGG GGG GGG T R G Sbjct: 154 GRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGG 192 Score = 35.9 bits (79), Expect = 0.047 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGR 854 GG G G GGG G G GGG G G GR Sbjct: 127 GGRGGWRGRGGGEGNGAGGGIGRGGGRGR 155 Score = 35.9 bits (79), Expect = 0.047 Identities = 19/36 (52%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGG-GXGGGXXPGRTXERXR 836 G GG GG GGG GGG G G GGG G R R Sbjct: 164 GRGGNGGGRGGGEGGGGRGRGTGGGSRGGGGDGRGR 199 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 GGG G GGG G G G G GGG Sbjct: 136 GGGEGNGAGGGIGRGGGRGRGGG 158 Score = 31.5 bits (68), Expect = 1.0 Identities = 25/84 (29%), Positives = 28/84 (33%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXGG 761 G G GG G G GGG G G G G G R G G + G Sbjct: 131 GWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSR 190 Query: 760 XLGXEPPHXPRGGXEKGXXCGG*G 689 G + RGG E+ G G Sbjct: 191 GGGGDGRGRGRGGTEERTRIEGYG 214 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 37.5 bits (83), Expect = 0.016 Identities = 36/105 (34%), Positives = 37/105 (35%), Gaps = 8/105 (7%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGG---GXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGX 767 GGG G GG GG GG G GG G E G G Sbjct: 427 GGGYEGRGRGGRGGPRGGGPRGYDGGYGQGGGYEGYSGGYRDDYGYGGGSYDHYDSYYGG 486 Query: 766 G--GXLGXEPPH-XPRGGXEKGXXCGG--*GXLRGXXGPXXGXGG 647 G G PP PRGG +G GG G RG GP G GG Sbjct: 487 GYDDYYGGGPPRGGPRGG--RGGSRGGPPRGAPRGRSGPPRGRGG 529 Score = 31.5 bits (68), Expect = 1.0 Identities = 31/102 (30%), Positives = 33/102 (32%), Gaps = 8/102 (7%) Frame = -2 Query: 937 GGGXXGGXGG-GXGGGXGGGXGG-----GXXPGRTXERXRXGXXXXXXXXXXXGPKXXRX 776 GGG G GG G GGG G GG G G P+ Sbjct: 443 GGGPRGYDGGYGQGGGYEGYSGGYRDDYGYGGGSYDHYDSYYGGGYDDYYGGGPPRGGPR 502 Query: 775 XGXGGXLGXEPPHXPRG--GXEKGXXCGG*GXLRGXXGPXXG 656 G GG G P PRG G +G G G G G G Sbjct: 503 GGRGGSRGGPPRGAPRGRSGPPRGRGGGDFGGRGGRGGTTPG 544 Score = 28.7 bits (61), Expect = 7.2 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GGG GG GG GG GG G R R G Sbjct: 493 GGGPPRGGPRGGRGGSRGGPPRGAPRGRSGPPRGRGG 529 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 37.5 bits (83), Expect = 0.016 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PPP PP P P P PP P PP Sbjct: 93 GDPPPPATPPPPTMPPTPPPPQTPAPP 119 Score = 35.9 bits (79), Expect = 0.047 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXP--PXXPPPP 941 P PPP PP PPP P P P P PP Sbjct: 98 PATPPPPTMPPTPPPPQTPAPPGPDTPAPP 127 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PP PPP P P P P P P Sbjct: 103 PPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PPP P PP PP P Sbjct: 102 PPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 37.1 bits (82), Expect = 0.021 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXPPPP 941 PPP P PPP PP PPPP Sbjct: 73 PPPLCAPPPPPPPPPPPPPP 92 Score = 37.1 bits (82), Expect = 0.021 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PPP PPP PPP P P Sbjct: 74 PPLCAPPPPPPPPPPPPPPPGAKKPDDP 101 Score = 36.7 bits (81), Expect = 0.027 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +3 Query: 837 RSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPP 935 +S++ P P PPP PPP PPP P P Sbjct: 66 KSMAAATPPPLCAPPPPPPPPPPPPPPPGAKKP 98 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 37.1 bits (82), Expect = 0.021 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXPPPP 941 PPP P PPP PP PPPP Sbjct: 274 PPPLCAPPPPPPPPPPPPPP 293 Score = 37.1 bits (82), Expect = 0.021 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PPP PPP PPP P P Sbjct: 275 PPLCAPPPPPPPPPPPPPPPGAKKPDDP 302 Score = 36.7 bits (81), Expect = 0.027 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +3 Query: 837 RSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPP 935 +S++ P P PPP PPP PPP P P Sbjct: 267 KSMAAATPPPLCAPPPPPPPPPPPPPPPGAKKP 299 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 37.1 bits (82), Expect = 0.021 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXP--PXXPPPP 941 LP PPP PP P PPP P P P PP Sbjct: 451 LPSDEPPPLPPDEEKPPPPPAPALPPLPLPP 481 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPP 938 PP P PPP PP PPP Sbjct: 449 PPLPSDEPPPLPPDEEKPPPPP 470 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LP P PPP P P P PP P P Sbjct: 459 LPPDEEKPPPPPAPALPPLPLPPELPGSP 487 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 2/21 (9%) Frame = +3 Query: 885 PPXPPPXPPPXPP--XXPPPP 941 PP P PPP PP PPPP Sbjct: 449 PPLPSDEPPPLPPDEEKPPPP 469 Score = 28.7 bits (61), Expect = 7.2 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = +3 Query: 837 RSLSXVLPGXXPPPXPPPXPPPXP-PPXPPXXPPPP 941 R+ + LP P PPP PP PP PP PP Sbjct: 442 RASAATLP-PLPSDEPPPLPPDEEKPPPPPAPALPP 476 >SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) Length = 595 Score = 37.1 bits (82), Expect = 0.021 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRTXER 842 GGG GG GGG GGG GG G G T R Sbjct: 514 GGGGGGGGGGGGGGGGRGGRGRGRPTTTTTTR 545 Score = 36.7 bits (81), Expect = 0.027 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXER 842 GGGG GG GGG GGG GG G T R Sbjct: 514 GGGGGGGGGGGGGGGGRGGRGRGRPTTTTTTRR 546 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 822 GGGGXGGGGXPXEXAXRGGGG 760 GGGG GGGG RGG G Sbjct: 514 GGGGGGGGGGGGGGGGRGGRG 534 >SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) Length = 304 Score = 37.1 bits (82), Expect = 0.021 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 G G GG GG GGG GGG GGG Sbjct: 41 GAGRGGGRGGPRGGGRGGGRGGG 63 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXG 875 GGG G GGG GGG GGG G Sbjct: 45 GGGRGGPRGGGRGGGRGGGGG 65 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/30 (56%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = -2 Query: 937 GGGXXGGXGGGXG--GGXGGGXGGGXXPGR 854 GGG GG GGG G GGG GGG GR Sbjct: 53 GGGRGGGRGGGGGFKSPRGGGRGGGRGGGR 82 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG 875 GGGG GGG GGG GGG G Sbjct: 62 GGGGFKSPRGGGRGGGRGGGRG 83 Score = 33.1 bits (72), Expect = 0.33 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = -2 Query: 919 GXGGGXGGGXGGGXGGGXXPGRTXERXRXG 830 G GGG GG GGG GGG G + R G Sbjct: 43 GRGGGRGGPRGGGRGGGRGGGGGFKSPRGG 72 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXG--GGXGGGXXPGR 854 GG GG GGG GGG G GGG GR Sbjct: 49 GGPRGGGRGGGRGGGGGFKSPRGGGRGGGR 78 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 913 GGGXGGGXGGGXGGGXXPGR 854 G G GGG GG GGG GR Sbjct: 41 GAGRGGGRGGPRGGGRGGGR 60 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 37.1 bits (82), Expect = 0.021 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GGG GGG GG GG Sbjct: 1003 GGGGGGGGGGGGGGGRRGGRGG 1024 Score = 36.7 bits (81), Expect = 0.027 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = -2 Query: 913 GGGXGGGXGGGXGGGXXPGRTXERXR 836 GGG GGG GGG GGG GR R R Sbjct: 1003 GGGGGGGGGGGGGGGRRGGRGGARGR 1028 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG 875 GGGG GG GGG GG GG G Sbjct: 1006 GGGGGGGGGGGGRRGGRGGARG 1027 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 922 GGXGGGXGGGXGGGXGGGXXPGR 854 GG GGG GGG GGG GG R Sbjct: 1004 GGGGGGGGGGGGGGRRGGRGGAR 1026 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 922 GGXGGGXGGGXGGGXGGGXXPGRTXER 842 GG GGG GGG GGG G G R Sbjct: 1003 GGGGGGGGGGGGGGGRRGGRGGARGRR 1029 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGG 766 G GGGG GGGG RGG Sbjct: 1003 GGGGGGGGGGGGGGGRRGGRGG 1024 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 822 GGGGXGGGGXPXEXAXRGGGG 760 GGGG GGGG RGG G Sbjct: 1003 GGGGGGGGGGGGGGGRRGGRG 1023 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 37.1 bits (82), Expect = 0.021 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP PP PP Sbjct: 430 PPPTPPPTPPPTPPPTTLPP 449 Score = 36.7 bits (81), Expect = 0.027 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP P PP P Sbjct: 430 PPPTPPPTPPPTPPPTTLPPTTQPPPQP 457 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 3/30 (10%) Frame = +3 Query: 861 GXXPPPXPP-PXPPPXPPP--XPPXXPPPP 941 G PP P P PPP PPP PP PPP Sbjct: 426 GTATPPPTPPPTPPPTPPPTTLPPTTQPPP 455 >SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 37.1 bits (82), Expect = 0.021 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGG GG G G GGG GGG GG Sbjct: 6 GGGDGDGGDGDGGGGGDGGGDGG 28 Score = 32.3 bits (70), Expect = 0.59 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G G GGG GG GG G Sbjct: 5 GGGGDGDGGDGDGGGGGDGGGDGGDCDG 32 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 G G G GG G G GGG GGG Sbjct: 2 GYDGGGGDGDGGDGDGGGGGDGGG 25 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 36.7 bits (81), Expect = 0.027 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXP---PPXPPXXPPPP 941 PG P P PP PP P PP PP P PP Sbjct: 1257 PGMRPMPPQPPFMPPPPRMQPPGPPGPPGPP 1287 Score = 32.7 bits (71), Expect = 0.44 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP PP PP PP PPPP Sbjct: 1235 PPPPPAMPPDGPPKFMGLPPPPP 1257 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 4/28 (14%) Frame = +3 Query: 870 PPPXPPPXPPPX----PPPXPPXXPPPP 941 PPP PP PP PPP P P PP Sbjct: 1237 PPPAMPPDGPPKFMGLPPPPPGMRPMPP 1264 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/47 (29%), Positives = 16/47 (34%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP+ P PP P P + P P PP P PP Sbjct: 1238 PPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPP 1284 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Frame = +3 Query: 861 GXXPPPX---PPPXPPPXPPPXPPXXPPPP 941 G PPP P P PP PP P PP P Sbjct: 1251 GLPPPPPGMRPMPPQPPFMPPPPRMQPPGP 1280 Score = 29.1 bits (62), Expect = 5.5 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 12/36 (33%) Frame = +3 Query: 870 PPPXPPPXPP-----PXPPPX-------PPXXPPPP 941 PP PP PP P PPP PP PPPP Sbjct: 1238 PPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPP 1273 Score = 28.3 bits (60), Expect = 9.5 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +1 Query: 784 FXWXPPSPPX--PXPPXXXXXPSPXFSLXXXPXPXPXXPPXP 903 F PP PP P PP P P P P P PP P Sbjct: 1249 FMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGP-PGPPGPPGP 1289 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 36.7 bits (81), Expect = 0.027 Identities = 17/47 (36%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +1 Query: 796 PPSPPX-PXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPP 933 PP+PP P PP P+P P P PP P P PP Sbjct: 188 PPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPP 234 Score = 33.9 bits (74), Expect = 0.19 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P P PP PP P P P PP P Sbjct: 182 PSTIPTPPTPPAPPSPPIPTAPPTPPMP 209 Score = 32.7 bits (71), Expect = 0.44 Identities = 20/69 (28%), Positives = 22/69 (31%), Gaps = 4/69 (5%) Frame = +3 Query: 747 SXPXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPP----PXPPP 914 S P PP P P + +P P P PP PP P PP Sbjct: 269 SIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPP 328 Query: 915 XPPXXPPPP 941 P P PP Sbjct: 329 NPSIPPAPP 337 Score = 31.9 bits (69), Expect = 0.77 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 1/48 (2%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXP-PPH 939 P P PP P+P P P PP P P T P PH Sbjct: 172 PETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPH 219 Score = 31.5 bits (68), Expect = 1.0 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 +P PP PP P P PP PP P Sbjct: 185 IPTPPTPPAPPSPPIPTAPPTPPMPETP 212 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/52 (30%), Positives = 19/52 (36%), Gaps = 4/52 (7%) Frame = +1 Query: 790 WXPPSPPX----PXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPP 933 + PP+PP PP P+P P P PP P P PP Sbjct: 295 YIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPPAPP 346 Score = 31.5 bits (68), Expect = 1.0 Identities = 18/46 (39%), Positives = 21/46 (45%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPP 933 PP+PP P P P+P S+ P P P PP P P PP Sbjct: 315 PPAPPNPYIPTAP--PNP--SIPPAP-PNPSIPPAPPNPSIPPAPP 355 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P PP P P PP P P PP Sbjct: 180 PAPSTIPTPPTPPAPPSPPIPTAPPTPP 207 Score = 31.1 bits (67), Expect = 1.4 Identities = 24/97 (24%), Positives = 26/97 (26%) Frame = +1 Query: 646 APPXPFXAPXTPAXTLNPHTXXXXXXXXXXXXXXXXXXXXXXPXSXFXWXPPSPPXPXPP 825 APP P P P P T P P+PP P P Sbjct: 193 APPSP-PIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPMPETP 251 Query: 826 XXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P+P P P PP P P P P Sbjct: 252 LPPATPNP---FIPPASPNPSIPPAPPNPSIPAPPNP 285 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 5/53 (9%) Frame = +1 Query: 796 PPSPPXPX----PPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXP-PPH 939 PP PP P PP PSP P P P P P P PH Sbjct: 176 PPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPH 228 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 4/33 (12%) Frame = +3 Query: 855 LPGXXPPPXPPPXPP----PXPPPXPPXXPPPP 941 +P P P PP PP P PP P P PP Sbjct: 323 IPTAPPNPSIPPAPPNPSIPPAPPNPSIPPAPP 355 Score = 29.9 bits (64), Expect = 3.1 Identities = 20/68 (29%), Positives = 23/68 (33%), Gaps = 5/68 (7%) Frame = +3 Query: 753 PXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPP----PXPP-PX 917 P PP P P + + +P P P PP PP P PP P Sbjct: 227 PHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPNPS 286 Query: 918 PPXXPPPP 941 P PP P Sbjct: 287 IPLAPPNP 294 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = +3 Query: 855 LPGXXPPPXPPPXPP-PXPPPXPPXXPPPP 941 +P P P PP PP P PP PP PP Sbjct: 332 IPPAPPNPSIPPAPPNPSIPPAPPNLFIPP 361 Score = 29.5 bits (63), Expect = 4.1 Identities = 18/49 (36%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPP-PH 939 P PP P P P+P S+ P P P PP P PP PH Sbjct: 268 PSIPPAPPNPSIPAPPNP--SIPLAP-PNPYIPPAPPNLFIPSAPPNPH 313 Score = 28.7 bits (61), Expect = 7.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P P PP PP P PP P P Sbjct: 194 PPSPPIPTAPPTPPMPETPLPPGSPHIP 221 Score = 28.7 bits (61), Expect = 7.2 Identities = 24/99 (24%), Positives = 28/99 (28%), Gaps = 2/99 (2%) Frame = +1 Query: 643 SAPPXPFXAPXTPAXTLNPHTXXXXXXXXXXXXXXXXXXXXXXPXSXFXWXP--PSPPXP 816 +APP P P TP +PH P P P+ P P Sbjct: 201 TAPPTP-PMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNP 259 Query: 817 XPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPP 933 P PS + P P P P P PP Sbjct: 260 FIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPP 298 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P + P PP P P P PP P PP Sbjct: 163 PVTETTTTKPETKPPKPPAPSTIPTPPTPPAPPSPP 198 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 36.7 bits (81), Expect = 0.027 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPP---XXPPPP 941 P PP PPP P PPP PP PPPP Sbjct: 190 PWTSVPPPPPPGPGGIPPPPPPIRGGVPPPP 220 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +3 Query: 837 RSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 RS+ PG P PP PPP P PPPP Sbjct: 175 RSVITCSPGSPTEDTPWTSVPPPPPPGPGGIPPPP 209 Score = 28.7 bits (61), Expect = 7.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXP 920 PG PPP PPP PPP P Sbjct: 202 PGGIPPP-PPPIRGGVPPPPP 221 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 36.7 bits (81), Expect = 0.027 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 8/36 (22%) Frame = +3 Query: 858 PGXXPPPXPPP--------XPPPXPPPXPPXXPPPP 941 P PPP PPP PPP PPP P PPP Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPP 691 Score = 35.9 bits (79), Expect = 0.047 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP P PP PPP PPPP Sbjct: 676 PPPPPPPLPGGAAPPPPPPIGGGAPPPP 703 Score = 33.9 bits (74), Expect = 0.19 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPP 923 LPG PP PPP PPP PP Sbjct: 683 LPGGAAPPPPPPIGGGAPPPPPP 705 Score = 33.1 bits (72), Expect = 0.33 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 PG PPP PPP P P PPP Sbjct: 668 PGGQAGGAPPPPPPPLPGGAAPPPPPP 694 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/46 (30%), Positives = 15/46 (32%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P PP P PP +P P PP P PPP Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 36.7 bits (81), Expect = 0.027 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GG GGG GGG GG G Sbjct: 195 GGGGYGGSSRGGYGGGRGGGGYGGGRGG 222 Score = 36.3 bits (80), Expect = 0.036 Identities = 17/28 (60%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGX-GGGXGGGXXPG 857 GG GG GGG GGG GGG GGG G Sbjct: 200 GGSSRGGYGGGRGGGGYGGGRGGGGGYG 227 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGG GG GGG GGG GG GGG Sbjct: 208 GGGRGGGGYGGGRGGG--GGYGGG 229 Score = 33.5 bits (73), Expect = 0.25 Identities = 17/32 (53%), Positives = 17/32 (53%), Gaps = 4/32 (12%) Frame = -2 Query: 940 GGGGXXGGX----GGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GG GG GGG G Sbjct: 183 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGG 214 Score = 33.5 bits (73), Expect = 0.25 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXER 842 GGGG GG GGG G G G GG G +R Sbjct: 212 GGGGYGGGRGGGGGYGGGRRDYGGGSKGGGYDR 244 Score = 32.3 bits (70), Expect = 0.59 Identities = 19/59 (32%), Positives = 19/59 (32%) Frame = -3 Query: 936 GGGXXXGXGXXXXGGXXGXXXXXXXXXXXXXXXGXGXXGGGGXGGGGXPXEXAXRGGGG 760 GGG G G GG G G GGGG GGG GGG Sbjct: 183 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGGSKGGG 241 >SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) Length = 591 Score = 36.7 bits (81), Expect = 0.027 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 G GG G GGG GGG GGG GG Sbjct: 488 GFGGGGGASGGGGGGGGGGGFSGG 511 Score = 36.3 bits (80), Expect = 0.036 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GG GGG GGG GGG G Sbjct: 487 GGFGGGGGASGGGGGGGGGGGFSGG 511 Score = 35.1 bits (77), Expect = 0.083 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GG G G Sbjct: 492 GGGASGGGGGGGGGGGFSGGACGDFTSG 519 Score = 33.5 bits (73), Expect = 0.25 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG GG GGG GGG G G Sbjct: 487 GGFGGGGGASGGGGGGGGGGGFSGGACG 514 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXP 860 GGG GG GGG GG G G P Sbjct: 497 GGGGGGGGGGGFSGGACGDFTSGLSP 522 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 36.7 bits (81), Expect = 0.027 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXP-PPXPPPXPPPXPPPXPPXXPPPP 941 P P PP P PPP P PP PPPP Sbjct: 1051 PSAVPIPPPRKPSPPPSEPAPPPRQPPPP 1079 Score = 35.9 bits (79), Expect = 0.047 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PPP P PP P PP Sbjct: 1049 PPPSAVPIPPPRKPSPPPSEPAPP 1072 Score = 33.5 bits (73), Expect = 0.25 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P R S PPP P PP P PP P PP Sbjct: 1029 PKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPP 1065 Score = 32.3 bits (70), Expect = 0.59 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PP PPP P PP Sbjct: 1064 PPPSEPAPPPRQPPPPSTSQPVPP 1087 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPP-PXPPPXPPPXPPXXPPPP 941 P S + P P P P P PPP PP P P P Sbjct: 1049 PPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVP 1086 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +1 Query: 802 SPPXPXPPXXXXXPSPXFSLXXXPXPX-PXXPPXPXXPXTXXXPPP 936 SPP P PSP S P P P PP P PPP Sbjct: 1034 SPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPP 1079 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P R S PPP PP P P PP P P Sbjct: 1058 PPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDP 1093 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXP-PXPXXPXTXXXPPP 936 PSPP P P P + P P P P P P P PPP Sbjct: 1062 PSPPPSEPAPPPRQPPPPST--SQPVPPPRQPDPIPTNPAHPTEPPP 1106 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PP P P P PPP PPP Sbjct: 1065 PPSEPAPPPRQPPPPSTSQPVPPP 1088 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 36.3 bits (80), Expect = 0.036 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP PPP P PPP PP PP Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPP 51 Score = 35.9 bits (79), Expect = 0.047 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PP PP P P PP PP P PP Sbjct: 107 GDMGPPGPPGPPGPQMPPGPPGLPGPP 133 Score = 33.5 bits (73), Expect = 0.25 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXP--PPXPPPXPPPXPPXXPPPP 941 PG PP P PP PP P P P PP P Sbjct: 707 PGLPGPPGPASPPSPPGPPGPPGPNGPPGP 736 Score = 33.5 bits (73), Expect = 0.25 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXP--PPXPPPXPPPXPPXXPPPP 941 PG PP P PP PP P P P PP P Sbjct: 792 PGLPGPPGPASPPSPPGPPGPPGPKGPPGP 821 Score = 33.5 bits (73), Expect = 0.25 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXP--PPXPPPXPPPXPPXXPPPP 941 PG PP P PP PP P P P PP P Sbjct: 877 PGLPGPPGPASPPSPPGPPGPPGPKGPPGP 906 Score = 33.1 bits (72), Expect = 0.33 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LPG P P PP PP P P P PP P Sbjct: 624 LPGP-PGPASPPSPPGPPGPPGPKGPPGP 651 Score = 32.3 bits (70), Expect = 0.59 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPP 935 PPP P PPP P P P PP Sbjct: 30 PPPPPYEAPPPPPGPPGPDGPP 51 Score = 32.3 bits (70), Expect = 0.59 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PP P P P PP PP P PP Sbjct: 702 GEMGPPGLPGPPGPASPPSPPGPPGPP 728 Score = 32.3 bits (70), Expect = 0.59 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PP P P P PP PP P PP Sbjct: 787 GEMGPPGLPGPPGPASPPSPPGPPGPP 813 Score = 32.3 bits (70), Expect = 0.59 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PP P P P PP PP P PP Sbjct: 872 GEMGPPGLPGPPGPASPPSPPGPPGPP 898 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 2/28 (7%) Frame = +3 Query: 858 PGXXPPPXP--PPXPPPXPPPXPPXXPP 935 PG PP P PP PP P P P PP Sbjct: 112 PGPPGPPGPQMPPGPPGLPGPPGPAGPP 139 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PP P P P PP PP P P Sbjct: 276 PGDMGPPGLPGPPGPQMPPGPPGLPGAP 303 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/38 (36%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +3 Query: 831 PXRSLSXVLPGXXP-PPXPPPXPPPXPPPXPPXXPPPP 941 P + + P P PP P P P PP PP PP Sbjct: 612 PPGEIGEIGPAGLPGPPGPASPPSPPGPPGPPGPKGPP 649 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 LPG P PP P P PP P P P Sbjct: 794 LPGPPGPASPPSPPGPPGPPGPKGPPGP 821 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 LPG P PP P P PP P P P Sbjct: 879 LPGPPGPASPPSPPGPPGPPGPKGPPGP 906 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPX--PPPXPPPXPPPXPPXXPPP 938 P +LS PPP PPP P P P PP P P Sbjct: 19 PACTLSCCETPPPPPPYEAPPPPPGPPGPDGPPGFPGP 56 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 LPG P PP P P PP P P P Sbjct: 709 LPGPPGPASPPSPPGPPGPPGPNGPPGP 736 Score = 29.5 bits (63), Expect = 4.1 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 5/31 (16%) Frame = +3 Query: 858 PGXXPPPXP--PPXPP-PXPPPXP--PXXPP 935 PG PP P PP PP P PP P P PP Sbjct: 628 PGPASPPSPPGPPGPPGPKGPPGPNGPLGPP 658 Score = 29.5 bits (63), Expect = 4.1 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 5/31 (16%) Frame = +3 Query: 858 PGXXPPPXP--PPXPP-PXPPPXP--PXXPP 935 PG PP P PP PP P PP P P PP Sbjct: 713 PGPASPPSPPGPPGPPGPNGPPGPNGPLGPP 743 Score = 29.5 bits (63), Expect = 4.1 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 5/31 (16%) Frame = +3 Query: 858 PGXXPPPXP--PPXPP-PXPPPXP--PXXPP 935 PG PP P PP PP P PP P P PP Sbjct: 798 PGPASPPSPPGPPGPPGPKGPPGPNGPLGPP 828 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/38 (36%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXP-PPXPPXXPPPP 941 P + + P P P P PP P PP PP PP Sbjct: 697 PPGQIGEMGPPGLPGPPGPASPPSPPGPPGPPGPNGPP 734 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/38 (36%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXP-PPXPPXXPPPP 941 P + + P P P P PP P PP PP PP Sbjct: 782 PPGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGPKGPP 819 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/38 (36%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXP-PPXPPXXPPPP 941 P + + P P P P PP P PP PP PP Sbjct: 867 PPGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGPKGPP 904 Score = 28.7 bits (61), Expect = 7.2 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PP P P P PP PP P P Sbjct: 362 GDVGPPGLPGPPGPQMPPGPPGLPGAP 388 Score = 28.7 bits (61), Expect = 7.2 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PP P P P PP PP P P Sbjct: 447 GDVGPPGLPGPPGPQMPPGPPGLPGAP 473 Score = 28.7 bits (61), Expect = 7.2 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PP P P P PP PP P P Sbjct: 532 GDVGPPGLPGPPGPQMPPGPPGLPGAP 558 Score = 28.3 bits (60), Expect = 9.5 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPP 933 PP PP PP P P P P P P P PP Sbjct: 30 PPPPPYEAPPPPPGPPGPD---GPPGFPGPQGPNGPKGPPGLPGPP 72 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PP P P PP PP P P Sbjct: 191 PGDMGPPGLPGPQGPQMPPGPPGLPGAP 218 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 36.3 bits (80), Expect = 0.036 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PP PPP PP PP PPPP Sbjct: 273 GMPPPGMPPPMPPGGMPPNMEQPPPPP 299 Score = 32.3 bits (70), Expect = 0.59 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PPP PP PP P PPPP Sbjct: 272 GGMPPPGMPPPMPPGGMPPNMEQPPPP 298 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 9/36 (25%) Frame = +3 Query: 858 PGXXPPPXPPP---------XPPPXPPPXPPXXPPP 938 PG PPP PP PP PPP PP PP Sbjct: 255 PGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPP 290 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +3 Query: 858 PGXXPPPXPPPXPPP---XPPPXPP 923 P PPP PP PP PPP PP Sbjct: 276 PPGMPPPMPPGGMPPNMEQPPPPPP 300 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PP P PPP PP P PPP Sbjct: 236 PPMGAPPPPHSMPPPGMPP-PGMMPPP 261 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 SL ++P PP PP P PP PPP Sbjct: 222 SLPPMIPPVGMLGHPPMGAPPPPHSMPPPGMPPP 255 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 2/27 (7%) Frame = +3 Query: 861 GXXPPPX--PPPXPPPXPPPXPPXXPP 935 G PPP PPP PP PP PP Sbjct: 239 GAPPPPHSMPPPGMPPPGMMPPPGFPP 265 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P S LP PP PP PP P PPP Sbjct: 215 PPIQTSTSLPPMIPPVGMLGHPPMGAPPPPHSMPPP 250 >SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) Length = 315 Score = 36.3 bits (80), Expect = 0.036 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +3 Query: 858 PGXXPPPXPPPXPP-PXPPPXPPXXPP 935 P PPP PP PP PPP PP PP Sbjct: 177 PRTQPPPIPPIDPPRTQPPPIPPIDPP 203 Score = 36.3 bits (80), Expect = 0.036 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +3 Query: 858 PGXXPPPXPPPXPP-PXPPPXPPXXPP 935 P PPP PP PP PPP PP PP Sbjct: 190 PRTQPPPIPPIDPPRTQPPPIPPIDPP 216 Score = 32.3 bits (70), Expect = 0.59 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P P PPP PP PP PPP Sbjct: 169 PPIFPIDPPRTQPPPIPPIDPPRTQPPP 196 Score = 32.3 bits (70), Expect = 0.59 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P R+ +P PP PP PP PP P PP Sbjct: 176 PPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPP 212 Score = 31.9 bits (69), Expect = 0.77 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +3 Query: 858 PGXXPPPXPPPXPP-PXPPPXPPXXPP 935 P PPP P PP PPP PP PP Sbjct: 164 PRTQPPPIFPIDPPRTQPPPIPPIDPP 190 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/39 (38%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPP---XPPXXPPP 938 P R+ +P PP PP PP PP PP P P Sbjct: 189 PPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIFPQP 227 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P LP P P PPP P PP PPP Sbjct: 147 PTTPAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPPP 183 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 36.3 bits (80), Expect = 0.036 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 ++ P PPP P PP P PP PPPP Sbjct: 173 MAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPP 205 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPP--PXPPPXPP-PXPPPXPPXXPPPP 941 P PP P PP PP PP PP P PP Sbjct: 179 PAPPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%) Frame = +3 Query: 870 PPPXP---PPXPPPXPPPXPPXXPPPP 941 PP P P PP PPP P PP P Sbjct: 167 PPAAPFMAPAAPPAPPPPGAPAAPPAP 193 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXP--PPXPPXXPPPP 941 P P PP PP P P P PPPP Sbjct: 155 PSIASQPPQPPAPPAAPFMAPAAPPAPPPP 184 Score = 28.3 bits (60), Expect = 9.5 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPP 897 PP+PP P P P+P F P P PP Sbjct: 178 PPAPPPPGAPAAP--PAPPFGGPPSAPPPPPAPP 209 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 36.3 bits (80), Expect = 0.036 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G P PPP P P P PP PPPP Sbjct: 296 GGHPAAAPPPPPLPAGVPAPPPPPPPP 322 Score = 33.1 bits (72), Expect = 0.33 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P PPP P P P PPP PP PP Sbjct: 299 PAAAPPPPPLPAGVPAPPPPPP--PP 322 Score = 32.3 bits (70), Expect = 0.59 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 PPP P P P PPP PP P Sbjct: 305 PPPLPAGVPAPPPPPPPPMLGGP 327 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P S P P PP P F P P PP P PPP Sbjct: 276 PTSQPPPPPPLTGGMLPPPFG--GHPAAAPPPPPLPAGVPAPPPPPP 320 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 4/31 (12%) Frame = +3 Query: 861 GXXPPPXPP-PXPPPXPPPXP---PXXPPPP 941 G PPP P P PPP P P PPPP Sbjct: 289 GMLPPPFGGHPAAAPPPPPLPAGVPAPPPPP 319 Score = 29.5 bits (63), Expect = 4.1 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPX---PPXXPPPP 941 P PPP PP PPP P PPPP Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPP 306 >SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2332 Score = 36.3 bits (80), Expect = 0.036 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 P P PPP PPP P PP P P Sbjct: 940 PTPTPPPSPPPKEPTPPPSSKPSP 963 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPP 923 P PPP PPP P PP P Sbjct: 940 PTPTPPPSPPPKEPTPPPSSKP 961 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 36.3 bits (80), Expect = 0.036 Identities = 17/26 (65%), Positives = 17/26 (65%), Gaps = 2/26 (7%) Frame = -2 Query: 940 GGGGXX--GGXGGGXGGGXGGGXGGG 869 GGGG GG GGG G G GGG GGG Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYGGG 117 Score = 36.3 bits (80), Expect = 0.036 Identities = 17/26 (65%), Positives = 17/26 (65%), Gaps = 2/26 (7%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGG--XGGGXGGG 869 GGGG GG GG GGG GGG GGG Sbjct: 103 GGGGGYGGGGGYGGGGRSYGGGGGGG 128 Score = 32.7 bits (71), Expect = 0.44 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -2 Query: 940 GGGGXXGGXGGGXG-GGXGGGXGGGXXPG 857 GG G GG GGG G GG G GGG G Sbjct: 100 GGRGGGGGYGGGGGYGGGGRSYGGGGGGG 128 Score = 32.3 bits (70), Expect = 0.59 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GG G GG GGG GGG GGG Sbjct: 106 GGYGGGGGYGGGGRSYGGGGGGGG 129 Score = 32.3 bits (70), Expect = 0.59 Identities = 16/28 (57%), Positives = 16/28 (57%), Gaps = 4/28 (14%) Frame = -2 Query: 940 GGGGXXGGXGGGXGG----GXGGGXGGG 869 GGGG G GGG GG GGG GGG Sbjct: 115 GGGGRSYGGGGGGGGFYQDSYGGGGGGG 142 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRT 851 GGG GG GGG GG GG GR+ Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYGGGGRS 120 Score = 28.3 bits (60), Expect = 9.5 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGGX*XXNLPTXPGGG 721 G GGGG GGG GGGG + GGG Sbjct: 106 GGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGGG 142 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 36.3 bits (80), Expect = 0.036 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PPP PPP PPP PPPP Sbjct: 352 GMAPPPVGGAAPPPPPPPPVGGPPPPP 378 Score = 35.9 bits (79), Expect = 0.047 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PPP PPP PPP PP PP Sbjct: 360 GAAPPPPPPPPVGGPPPPPPPIEGRPP 386 Score = 34.3 bits (75), Expect = 0.14 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PPP PP PPP PPPP Sbjct: 323 GTAPPPPPPSRSSQRPPPPSRGAPPPP 349 Score = 33.5 bits (73), Expect = 0.25 Identities = 17/52 (32%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +1 Query: 796 PPSPPX-----PXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P PP P P + P PP P P PPP Sbjct: 327 PPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPP 378 Score = 33.1 bits (72), Expect = 0.33 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPP 923 G PP PPP P PPP PP Sbjct: 359 GGAAPPPPPPPPVGGPPPPPP 379 Score = 32.7 bits (71), Expect = 0.44 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PPP PPP PP PPPP Sbjct: 344 GAPPPPSMGMAPPPVGGAAPPPPPPPP 370 Score = 32.7 bits (71), Expect = 0.44 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 4/32 (12%) Frame = +3 Query: 858 PGXXPPPX--PPPXPPPXP--PPXPPXXPPPP 941 P PPP PPP PPP PP PPPP Sbjct: 364 PPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPP 395 Score = 32.7 bits (71), Expect = 0.44 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 8/36 (22%) Frame = +3 Query: 858 PGXXPPPXPPP---XPP-----PXPPPXPPXXPPPP 941 P PPP PPP PP P PPP P PPP Sbjct: 370 PVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPP 405 Score = 31.9 bits (69), Expect = 0.77 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Frame = +3 Query: 861 GXXPPPXPP---PXPPPXPPPXPPXXPPPP 941 G PPP P PPP PP PPPP Sbjct: 312 GSAPPPPPARMGTAPPPPPPSRSSQRPPPP 341 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/44 (31%), Positives = 16/44 (36%) Frame = +1 Query: 802 SPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPP 933 +PP P PP P P + P PP P P PP Sbjct: 362 APPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPP 405 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPP--PXPPPXPPPXPPXXPPPP 941 P R + P PP PP PP PP PPPP Sbjct: 291 PSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPP 329 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSP-XFSLXXXPXPXPXXPPXPXXPXTXXXPP 933 PPS P PP P P + P P P P P P PP Sbjct: 340 PPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPP 386 Score = 29.9 bits (64), Expect = 3.1 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 9/37 (24%) Frame = +3 Query: 858 PGXXPPPXP-----PP----XPPPXPPPXPPXXPPPP 941 P PP P PP PP PPP P PPPP Sbjct: 341 PSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPP 377 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PPP P P PPP PPPP Sbjct: 284 GIQPPPPPSRGAAP-PPPSRGAPPPPP 309 Score = 29.1 bits (62), Expect = 5.5 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 4/51 (7%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXP----XXPPXPXXPXTXXXPPP 936 PPS PP P P S P P P PP P + PPP Sbjct: 290 PPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPP 340 Score = 29.1 bits (62), Expect = 5.5 Identities = 16/57 (28%), Positives = 18/57 (31%), Gaps = 1/57 (1%) Frame = +2 Query: 491 PPNXXXXXSPGRGXXPX-AGGXXXPKPXXXXXXXXGPPTXKXAXKKPXXXXXPPPLP 658 PP+ P G P GG P P PP + P PPP P Sbjct: 340 PPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPP 396 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 36.3 bits (80), Expect = 0.036 Identities = 17/32 (53%), Positives = 17/32 (53%), Gaps = 5/32 (15%) Frame = +3 Query: 861 GXXPPPXPP-PXPPPXPPPXP----PXXPPPP 941 G PPP PP PP PPP P P PPPP Sbjct: 298 GFQPPPPPPTDFAPPPPPPEPTSELPPPPPPP 329 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P S F P PP P P + PPP Sbjct: 280 PPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPP 326 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 10/34 (29%) Frame = +3 Query: 870 PPPXPPPXPPP--------XPPPXPP--XXPPPP 941 PPP PPP P PPP PP PPPP Sbjct: 281 PPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPP 314 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P PP PPP P PP PP PP Sbjct: 306 PTDFAPPPPPPEPTSELPPPPP--PP 329 >SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 519 Score = 35.9 bits (79), Expect = 0.047 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG GG GG GGG GGG G Sbjct: 171 GSNGSGGGDDGGDGGDDGGGSGGGGDDG 198 Score = 35.5 bits (78), Expect = 0.063 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GG GGG GGG G G Sbjct: 176 GGGDDGGDGGDDGGGSGGGGDDGGSDG 202 Score = 35.1 bits (77), Expect = 0.083 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG G GGG GG GG GGG G Sbjct: 167 GDGGGSNGSGGGDDGGDGGDDGGGSGGG 194 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GG GG GG GG Sbjct: 192 GGGGDDGGSDGGGGGNDGGRDDGG 215 Score = 32.3 bits (70), Expect = 0.59 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GG GG GG GG Sbjct: 188 GGGSGGGGDDGGSDGGGGGNDGG 210 Score = 31.9 bits (69), Expect = 0.77 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GG G G G G GG GG GGG Sbjct: 181 GGDGGDDGGGSGGGGDDGGSDGGG 204 Score = 31.9 bits (69), Expect = 0.77 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGR 854 GG GG GGG G G GGG GR Sbjct: 184 GGDDGGGSGGGGDDGGSDGGGGGNDGGR 211 >SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) Length = 256 Score = 35.9 bits (79), Expect = 0.047 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +3 Query: 852 VLPGXXPPPX-PPPXPPPXPPPXPPXXPPPP 941 VLP PP PP PPP P PP P PP Sbjct: 225 VLPASPKPPTAPPNTPPPPVTPPPPNTPGPP 255 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 35.9 bits (79), Expect = 0.047 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +3 Query: 855 LPGXXPPPXPPPX--PPPXPPPXPPXXPPPP 941 L G PPP P PPP PP P PPPP Sbjct: 117 LGGYVPPPPPTGTLPPPPVTPPPGPETPPPP 147 Score = 35.5 bits (78), Expect = 0.063 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PP PPP P PPP P P PP Sbjct: 133 PPVTPPPGPETPPPPDTPAPPVPP 156 Score = 33.1 bits (72), Expect = 0.33 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PPP P P P PP PP P PP Sbjct: 128 GTLPPPPVTPPPGPETPP-PPDTPAPP 153 Score = 32.3 bits (70), Expect = 0.59 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PP P PPP PP P Sbjct: 132 PPPVTPPPGPETPPPPDTPAPPVP 155 Score = 32.3 bits (70), Expect = 0.59 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = +3 Query: 858 PGXXPPPXPP-PXPPPXP-PPXPPXXPPP 938 P PPP P P PP P PP PP PP Sbjct: 133 PPVTPPPGPETPPPPDTPAPPVPPTEAPP 161 Score = 31.5 bits (68), Expect = 1.0 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 PG PP P PP PP P PP Sbjct: 139 PGPETPPPPDTPAPPVPPTEAPPTAPP 165 Score = 28.7 bits (61), Expect = 7.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXP 932 P PP P PPP P PP P Sbjct: 132 PPPVTPPPGPETPPPPDTPAPPVPP 156 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 35.9 bits (79), Expect = 0.047 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG G G G GGG GGG G Sbjct: 768 GGGGYRGGGGYGGGHRGGGGYGGGGHRG 795 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Frame = -2 Query: 937 GGGXXGGXGGGX--GGGXGGGXGGGXXPG 857 GGG GG GGG GGG GGG GG G Sbjct: 761 GGGGYGGGGGGYRGGGGYGGGHRGGGGYG 789 Score = 33.9 bits (74), Expect = 0.19 Identities = 18/30 (60%), Positives = 18/30 (60%), Gaps = 3/30 (10%) Frame = -2 Query: 937 GGGXXGGXG-GGXGGG--XGGGXGGGXXPG 857 GGG GG G GG GGG GGG GGG G Sbjct: 756 GGGYRGGGGYGGGGGGYRGGGGYGGGHRGG 785 Score = 32.7 bits (71), Expect = 0.44 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGGG GG GG G G GG GG Sbjct: 774 GGGGYGGGHRGGGGYGGGGHRGG 796 Score = 31.9 bits (69), Expect = 0.77 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG GG GGG GG GGG GG G Sbjct: 757 GGYRGGGGYGGGGGGYRGGGGYGGGHRG 784 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GG G G G GGG GGG GG Sbjct: 749 GGYGNRSGGGYRGGGGYGGGGGG 771 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG GGG GG G G GGG G Sbjct: 749 GGYGNRSGGGYRGGGGYGGGGGGYRG 774 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG RGGGG Sbjct: 758 GYRGGGGYGGGG----GGYRGGGG 777 >SB_7159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 35.9 bits (79), Expect = 0.047 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRTXE 845 GGG G GGG GG GG GGG G E Sbjct: 13 GGGDGGDSGGGSDGGGDGGDGGGGSDGGDGE 43 Score = 35.1 bits (77), Expect = 0.083 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GG GGG GG G G G Sbjct: 21 GGGSDGGGDGGDGGGGSDGGDGEGDDDG 48 Score = 33.1 bits (72), Expect = 0.33 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GGG GG GGG GG G Sbjct: 17 GGDSGGGSDGGGDGGDGGGGSDGGDGEG 44 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGX-GGGXGGGXXPG 857 G G GG GG GGG GGG GG G Sbjct: 9 GDGEGGGDGGDSGGGSDGGGDGGDGGGG 36 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GGG GG GGG GG G Sbjct: 7 GDGDGEGGGDGGDSGGGSDGGGDGG 31 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG G GGG GG G G G G Sbjct: 26 GGGDGGDGGGGSDGGDGEGDDDGDGEG 52 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 35.5 bits (78), Expect = 0.063 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXP 860 GGGG G GGG GGG G GG P Sbjct: 229 GGGGGVWGNGGGGGGGGGYSGGGSGNP 255 Score = 33.1 bits (72), Expect = 0.33 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG GG G G GGG GGG G Sbjct: 223 GVPGGFGGGGGVWGNGGGGGGGGGYSGG 250 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG G GGG GGG G G Sbjct: 226 GGFGGGGGVWGNGGGGGGGGGYSGGGSG 253 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 35.5 bits (78), Expect = 0.063 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP--PP 941 P PP PP PP PP PP PP PP Sbjct: 26 PPTDPPTDPPTDPPTDPPTDPPTDPPTDPP 55 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 35.5 bits (78), Expect = 0.063 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 GGG GG GGG G GGG G G Sbjct: 61 GGGNDGGNGGGGAGNGGGGGGAG 83 Score = 35.1 bits (77), Expect = 0.083 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG GG GGG G GGG G Sbjct: 56 GGCGCGGGNDGGNGGGGAGNGGGGGGAG 83 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -2 Query: 940 GGGGXXGGXGGGXG-GGXGGGXGGGXXPG 857 GGG G GGG G GG GGG G G G Sbjct: 61 GGGNDGGNGGGGAGNGGGGGGAGNGGAAG 89 Score = 34.3 bits (75), Expect = 0.14 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGGG GG G G G G G G GG Sbjct: 35 GGGGVGGGGGNGGGAGNGVGAGG 57 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 GGG GG GGG GGG G G G G Sbjct: 35 GGGGVGG-GGGNGGGAGNGVGAG 56 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG G G G GG GGG G Sbjct: 79 GGGAGNGGAAGAAGAGAGGNVGGGGSGG 106 Score = 33.1 bits (72), Expect = 0.33 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG G G GGG GGG G G G Sbjct: 29 GVGVGVGGGGVGGGGGNGGGAGNGVGAG 56 Score = 32.3 bits (70), Expect = 0.59 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 3/31 (9%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGX---GGGXGGGXXPG 857 GGGG GG G G G G GGG GG G Sbjct: 41 GGGGNGGGAGNGVGAGGCGCGGGNDGGNGGG 71 Score = 31.9 bits (69), Expect = 0.77 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG G GGG GG GG G G Sbjct: 67 GNGGGGAGNGGGGGGAGNGGAAGAAGAG 94 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GGG GGG G G G G G Sbjct: 28 GGVGVGVGGGGVGGGGGNGGGAGNGVG 54 Score = 31.5 bits (68), Expect = 1.0 Identities = 17/30 (56%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXG-GGXG-GGXXPG 857 GG G GG GGG G G G GG G GG G Sbjct: 37 GGVGGGGGNGGGAGNGVGAGGCGCGGGNDG 66 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG G G G G GGG G Sbjct: 40 GGGGGNGGGAGNGVGAGGCGCGGGNDGG 67 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG G G G G G Sbjct: 70 GGGAGNGGGGGGAGNGGAAGAAGAGAGG 97 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 G G G GGG GG GG G G Sbjct: 92 GAGAGGNVGGGGSGGVGGNGGSG 114 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G GG GG GGG G G G Sbjct: 54 GAGGCGCGGGNDGGNGGGGAGNGGGGG 80 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = -2 Query: 940 GGGGXXG-GXGGGXGGGXGGGXGGGXXPG 857 G G G G GG GGG GG GG G Sbjct: 86 GAAGAAGAGAGGNVGGGGSGGVGGNGGSG 114 Score = 29.5 bits (63), Expect = 4.1 Identities = 20/73 (27%), Positives = 21/73 (28%) Frame = -3 Query: 939 VGGGXXXGXGXXXXGGXXGXXXXXXXXXXXXXXXGXGXXGGGGXGGGGXPXEXAXRGGGG 760 VGGG G G G G G G G GGGG A G Sbjct: 34 VGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGA 93 Query: 759 X*XXNLPTXPGGG 721 N+ GG Sbjct: 94 GAGGNVGGGGSGG 106 Score = 29.5 bits (63), Expect = 4.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG GG G G GGG G G G Sbjct: 66 GGNGGGGAGNGGGGGGAGNGGAAGAAG 92 Score = 29.5 bits (63), Expect = 4.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GGG G G G G Sbjct: 69 GGGGAGNGGGGGGAGNGGAAGAAGAGAG 96 Score = 29.5 bits (63), Expect = 4.1 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = -2 Query: 940 GGGGXXGGXG-GGXGGGXGGGXGGGXXPG 857 G GG GG G GG G G G GG G Sbjct: 74 GNGGGGGGAGNGGAAGAAGAGAGGNVGGG 102 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG G GGG GG GGG G G Sbjct: 54 GAGGC--GCGGGNDGGNGGGGAGNGGGG 79 >SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 516 Score = 35.5 bits (78), Expect = 0.063 Identities = 18/32 (56%), Positives = 18/32 (56%), Gaps = 3/32 (9%) Frame = -2 Query: 940 GGGGXXGGXGGGXG---GGXGGGXGGGXXPGR 854 GG G G GGG G GG GGG GGG GR Sbjct: 403 GGRGGYRGRGGGRGYYRGGRGGGRGGGGRGGR 434 Score = 32.7 bits (71), Expect = 0.44 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 G G GG GGG GGG GG GG Sbjct: 414 GRGYYRGGRGGGRGGGGRGGRGG 436 >SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) Length = 227 Score = 35.5 bits (78), Expect = 0.063 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG G G G G Sbjct: 86 GGGGGDGG-GGGDGGGDGDGDGDG 108 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG G G GGG GGG G G G Sbjct: 84 GDGGGGGDGGGGGDGGGDGDGDGDG 108 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 35.5 bits (78), Expect = 0.063 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP P P P PPP PP PPPP Sbjct: 903 PTTPAPPPPLPLAPEPPPPLPP--PPPP 928 Score = 35.5 bits (78), Expect = 0.063 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPX--PPPXPPPX--PPPXPPXXPPPP 941 P S P PP PPP P PPP PP PPPP Sbjct: 940 PTTQASTTRPTPPPPTSALPPPIPATQVPPPPLPPLPPPPP 980 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = +3 Query: 870 PPPXP--PPXPPPXPPPXPPXXPPPP 941 PPP P P PPP PPP PP P Sbjct: 909 PPPLPLAPEPPPPLPPPPPPIQTTRP 934 Score = 32.3 bits (70), Expect = 0.59 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXP-PPXPPPXPPPXPPXXPPPP 941 P +L +P PP P PP PPP PP P P Sbjct: 954 PTSALPPPIPATQVPPPPLPPLPPPPPPVQTTTAPTLP 991 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Frame = +3 Query: 870 PPPXPPPXPPPXP-PPXPPXXPPPP 941 P P P PPP P P PP PPP Sbjct: 901 PKPTTPAPPPPLPLAPEPPPPLPPP 925 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 4/32 (12%) Frame = +3 Query: 858 PGXXPP----PXPPPXPPPXPPPXPPXXPPPP 941 P PP P PPP PP PPP P P Sbjct: 906 PAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVP 937 Score = 29.5 bits (63), Expect = 4.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 P P P P PPP P PPP Sbjct: 898 PTTPKPTTPAPPPPLPLAPEPPP 920 Score = 29.5 bits (63), Expect = 4.1 Identities = 17/52 (32%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +1 Query: 796 PPSPPXPXP-----PXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P P P P+ S P P P P T PPP Sbjct: 920 PPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPATQVPPPP 971 Score = 28.7 bits (61), Expect = 7.2 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 2/24 (8%) Frame = +3 Query: 870 PPPXPP--PXPPPXPPPXPPXXPP 935 PPP PP P PPP P PP Sbjct: 969 PPPLPPLPPPPPPVQTTTAPTLPP 992 >SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) Length = 628 Score = 35.5 bits (78), Expect = 0.063 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPPPXPPPXPPP 914 S+ + G PP PPP PPP PPP Sbjct: 200 SIMLLAYGDAKPPPPPPPPPPPPPP 224 Score = 33.9 bits (74), Expect = 0.19 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = +3 Query: 882 PPPXPPPXPPPXPP 923 PPP PPP PPP PP Sbjct: 211 PPPPPPPPPPPPPP 224 Score = 31.9 bits (69), Expect = 0.77 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = +3 Query: 894 PPPXPPPXPPXXPPPP 941 PPP PPP PP PPPP Sbjct: 211 PPPPPPPPPP--PPPP 224 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 35.1 bits (77), Expect = 0.083 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 PG P PPP PP P PP PPP Sbjct: 657 PGGGMFPPPPPPPPGGGVPGPPKPPPP 683 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP P PP Sbjct: 655 PPPGGGMFPPPPPPPPGGGVPGPP 678 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 35.1 bits (77), Expect = 0.083 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPP 938 G P P PP P P P P PP PP Sbjct: 519 GSYPAPQPPSPPAPPPKPAPPPRSPP 544 Score = 32.3 bits (70), Expect = 0.59 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PP P P P P PPP P P Sbjct: 522 PAPQPPSPPAPPPKPAPPPRSPPAAAP 548 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPPP 941 P P P PP PPP P P P Sbjct: 522 PAPQPPSPPAPPPKPAPPPRSP 543 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P P P PPP PP P P P Sbjct: 530 PAPPPKPAPPPRSPPAAAPCNPAMAP 555 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 35.1 bits (77), Expect = 0.083 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXP------PPXPPPXPPPXPPXXPPP 938 P S S P PP P P PP PPP PP PPP Sbjct: 331 PSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPPPTPPP 372 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P P P PPP PP PP P Sbjct: 343 PQPPTPTTPKTHPQLGPPPPPPPPPPTP 370 >SB_19081| Best HMM Match : Metallothio_2 (HMM E-Value=4.4) Length = 260 Score = 35.1 bits (77), Expect = 0.083 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGG 881 GGGG GG G G GGG GGG Sbjct: 154 GGGGRGGGRGHGRGGGSGGG 173 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 G GG GG GGG G G GGG GGG Sbjct: 152 GRGG--GGRGGGRGHGRGGGSGGG 173 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GGG GGG G G GGG G Sbjct: 148 GPVRGRGGGGRGGGRGHGRGGGSGGG 173 >SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) Length = 968 Score = 34.7 bits (76), Expect = 0.11 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G P PP PPP P PP P PP Sbjct: 299 GTPQTPPPPQTPPPPQTPAPPQTPAPP 325 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 34.7 bits (76), Expect = 0.11 Identities = 33/105 (31%), Positives = 38/105 (36%), Gaps = 7/105 (6%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXGGX 758 GGG G G G G G GGG G G G R + G + G GG Sbjct: 265 GGGWGRGQGRGMGRGPGGGWGRGSGGG--WGRMQGGGMGRGPGGGWGRMQGGMGRGPGGG 322 Query: 757 LGXEP----PHXPRGGXEKGXXCGG*GXLRG---XXGPXXGXGGR 644 G P GG +G GG G ++G GP G G R Sbjct: 323 WGRMQGGGMGRGPGGGLGRGPG-GGWGRMQGGGMGRGPGQGWGCR 366 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/31 (51%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = -2 Query: 940 GGGGXXG--GXGGGXGGGXGGGXGGGXXPGR 854 GGG G G G G GGG G G GGG G+ Sbjct: 242 GGGMGQGPRGWGRGSGGGWGQGPGGGWGRGQ 272 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG G GGG G G G G G G G Sbjct: 257 GGGWGQGPGGGWGRGQGRGMGRGPGGG 283 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G GGG G G GGG G G G Sbjct: 248 GPRGWGRGSGGGWGQGPGGGWGRGQGRG 275 Score = 29.5 bits (63), Expect = 4.1 Identities = 27/99 (27%), Positives = 31/99 (31%), Gaps = 3/99 (3%) Frame = -1 Query: 938 WGGGXXXVXGXXGXGGXXGXGXGXXSRENXGEGXXXXXG-GXGXG-GEGGXQXKXLXGXX 765 WGGG G G G G G G+G G G G G G GG + G Sbjct: 241 WGGGMGQGPRGWGRGSGGGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSGGGWGRMQGGGM 300 Query: 764 XXXXXXXXXXXXXXXXKG-XXVWGLRVXAGVXGAXXGXG 651 +G WG R+ G G G G Sbjct: 301 GRGPGGGWGRMQGGMGRGPGGGWG-RMQGGGMGRGPGGG 338 Score = 29.5 bits (63), Expect = 4.1 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG G G GGG G GGG G Sbjct: 307 GWGRMQGGMGRGPGGGWGRMQGGGMGRG 334 >SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPGRTXER 842 G GG GG G G GGG GGG G + R Sbjct: 468 GGFGGGGGPNGAGGGGGGGGGYSGGASGSR 497 Score = 34.3 bits (75), Expect = 0.14 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRT 851 G GG G G G GGG GGG GG R+ Sbjct: 469 GFGGGGGPNGAGGGGGGGGGYSGGASGSRS 498 Score = 31.9 bits (69), Expect = 0.77 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG G GGG GGG G G Sbjct: 468 GGFGGGGGPNGAGGGGGGGGGYSGGASG 495 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GG G GGG Sbjct: 481 GGGGGGGGYSGGASGSRSNSCGGG 504 Score = 28.3 bits (60), Expect = 9.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG 875 GGGG GG G GGG G Sbjct: 485 GGGGYSGGASGSRSNSCGGGGG 506 >SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/30 (56%), Positives = 17/30 (56%), Gaps = 3/30 (10%) Frame = -2 Query: 937 GGGXXGGXGGGXG---GGXGGGXGGGXXPG 857 GGG GG GGG G GG GG GGG G Sbjct: 368 GGGRGGGRGGGRGGFRGGRGGRGGGGRGAG 397 Score = 33.1 bits (72), Expect = 0.33 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 G GG GG GG GG GGG G G Sbjct: 374 GRGGGRGGFRGGRGGRGGGGRGAG 397 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +3 Query: 837 RSLSXVLPGXXPPPX--PPPXPPPXPPPXPPXXPPPP 941 RS PG P P PPP PP PP PPPP Sbjct: 266 RSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPP 302 Score = 31.9 bits (69), Expect = 0.77 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP PP PP PP PPP Sbjct: 279 PLGGPPPPPPGRRPPSGKINPPPPPPP 305 Score = 31.5 bits (68), Expect = 1.0 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPX--XPPXP-XXPXTXXXPPP 936 PP PP P P P S P P P PP P P + PPP Sbjct: 128 PPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPP 177 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 837 RSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 R L PG PP P P P PP PPP Sbjct: 150 RPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPP 184 Score = 29.9 bits (64), Expect = 3.1 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPP 914 PPP PP PP PPP Sbjct: 376 PPPVPPSRGPPPPPP 390 Score = 29.5 bits (63), Expect = 4.1 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 5/33 (15%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPP-----XXPPPP 941 P P PPP PPP PP PPPP Sbjct: 214 PSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPP 246 Score = 29.1 bits (62), Expect = 5.5 Identities = 16/59 (27%), Positives = 16/59 (27%) Frame = +3 Query: 762 PPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 PP P R P PPP P P PPP PPP Sbjct: 107 PPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPP 165 Score = 29.1 bits (62), Expect = 5.5 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 5/42 (11%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXP-----PPXPPXXPPPP 941 P S LP P PP P P PP P PPPP Sbjct: 144 PPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPP 185 Score = 28.7 bits (61), Expect = 7.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP PPP P P PPPP Sbjct: 283 PPPPPPGRRPPSGKINPPPPPPP 305 Score = 28.3 bits (60), Expect = 9.5 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 4/29 (13%) Frame = +3 Query: 861 GXXPPPXPPPXPP----PXPPPXPPXXPP 935 G PPP P PP PPP P PP Sbjct: 173 GEPPPPKNAPPPPKRGSSNPPPPPTRGPP 201 Score = 28.3 bits (60), Expect = 9.5 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%) Frame = +3 Query: 870 PPPXPP---PXPPPXPPPXPPXXPPPP 941 PPP PP P P PP PPPP Sbjct: 230 PPPPPPSRDQVPLPPPPLRGQIAPPPP 256 Score = 28.3 bits (60), Expect = 9.5 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 11/40 (27%) Frame = +3 Query: 855 LPGXXPPPXPP-----------PXPPPXPPPXPPXXPPPP 941 L G PP PP P PPP P P PPPP Sbjct: 247 LRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPP 286 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 34.7 bits (76), Expect = 0.11 Identities = 32/97 (32%), Positives = 35/97 (36%), Gaps = 1/97 (1%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXGGX 758 G G GG G G GGG G G GGG G R G G G G Sbjct: 9 GRGSGGGWGQGPGGGWGRGQGGGMGRGPGGGWGR-GSGGGWGRMQGGGMGRGPGGGWGRM 67 Query: 757 LGXEPPHXPRGGXEKGXXCGG*GXLR-GXXGPXXGXG 650 G P GG +G GG G ++ G G G G Sbjct: 68 QGGGMGRGPGGGLGRGPG-GGWGRMQEGGMGRGPGQG 103 Score = 33.1 bits (72), Expect = 0.33 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG G GGG G G GGG G G G Sbjct: 4 GPGGWGRGSGGGWGQGPGGGWGRGQGGG 31 Score = 31.9 bits (69), Expect = 0.77 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPGR 854 G GG G G GGG G G GGG G+ Sbjct: 2 GQGPGGWGRGSGGGWGQGPGGGWGRGQ 28 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PPP PP P PP P PPPP Sbjct: 481 GFPPPPFGPPPPFYRGPPPPRGMPPPP 507 Score = 33.5 bits (73), Expect = 0.25 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP P PP PPPP Sbjct: 469 PPPPMGMYPPPRGFPPPPFGPPPP 492 Score = 33.1 bits (72), Expect = 0.33 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PPP P PP PPP PPPP Sbjct: 474 GMYPPPRGFPPPPFGPPPPFYRGPPPP 500 Score = 29.1 bits (62), Expect = 5.5 Identities = 15/47 (31%), Positives = 17/47 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP+ P P P P P + P P P P P PPP Sbjct: 455 PPNLPPP-PGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPP 500 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 34.7 bits (76), Expect = 0.11 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PP PP P P PPPP Sbjct: 189 PPPAPPGVLPPPPAPPGALIPPPP 212 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 3/33 (9%) Frame = +3 Query: 852 VLPGXXPPPXPPPX---PPPXPPPXPPXXPPPP 941 V PG PP PP PPP PP P P PP Sbjct: 172 VSPGILAPPPAPPGVLAPPPAPPGVLPPPPAPP 204 Score = 31.9 bits (69), Expect = 0.77 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPP 923 PG PPP PP PPP PP Sbjct: 194 PGVLPPPPAPPGALIPPPPAPP 215 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +1 Query: 841 PSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P+P L P P PP P P PPP Sbjct: 181 PAPPGVLAPPPAPPGVLPPPPAPPGALIPPPP 212 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 30.7 bits (66), Expect = 1.8 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 873 PPXPPPXPPPXPPP 914 PP PPP PP PPP Sbjct: 1455 PPPPPPPAPPCPPP 1468 Score = 30.7 bits (66), Expect(2) = 0.12 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 894 PPPXPPPXPPXXPP 935 PPP PPP PP PP Sbjct: 1455 PPPPPPPAPPCPPP 1468 Score = 29.9 bits (64), Expect = 3.1 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 870 PPPXPPPXPPPXPP 911 PPP PPP PP PP Sbjct: 1455 PPPPPPPAPPCPPP 1468 Score = 29.9 bits (64), Expect = 3.1 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 882 PPPXPPPXPPPXPP 923 PPP PPP PP PP Sbjct: 1455 PPPPPPPAPPCPPP 1468 Score = 27.5 bits (58), Expect(2) = 0.94 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 897 PPXPPPXPPXXPPP 938 PP PPP P PPP Sbjct: 1455 PPPPPPPAPPCPPP 1468 Score = 22.6 bits (46), Expect(2) = 0.12 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +3 Query: 870 PPPXPPPXPPPXPP 911 P P PP PP PP Sbjct: 1423 PAPPPPMAFPPMPP 1436 Score = 22.6 bits (46), Expect(2) = 0.94 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +3 Query: 882 PPPXPPPXPPPXPP 923 P P PP PP PP Sbjct: 1423 PAPPPPMAFPPMPP 1436 >SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 34.3 bits (75), Expect = 0.14 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PP PP P PPP P PPPP Sbjct: 225 PGGMPPGRMPPQGLPFPPPGP--IPPPP 250 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 3/29 (10%) Frame = +3 Query: 858 PGXXPP---PXPPPXPPPXPPPXPPXXPP 935 PG PP P PPP P P PP PP Sbjct: 230 PGRMPPQGLPFPPPGPIPPPPGAGGMRPP 258 Score = 28.7 bits (61), Expect = 7.2 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 4/31 (12%) Frame = +3 Query: 858 PGXXPPPX--PPPX--PPPXPPPXPPXXPPP 938 PG PPP PPP PP PP PPP Sbjct: 213 PGLMPPPGMLPPPGGMPPGRMPPQGLPFPPP 243 Score = 28.7 bits (61), Expect = 7.2 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPP 923 +P PP P PPP P P PP Sbjct: 228 MPPGRMPPQGLPFPPPGPIPPPP 250 >SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 34.3 bits (75), Expect = 0.14 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP P PP PPPP Sbjct: 5 PPPPPPPPPIAAEFTAPPAPPPPP 28 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 5/29 (17%) Frame = +3 Query: 870 PPPXPPP-----XPPPXPPPXPPXXPPPP 941 PPP PPP PP PPP P P P Sbjct: 7 PPPPPPPIAAEFTAPPAPPPPPNPAPDVP 35 >SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) Length = 295 Score = 34.3 bits (75), Expect = 0.14 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Frame = +3 Query: 873 PPXPPPXPPPXP--PPXPPXXPPPP 941 PP PP PP P PP PP PP P Sbjct: 235 PPVPPTNPPVPPTNPPAPPTNPPKP 259 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXP---PPXPPXXPPPP 941 P PP P PP P PP PP PP P Sbjct: 222 PTTQTPPTKAPTDPPVPPTNPPVPPTNPPAP 252 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPPP 941 P PP PP PP P P PP Sbjct: 232 PTDPPVPPTNPPVPPTNPPAPP 253 >SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) Length = 340 Score = 34.3 bits (75), Expect = 0.14 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPP 923 PPP PPP PP PPP PP Sbjct: 162 PPPQPPP--PPLPPPPPP 177 Score = 32.3 bits (70), Expect = 0.59 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXPPPP 941 PPP PP PPP PP PPPP Sbjct: 162 PPPQPP--PPPLPP--PPPP 177 >SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 33.9 bits (74), Expect = 0.19 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXP 932 PP PPP P P PP PP P Sbjct: 142 PPPPPPPPSPPPPCHPPALP 161 Score = 32.7 bits (71), Expect = 0.44 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 885 PPXPPPXPPPXPPXXPP 935 PP PPP P P PP PP Sbjct: 142 PPPPPPPPSPPPPCHPP 158 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPP 923 PPP PP PPP PP P Sbjct: 144 PPPPPPSPPPPCHPPALP 161 Score = 29.1 bits (62), Expect = 5.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 888 PXPPPXPPPXPPXXPPP 938 P PPP PP PP PP Sbjct: 142 PPPPPPPPSPPPPCHPP 158 Score = 28.7 bits (61), Expect = 7.2 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 894 PPPXPPPXPPXXPPPP 941 PPP PPP PP PP Sbjct: 143 PPPPPPPSPPPPCHPP 158 >SB_36422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = +3 Query: 873 PPXPPPXPP--PXPPPXPPXXPPP 938 PP PP PP P PPP PP PPP Sbjct: 29 PPEAPPLPPFAPLPPPVPP--PPP 50 >SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) Length = 3922 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGGG GG GGG G G GG G Sbjct: 3703 GGGGGYGGGGGGYGDGTGGAAFG 3725 Score = 32.7 bits (71), Expect = 0.44 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GG G GG GG GGG G G GG Sbjct: 3699 GGYGGGGGGYGGGGGGYGDGTGG 3721 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGG 869 GG GG GGG G G GGG G G Sbjct: 3698 GGGYGGGGGGYG-GGGGGYGDG 3718 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 922 GGXGGGXGGGXGGGXGGGXXPG 857 GG GGG GG GGG G G G Sbjct: 3699 GGYGGGGGGYGGGGGGYGDGTG 3720 Score = 28.7 bits (61), Expect = 7.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 913 GGGXGGGXGGGXGGGXXPG 857 GGG GGG GG GGG G Sbjct: 3698 GGGYGGGGGGYGGGGGGYG 3716 >SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) Length = 287 Score = 33.9 bits (74), Expect = 0.19 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG G GGG GGG GG GGG Sbjct: 263 GGGGACGCNGGGAGGG-GGYSGGG 285 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG 875 GG G GG G GGG GGG G Sbjct: 259 GGFGGGGGACGCNGGGAGGGGG 280 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GG G GG GGG G Sbjct: 259 GGFGGGGGACGCNGGGAGGGGGYSG 283 >SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1929 Score = 33.9 bits (74), Expect = 0.19 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPP 935 PP PPP P PP PP PP Sbjct: 1166 PPQPPPVPSVQAPPAPPPAPP 1186 >SB_1966| Best HMM Match : GRP (HMM E-Value=0.53) Length = 178 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GGG G G G G GG Sbjct: 39 GGGHGGGHGGGRGRGRGHGHGG 60 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 922 GGXGGGXGGGXGGGXGGG 869 GG GGG GGG G G G G Sbjct: 40 GGHGGGHGGGRGRGRGHG 57 Score = 29.5 bits (63), Expect = 4.1 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 913 GGGXGGGXGGGXGGGXXPG 857 GGG GGG GGG G G G Sbjct: 39 GGGHGGGHGGGRGRGRGHG 57 >SB_52684| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 33.5 bits (73), Expect = 0.25 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPP 938 PP P P PP PPP PP P Sbjct: 139 PPQPSPPQPPQPPPQPPDQQGP 160 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 33.5 bits (73), Expect = 0.25 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG P P PPP P P P P PP Sbjct: 800 PGARPTPPPPPPGKPTKPTKPSLPPVPP 827 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 2/26 (7%) Frame = +3 Query: 870 PPPXP--PPXPPPXPPPXPPXXPPPP 941 PP P PP P PPP PP P P Sbjct: 792 PPNIPSRPPGARPTPPPPPPGKPTKP 817 Score = 29.9 bits (64), Expect = 3.1 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 8/35 (22%) Frame = +3 Query: 861 GXXPPPXPPPXP-----PPXPPPXPPX---XPPPP 941 G PPP PP P PP P PP PPPP Sbjct: 775 GAPPPPPPPTKPATPRVPPNIPSRPPGARPTPPPP 809 Score = 29.9 bits (64), Expect = 3.1 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 2/48 (4%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPS--PXFSLXXXPXPXPXXPPXPXXPXTXXXPP 933 PP PP P P P P P P P P P P PP Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPP 824 Score = 29.5 bits (63), Expect = 4.1 Identities = 15/39 (38%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +3 Query: 831 PXRSLSXVLPGXXP--PPXPPPXPPPXPPPXPPXXPPPP 941 P + + +P P PP P PPP PPP P P P Sbjct: 783 PTKPATPRVPPNIPSRPPGARPTPPP-PPPGKPTKPTKP 820 >SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) Length = 188 Score = 33.5 bits (73), Expect = 0.25 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 870 PPPXPPPXPPPXPPP 914 PPP PPP PPP PP Sbjct: 32 PPPSPPPSPPPPSPP 46 Score = 33.5 bits (73), Expect = 0.25 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 870 PPPXPPPXPPPXPPP 914 PPP PPP PPP PP Sbjct: 155 PPPSPPPSPPPPSPP 169 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXPPP 938 PPP PPP PPP P P Sbjct: 32 PPPSPPPSPPPPSPPLDCP 50 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXPPP 938 PPP PPP PPP P P Sbjct: 155 PPPSPPPSPPPPSPPLDCP 173 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPP 935 P PP PP PPP PP P Sbjct: 31 PPPPSPPPSPPPPSPPLDCP 50 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPP 935 P PP PP PPP PP P Sbjct: 154 PPPPSPPPSPPPPSPPLDCP 173 Score = 28.3 bits (60), Expect = 9.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 906 PPPXPPXXPPPP 941 PPP PP PPPP Sbjct: 32 PPPSPPPSPPPP 43 Score = 28.3 bits (60), Expect = 9.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 906 PPPXPPXXPPPP 941 PPP PP PPPP Sbjct: 155 PPPSPPPSPPPP 166 >SB_5429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 33.5 bits (73), Expect = 0.25 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPP 938 PP P P PP PPP PP P Sbjct: 157 PPQPSPPQPPQPPPQPPDQQGP 178 >SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2631 Score = 33.1 bits (72), Expect = 0.33 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 G GG GG GG GG GG GG Sbjct: 804 GAGGSSGGASGGAGGSSGGASGG 826 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 G G GG GG GG GG GG Sbjct: 771 GAGSSSGGASGGAGGSSGGANGG 793 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 G GG GG GG G GG GG Sbjct: 782 GAGGSSGGANGGAGSSSGGASGG 804 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 G G GG GG GG GG GG Sbjct: 793 GAGSSSGGASGGAGGSSGGASGG 815 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 G G GG GG GG GG GG Sbjct: 800 GASGGAGGSSGGASGGAGGSSGG 822 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 G GG GG GG G GG GG Sbjct: 815 GAGGSSGGASGGAGSSSGGASGG 837 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 2/28 (7%) Frame = -2 Query: 934 GGXXGGXGGGXGG--GXGGGXGGGXXPG 857 GG GG GG GG G GG GG G Sbjct: 799 GGASGGAGGSSGGASGGAGGSSGGASGG 826 Score = 28.3 bits (60), Expect = 9.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 G G GG GG GG G GG Sbjct: 778 GASGGAGGSSGGANGGAGSSSGG 800 Score = 28.3 bits (60), Expect = 9.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 G G G GG GG GG GG Sbjct: 789 GANGGAGSSSGGASGGAGGSSGG 811 Score = 28.3 bits (60), Expect = 9.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GG G G G GG GG GG Sbjct: 792 GGAGSSSGGASGGAGGSSGGASGG 815 Score = 28.3 bits (60), Expect = 9.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 G G GG GG GG G GG Sbjct: 811 GASGGAGGSSGGASGGAGSSSGG 833 Score = 28.3 bits (60), Expect = 9.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGG 872 GG GG G GG GG GG Sbjct: 821 GGASGGAGSSSGGASGGADGG 841 >SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 965 Score = 33.1 bits (72), Expect = 0.33 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPP 935 P P PPP PP P P PP P Sbjct: 461 PIPPPPPMSPPPPTPPPPATSP 482 Score = 31.9 bits (69), Expect = 0.77 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 888 PXPPPXPPPXPPXXPPPP 941 P PPP P PP PPPP Sbjct: 461 PIPPPPPMSPPPPTPPPP 478 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPPP 941 P PPP P PPP PP P Sbjct: 461 PIPPPPPMSPPPPTPPPPATSP 482 Score = 29.5 bits (63), Expect = 4.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPP 923 P PPP PP P P PP P Sbjct: 461 PIPPPPPMSPPPPTPPPPATSP 482 >SB_37850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 509 Score = 33.1 bits (72), Expect = 0.33 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGG--XGGGXGGGXXPG 857 GGGG G G G GGG GG GG PG Sbjct: 254 GGGGVIAGAGAGIGGGVIGTGGIPGGILPG 283 Score = 29.5 bits (63), Expect = 4.1 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG GG GGG G G G G Sbjct: 242 GGVGGLGGIGGLGGGGVIAGAGAGIGGG 269 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 33.1 bits (72), Expect = 0.33 Identities = 18/66 (27%), Positives = 24/66 (36%) Frame = +3 Query: 744 GSXPXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPPXPP 923 G+ P PP P + P +++ +P P P PPP P P Sbjct: 380 GNGPGGPPPPWSK---PGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQP 436 Query: 924 XXPPPP 941 PPPP Sbjct: 437 PPPPPP 442 Score = 32.3 bits (70), Expect = 0.59 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 PG PPP PP P PPP PP P Sbjct: 421 PGYIPPP-PPGFPQFQPPPPPPPSDAP 446 Score = 31.9 bits (69), Expect = 0.77 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P PP PP P P PPPP Sbjct: 315 PAAFAPAPPPSQAPPPPKTIPSTLPPPP 342 Score = 28.3 bits (60), Expect = 9.5 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PPP P P PP PPP Sbjct: 304 GEAPPPPAASEPAAFAPAPPPSQAPPP 330 >SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 33.1 bits (72), Expect = 0.33 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPP 923 G P P PPP P PPP PP Sbjct: 166 GEGPNPSPPPSGAPPPPPPPP 186 Score = 29.5 bits (63), Expect = 4.1 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXPPPP 941 P P PPP P PP PPPP Sbjct: 169 PNPSPPPSGAPPPP--PPPP 186 Score = 29.1 bits (62), Expect = 5.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPP 911 P PPP P PPP PP Sbjct: 169 PNPSPPPSGAPPPPPPPP 186 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 33.1 bits (72), Expect = 0.33 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 4/31 (12%) Frame = +3 Query: 858 PGXXPPPXPPPX--PPPXPPPX--PPXXPPP 938 P PP PPP PP PPP PP PPP Sbjct: 2166 PLGAPPSVPPPMGAPPSGPPPMGAPPSGPPP 2196 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 4/32 (12%) Frame = +3 Query: 858 PGXXPPPX--PPPXPPPX--PPPXPPXXPPPP 941 P PPP PP PPP PP PP PP Sbjct: 2170 PPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPP 2201 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 4/31 (12%) Frame = +3 Query: 858 PGXXPPPXPPP--XPPPXPPP--XPPXXPPP 938 P PP PPP PP PPP PP PP Sbjct: 2176 PMGAPPSGPPPMGAPPSGPPPMGTPPSGHPP 2206 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 4/31 (12%) Frame = +3 Query: 858 PGXXPPPXPPPX--PPPXPPPX--PPXXPPP 938 P PP PPP PP PP PP PPP Sbjct: 2186 PMGAPPSGPPPMGTPPSGHPPMGAPPMGPPP 2216 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 4/31 (12%) Frame = +3 Query: 858 PGXXPPPXPPPX--PPPXPPPX--PPXXPPP 938 P P P P PP PPP PP PPP Sbjct: 2156 PARHSPSGPSPLGAPPSVPPPMGAPPSGPPP 2186 >SB_45079| Best HMM Match : RRM_1 (HMM E-Value=0.0027) Length = 253 Score = 33.1 bits (72), Expect = 0.33 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 922 GGXGGGXGGGXGGGXGGG 869 GG GGG GGG GG GGG Sbjct: 164 GGGGGGGGGGGGGRRGGG 181 Score = 31.5 bits (68), Expect = 1.0 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GGGG GG GGG GG GGG R+ R G Sbjct: 164 GGGG--GGGGGGGGGRRGGGSMSPPRRSRSRSPRRGG 198 >SB_30029| Best HMM Match : Extensin_2 (HMM E-Value=0.45) Length = 622 Score = 33.1 bits (72), Expect = 0.33 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPP 935 P R+LS PG P P PPP P P PP Sbjct: 501 PMRNLSEGFPGGNPLQGSGPVPPPAYPTRPSSNPP 535 >SB_27977| Best HMM Match : ARID (HMM E-Value=1.6e-26) Length = 1536 Score = 33.1 bits (72), Expect = 0.33 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPP 935 P R+LS PG P P PPP P P PP Sbjct: 125 PMRNLSEGFPGGNPLQGSGPVPPPAYPTRPSSNPP 159 >SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) Length = 1103 Score = 33.1 bits (72), Expect = 0.33 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 ++P PPP P PP PP P PPP Sbjct: 77 MMPFPPPPPIYMPPPPVYMPPPPVYMPPP 105 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPPPX---PPPXPPPXPPXXPPPP 941 P P P PPP PPP P PP PPP Sbjct: 75 PMMMPFPPPPPIYMPPPPVYMPPPPVYMPPP 105 >SB_6008| Best HMM Match : CPSase_L_D2 (HMM E-Value=0) Length = 866 Score = 33.1 bits (72), Expect = 0.33 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G GG GGG GGG G G G Sbjct: 752 GDGDGDGDGGSNGGGDGGGDGDGDGDG 778 Score = 33.1 bits (72), Expect = 0.33 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G GGG GGG G G G G G Sbjct: 756 GDGDGGSNGGGDGGGDGDGDGDGDGDG 782 Score = 33.1 bits (72), Expect = 0.33 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG GG GGG G G G G G G G Sbjct: 760 GGSNGGGDGGGDGDGDGDGDGDGDGDG 786 Score = 32.7 bits (71), Expect = 0.44 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G G G GG GGG GGG G Sbjct: 747 GGDDDGDGDGDGDGGSNGGGDGGGDGDG 774 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 33.1 bits (72), Expect = 0.33 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXP 932 P PPP PPP PPP P P Sbjct: 375 PFAPPPPPPPPPPPAPGSTP 394 Score = 32.3 bits (70), Expect = 0.59 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXP 920 PPP PPP PPP P P Sbjct: 378 PPPPPPPPPPPAPGSTP 394 Score = 31.5 bits (68), Expect = 1.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPP 935 P PP PPP PPP P P Sbjct: 375 PFAPPPPPPPPPPPAPGSTP 394 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P P P PP PP PPPP Sbjct: 361 PAPTPAPLSSTPCAPFAPPPPPPPPPPP 388 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXP 932 P P PPP PPP PP P Sbjct: 372 PCAPFAPPPPPPPPPPPAP 390 Score = 29.5 bits (63), Expect = 4.1 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXP 903 PPS P P P P F+ P P P PP P Sbjct: 357 PPSTPAPTPAPLSSTPCAPFA--PPPPPPPPPPPAP 390 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPPPXPPPXPP-PXPPPXPPXXPPPP 941 P P P P P P P PP PPPP Sbjct: 357 PPSTPAPTPAPLSSTPCAPFAPPPPPPPP 385 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P P P PPP PP PP P Sbjct: 363 PTPAPLSSTPCAPFAPPPPPPPPPPPAP 390 >SB_21796| Best HMM Match : COLFI (HMM E-Value=0) Length = 1239 Score = 29.1 bits (62), Expect(2) = 0.34 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 3/21 (14%) Frame = +3 Query: 885 PPXPPPXPPP---XPPXXPPP 938 PP PPP PPP PP P P Sbjct: 89 PPIPPPTPPPQRRGPPGDPGP 109 Score = 22.6 bits (46), Expect(2) = 0.34 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXP 908 + V+PG P PP PP P Sbjct: 36 MGDVVPGTCPVFPPPAECPPEP 57 >SB_53480| Best HMM Match : Sigma70_r1_1 (HMM E-Value=5.7) Length = 402 Score = 32.7 bits (71), Expect = 0.44 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G G G G G GGG GGG G Sbjct: 73 GDGDGDGDGDGDGDGDGGGGGGGDGDG 99 Score = 29.5 bits (63), Expect = 4.1 Identities = 19/51 (37%), Positives = 21/51 (41%), Gaps = 5/51 (9%) Frame = -1 Query: 932 GGXXXVXGXXGXG----GXXGXGXGXXSRENXGEGXXXXXG-GXGXGGEGG 795 GG V G G G G G G G + G+G G G G GG GG Sbjct: 45 GGDDDVDGDDGDGDGDDGDDGDGDGDGDGDGDGDGDGDGDGDGDGGGGGGG 95 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/38 (34%), Positives = 16/38 (42%) Frame = -1 Query: 911 GXXGXGGXXGXGXGXXSRENXGEGXXXXXGGXGXGGEG 798 G G G G G G + G+G GG G G+G Sbjct: 62 GDDGDGDGDGDGDGDGDGDGDGDGDGDGGGGGGGDGDG 99 Score = 29.5 bits (63), Expect = 4.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXG 875 G G G GGG GGG G G G Sbjct: 81 GDGDGDGDGGGGGGGDGDGDG 101 >SB_50380| Best HMM Match : PMC2NT (HMM E-Value=2.4) Length = 362 Score = 32.7 bits (71), Expect = 0.44 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGG 881 GGGG GG G G GG GGG Sbjct: 154 GGGGRGGGRGHGRGGSGGGG 173 Score = 31.9 bits (69), Expect = 0.77 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 G GG GG GGG G G GG GGG Sbjct: 152 GRGG--GGRGGGRGHGRGGSGGGG 173 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GGG GGG G G GG G Sbjct: 148 GPVRGRGGGGRGGGRGHGRGGSGGGG 173 >SB_38546| Best HMM Match : Trypsin (HMM E-Value=1.90577e-43) Length = 506 Score = 32.7 bits (71), Expect = 0.44 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 P P PP P P PP PPPP Sbjct: 224 PTPPPPVKTTAAPTPSPPQTPPPP 247 >SB_19562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 279 Score = 32.7 bits (71), Expect = 0.44 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G GGG GGG G G GG G Sbjct: 233 GDGNGDGDGGGGDGGGDGDGDDGGVGDG 260 Score = 29.5 bits (63), Expect = 4.1 Identities = 15/47 (31%), Positives = 17/47 (36%) Frame = -1 Query: 935 GGGXXXVXGXXGXGGXXGXGXGXXSRENXGEGXXXXXGGXGXGGEGG 795 G G G G G G G G+G GG G G +GG Sbjct: 210 GDGGDGNGDGEGEGEGEGDGDGDGDGNGDGDGGGGDGGGDGDGDDGG 256 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G G GGG GGG G G G Sbjct: 229 GDGDGDGNGDGDGGGGDGGGDGDGDDGG 256 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G G G G G GGG GGG G Sbjct: 227 GDGDGDGDGNGDGDG-GGGDGGGDGDG 252 >SB_9718| Best HMM Match : Metallothio_2 (HMM E-Value=1.3) Length = 279 Score = 32.7 bits (71), Expect = 0.44 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGG 881 GGGG GG G G GG GGG Sbjct: 71 GGGGRGGGRGHGRGGSGGGG 90 Score = 31.9 bits (69), Expect = 0.77 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 G GG GG GGG G G GG GGG Sbjct: 69 GRGG--GGRGGGRGHGRGGSGGGG 90 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GGG GGG G G GG G Sbjct: 65 GPVRGRGGGGRGGGRGHGRGGSGGGG 90 >SB_7559| Best HMM Match : Metallothio_2 (HMM E-Value=2) Length = 532 Score = 32.7 bits (71), Expect = 0.44 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGG 881 GGGG GG G G GG GGG Sbjct: 324 GGGGRGGGRGRGRGGSGGGG 343 Score = 31.9 bits (69), Expect = 0.77 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 G GG GG GGG G G GG GGG Sbjct: 322 GRGG--GGRGGGRGRGRGGSGGGG 343 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GGG GGG G G GG G Sbjct: 318 GPVRGRGGGGRGGGRGRGRGGSGGGG 343 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 32.7 bits (71), Expect = 0.44 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP PPP P PP PPPP Sbjct: 755 PPPPPPPAVPGEGARPPPPPPPP 777 Score = 31.9 bits (69), Expect = 0.77 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 PPP PPP P PP PPP Sbjct: 755 PPPPPPPAVPGEGARPPPPPPPP 777 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/53 (32%), Positives = 18/53 (33%), Gaps = 7/53 (13%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXP-------XPXXPPXPXXPXTXXXPPP 936 P PP P PP + F L P P PP P P PPP Sbjct: 720 PPPPAPPPPPLGRDSAAVFMLTWTPLTNTSSAANVPPPPPPPAVPGEGARPPP 772 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 32.7 bits (71), Expect = 0.44 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 PPP PP PPP P PPP Sbjct: 511 PPPPPPASPPPPLPAEEDNSPPP 533 Score = 32.7 bits (71), Expect = 0.44 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP PPP PP P P PPP Sbjct: 511 PPPPPPASPPPPLPAEEDNSPPP 533 Score = 31.9 bits (69), Expect = 0.77 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 6/39 (15%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPPPXPPPXP------PPXPPXXPPP 938 SL V PPP P PPP P PP P PPP Sbjct: 502 SLDFVEDRSPPPPPPASPPPPLPAEEDNSPPPLPAGPPP 540 >SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74) Length = 483 Score = 32.3 bits (70), Expect = 0.59 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P P P P P PPP PP PP P Sbjct: 161 PTTKPTPAPHSSPSPTPPP-PPIIPPCP 187 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPP 923 P P P P PPP PP PP Sbjct: 167 PAPHSSPSPTPPPPPIIPPCPP 188 Score = 29.9 bits (64), Expect = 3.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPP 935 P P P P P PPP P PP Sbjct: 167 PAPHSSPSPTPPPPPIIPPCPP 188 >SB_59765| Best HMM Match : Metallothio_2 (HMM E-Value=4.3) Length = 229 Score = 32.3 bits (70), Expect = 0.59 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGG 881 GGGG GG G G GG GGG Sbjct: 124 GGGGRGGGRGYGRGGSGGGG 143 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 G GG GG GGG G G GG GGG Sbjct: 122 GRGG--GGRGGGRGYGRGGSGGGG 143 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GGG GGG G G GG G Sbjct: 118 GPVRGRGGGGRGGGRGYGRGGSGGGG 143 >SB_49744| Best HMM Match : Tubulin_C (HMM E-Value=6.7) Length = 370 Score = 32.3 bits (70), Expect = 0.59 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G GGG GGG G G G G G Sbjct: 252 GDGDGDGDGGGGGGGGDGDGDGDGDGDG 279 Score = 32.3 bits (70), Expect = 0.59 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G GGG GGG GG G G G Sbjct: 321 GDGDGDGDGGGGDGGGDDGGDGDGDGDG 348 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 G G G G G G G GGG GGG Sbjct: 244 GDGDGDGDGDGDGDGDGGGGGGG 266 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = -1 Query: 902 GXGGXXGXGXGXXSRENXGEGXXXXXGGXGXGGEGG 795 G G G G G + G+G GG G G +GG Sbjct: 305 GDGDGDGDGDGDGDGDGDGDGDGDGGGGDGGGDDGG 340 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G G GGG GGG G G G Sbjct: 248 GDGDGDGDGDGDGGGGGGGGDGDGDGDG 275 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G G GGG GGG GG G Sbjct: 317 GDGDGDGDGDGDGGGGDGGGDDGGDGDG 344 Score = 29.1 bits (62), Expect = 5.5 Identities = 15/48 (31%), Positives = 18/48 (37%) Frame = -1 Query: 941 GWGGGXXXVXGXXGXGGXXGXGXGXXSRENXGEGXXXXXGGXGXGGEG 798 G G G G G GG G G G + G+G G G+G Sbjct: 250 GDGDGDGDGDGGGGGGGGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDG 297 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G G G G G GGG GGG G Sbjct: 246 GDGDGDGDGDGDGDG-GGGGGGGDGDG 271 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G G G G G GGG GGG G Sbjct: 315 GDGDGDGDGDGDGDG-GGGDGGGDDGG 340 >SB_37025| Best HMM Match : Homeobox (HMM E-Value=1.3e-16) Length = 154 Score = 32.3 bits (70), Expect = 0.59 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PPP P PP P PP P P Sbjct: 96 PGTPPPPMYPAFPPSFPSSPPPEYPGLP 123 >SB_36275| Best HMM Match : Extensin_2 (HMM E-Value=0.062) Length = 406 Score = 32.3 bits (70), Expect = 0.59 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +1 Query: 805 PPXPXP-PXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 PP P P P+P S+ P P PP P P T P PH Sbjct: 254 PPTPTPHTSIPPTPTPHTSIPPTPTPHTSIPPTP-TPHTSIPPTPH 298 >SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 32.3 bits (70), Expect = 0.59 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG P PPP P P P PP P P Sbjct: 424 PGGGVPSHPPPLPQPPPSIIPPPTTPLP 451 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPP 938 G P P PPP P P P PPP Sbjct: 421 GGPPGGGVPSHPPPLPQPPPSIIPPP 446 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%) Frame = +3 Query: 870 PPPXPPPXP---PPXPPPXPPXXPPPP 941 PPP P P P PP P P P PP Sbjct: 432 PPPLPQPPPSIIPPPTTPLPQTVPTPP 458 >SB_14695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 32.3 bits (70), Expect = 0.59 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PPP P PP P PP P P Sbjct: 149 PGTPPPPMYPAFPPSFPSSPPPEYPGLP 176 >SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) Length = 2735 Score = 32.3 bits (70), Expect = 0.59 Identities = 16/40 (40%), Positives = 20/40 (50%), Gaps = 4/40 (10%) Frame = +3 Query: 831 PXRSLSXVLPGXXPP--PXPPPXPP--PXPPPXPPXXPPP 938 P + + ++P PP P PPP P P P PP PPP Sbjct: 2609 PPQMMPPMVPMMLPPMLPLPPPGLPMQPEAPVQPPPLPPP 2648 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXP 932 PG P P PPP PPP P P Sbjct: 2630 PGLPMQPEAPVQPPPLPPPGGPFPP 2654 Score = 28.3 bits (60), Expect = 9.5 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 2/26 (7%) Frame = +3 Query: 870 PPPXPP--PXPPPXPPPXPPXXPPPP 941 PPP P P P PPP PP P P Sbjct: 2628 PPPGLPMQPEAPVQPPPLPPPGGPFP 2653 >SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) Length = 1706 Score = 32.3 bits (70), Expect = 0.59 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = +3 Query: 873 PPXPP-PXPPPXPPPXPPXXPPPP 941 PP PP P P PP PP P PP Sbjct: 1259 PPLPPLPPPDAQPPSLPPQPPQPP 1282 Score = 31.9 bits (69), Expect = 0.77 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 PP PP PP PP PP P P Sbjct: 1262 PPLPPPDAQPPSLPPQPPQPPQP 1284 Score = 28.3 bits (60), Expect = 9.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXP 920 LP PP PP PP PP P Sbjct: 1261 LPPLPPPDAQPPSLPPQPPQPP 1282 >SB_3427| Best HMM Match : Homeobox (HMM E-Value=4e-24) Length = 245 Score = 32.3 bits (70), Expect = 0.59 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PPP P PP P PP P P Sbjct: 186 PGTPPPPMYPAFPPSFPSSPPPEYPGLP 213 >SB_42661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1717 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = -2 Query: 937 GGGXXGGXGGGXG-GGXGGGXGG 872 G G G G G G GG GGG GG Sbjct: 234 GAGSDSGVGSGGGYGGVGGGSGG 256 Score = 26.6 bits (56), Expect(2) = 0.72 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGG 896 G GG GG GGG GG Sbjct: 242 GSGGGYGGVGGGSGG 256 Score = 23.8 bits (49), Expect(2) = 0.72 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -2 Query: 922 GGXGGGXGGGXGGG 881 G GGG GG GGG Sbjct: 269 GSGGGGSWGGAGGG 282 >SB_51714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 31.9 bits (69), Expect = 0.77 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 P P PPP PP P P PPP Sbjct: 363 PTPPPPPHSPPPPLPVIQLNPPP 385 >SB_47181| Best HMM Match : Pkinase (HMM E-Value=7.7e-31) Length = 801 Score = 31.9 bits (69), Expect = 0.77 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 G G G GGG GGG G GGG Sbjct: 338 GSGDRGFLGGGGGGGGSSGGGGG 360 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXE 845 G G G G GGG GGG G GR E Sbjct: 333 GSAGDGSGDRGFLGGGGGGGGSSGGGGGRDDE 364 >SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) Length = 519 Score = 31.9 bits (69), Expect = 0.77 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PP P P PPP P P P Sbjct: 41 PRPLPPLREPPTPAPTPPPALPSTPTLP 68 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXP--PXXPPP 938 LP PP P P PPP P P P P P Sbjct: 44 LPPLREPPTPAPTPPPALPSTPTLPLAPRP 73 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPP 938 P P P PP PP P PPP Sbjct: 38 PHGPRPLPPLREPPTPAPTPPP 59 >SB_45113| Best HMM Match : CemA (HMM E-Value=6) Length = 363 Score = 31.9 bits (69), Expect = 0.77 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGG 881 GGGG GG G G GGG G G Sbjct: 154 GGGGRRGGRGRGGGGGGGEG 173 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GGG GG G G GGG G Sbjct: 148 GPMRGRGGGGRRGGRGRGGGGGGGEG 173 >SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 955 Score = 31.9 bits (69), Expect = 0.77 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P R S P P PPP P P P PPPP Sbjct: 517 PIRCSSVSRPVRPTGPPPPPVPKPQFDDTPTRAPPPP 553 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 31.9 bits (69), Expect = 0.77 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +3 Query: 852 VLPGXX-PPPXPPPXPPPXPPPXPPXXPPPP 941 VLPG PP P P PPP PPPP Sbjct: 886 VLPGLPGTPPITSPSSLPPPPPLQGYNPPPP 916 Score = 30.7 bits (66), Expect = 1.8 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 870 PPPXPPPXPPPXPP 911 PPP PPP PPP P Sbjct: 818 PPPPPPPPPPPEEP 831 Score = 30.7 bits (66), Expect = 1.8 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 882 PPPXPPPXPPPXPP 923 PPP PPP PPP P Sbjct: 818 PPPPPPPPPPPEEP 831 Score = 28.7 bits (61), Expect = 7.2 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXP 932 P PPP PPP PP P Sbjct: 813 PHEDSPPPPPPPPPPPEEP 831 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPP 914 P PP PPP PPP P Sbjct: 813 PHEDSPPPPPPPPPPPEEP 831 >SB_28631| Best HMM Match : Drf_FH1 (HMM E-Value=0.35) Length = 240 Score = 31.9 bits (69), Expect = 0.77 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P PP P PPPP Sbjct: 63 PPPLPTEAVPDGPPGEHPDLPPPP 86 >SB_23868| Best HMM Match : Gal_Lectin (HMM E-Value=1.4e-05) Length = 318 Score = 31.9 bits (69), Expect = 0.77 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P P P P P P P P Sbjct: 93 PPPQPAPLPEPEPEPEPDLDLPVP 116 >SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) Length = 288 Score = 31.9 bits (69), Expect = 0.77 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = +3 Query: 861 GXXPPPXPPPXPP--PXPPPXPPXXPPPP 941 G PP PP PP PPP P PPP Sbjct: 209 GPLPPTAAPPPPPTTGAPPPTPVTNKPPP 237 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 846 SXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 S LP PP PP P P P PPP Sbjct: 208 SGPLPPTAAPPPPPTTGAPPPTPVTNKPPPP 238 Score = 29.5 bits (63), Expect = 4.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 PPP P PP P P PPP Sbjct: 226 PPPTPVTNKPPPPRPATTQAPPP 248 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 31.9 bits (69), Expect = 0.77 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG G G GGG GG GGG G Sbjct: 197 GGRGGYGGRGRG-GGGRGGYGGGGGYGG 223 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -2 Query: 940 GGGGXXG-GXGGGXGGGXGGGXGGGXXPG 857 G GG G G GGG GG GGG G G G Sbjct: 198 GRGGYGGRGRGGGGRGGYGGGGGYGGYGG 226 >SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 31.9 bits (69), Expect = 0.77 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXG-GGXGGGXXPG 857 GG G G GG GGG G GG GGG G Sbjct: 197 GGRGAPRGRGGPRGGGGGSGGYGGGSYGG 225 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXG--GGXGGGXXPG 857 GGGG GG GGG GG G GG G G Sbjct: 210 GGGGGSGGYGGGSYGGYGNYGGYSQGGYGG 239 Score = 29.5 bits (63), Expect = 4.1 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXGGXGG--GXGGGXGGGXGGGXXPG 857 G GG GG G G GG GGG G G G Sbjct: 191 GRGGRGGGRGAPRGRGGPRGGGGGSGGYGG 220 Score = 29.1 bits (62), Expect = 5.5 Identities = 17/32 (53%), Positives = 17/32 (53%), Gaps = 4/32 (12%) Frame = -2 Query: 940 GGGGXXGGXGG--GXGGGXGGGXG--GGXXPG 857 G GG GG GG G GGG GG G GG G Sbjct: 204 GRGGPRGGGGGSGGYGGGSYGGYGNYGGYSQG 235 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 31.9 bits (69), Expect = 0.77 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 PPP PPP P P P P P P Sbjct: 1662 PPPPPPPAPGPPGPDGPMGLPGP 1684 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXP 932 P PPP PPP P P P P Sbjct: 1660 PAPPPPPPPAPGPPGPDGP 1678 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Frame = +3 Query: 870 PPPXPPPXPPPXPP-PXPPXXPPPP 941 P P PPP P P PP P P P P Sbjct: 1660 PAPPPPPPPAPGPPGPDGPMGLPGP 1684 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 31.9 bits (69), Expect = 0.77 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PP PP PPPP Sbjct: 781 PTTPPPEYPPPPPGLARPNPPPP 803 Score = 31.5 bits (68), Expect = 1.0 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 PPP PP PP P PP PP Sbjct: 784 PPPEYPPPPPGLARPNPPPPNPP 806 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPP 935 +P PP PPP P P PP PP Sbjct: 780 IPTTPPPEYPPPPPGLARPNPPPPNPP 806 Score = 28.7 bits (61), Expect = 7.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 P PP PPP P P PPP Sbjct: 781 PTTPPPEYPPPPPGLARPNPPPP 803 >SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) Length = 472 Score = 31.9 bits (69), Expect = 0.77 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GG GGG GG GG G Sbjct: 136 GGGAAGG-GGQEGGGQGGAQAGGSTSG 161 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGR 854 GGGG GG G GG G GG G+ Sbjct: 122 GGGGQAGGQAGSQAGGGAAGGGGQEGGGQ 150 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPGRT 851 G GG G GG GGG GG G T Sbjct: 132 GSQAGGGAAGGGGQEGGGQGGAQAGGST 159 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = -2 Query: 937 GGGXXGGXGGG--XGGGXGGGXGGGXXPG 857 GGG GG GG GGG GG G G Sbjct: 109 GGGEAGGEAGGQAGGGGQAGGQAGSQAGG 137 Score = 28.3 bits (60), Expect = 9.5 Identities = 21/81 (25%), Positives = 22/81 (27%), Gaps = 2/81 (2%) Frame = -2 Query: 934 GGXXGGXGGGXG--GGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXGG 761 GG GG GG G GG G GG G + G GG Sbjct: 114 GGEAGGQAGGGGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGGSTSGSSSGGATSGGGG 173 Query: 760 XLGXEPPHXPRGGXEKGXXCG 698 G GG G G Sbjct: 174 VSGSSGTSIAGGGSSAGAGAG 194 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXGGX--GGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GG GG G G Sbjct: 136 GGGAAGGGGQEGGGQGGAQAGGSTSGSSSG 165 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXGGXGGGX--GGGXGGGXGGGXXPG 857 GGGG GG GG GG G GG G Sbjct: 141 GGGGQEGGGQGGAQAGGSTSGSSSGGATSG 170 >SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2202 Score = 31.9 bits (69), Expect = 0.77 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 G G GG GG GG GGG GG Sbjct: 303 GNAGGNGGNAGGNGGMTGGGAGG 325 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 31.9 bits (69), Expect = 0.77 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 10/39 (25%) Frame = +3 Query: 855 LPGXXPPPX----PPPXPP------PXPPPXPPXXPPPP 941 +P PPP PPP PP P PPP PP P P Sbjct: 284 VPPMTPPPAVVTAPPPAPPLPNFTSPSPPPPPPLPPAMP 322 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 6/40 (15%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPPPXPPPXPPPXPP------XXPPPP 941 S+ V PP PPP PPP PP PPPP Sbjct: 275 SMDSVNKAPVPPMTPPPAVVTAPPPAPPLPNFTSPSPPPP 314 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 6/29 (20%) Frame = +3 Query: 873 PPXPPPXPPPXP------PPXPPXXPPPP 941 PP PPP PP P PP PPPP Sbjct: 311 PPPPPPLPPAMPAMDDLLPPEVLSPPPPP 339 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPXPPXXPP 935 LS + P PPP PPP P PP PP Sbjct: 240 LSNIKP--PPPPVPPPTIPSVPPGSETYVPP 268 Score = 28.3 bits (60), Expect = 9.5 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 2/48 (4%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPP--XPXXPXTXXXPPP 936 P PP PP P P L P P PP P P PP Sbjct: 283 PVPPMTPPPAVVTAPPPAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPP 330 >SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) Length = 496 Score = 31.9 bits (69), Expect = 0.77 Identities = 21/66 (31%), Positives = 22/66 (33%), Gaps = 1/66 (1%) Frame = +3 Query: 747 SXPXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPP-PXPPPXPPPXPP 923 S P PP P R+ P LP PP P P P PP PP Sbjct: 295 SPPRYPPSPP-RYPPSLHRYPQSPLRYPPSPIRYPPLPSRYPPSPPRYPSSHPRYPPSPP 353 Query: 924 XXPPPP 941 PP P Sbjct: 354 RYPPSP 359 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPP 935 PP PP PP PP PP PP Sbjct: 289 PPRYPPSPPRY-PPSPPRYPP 308 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 31.9 bits (69), Expect = 0.77 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 1/49 (2%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXP-XXPXTXXXPPPH 939 P PP PP P P P P PP P P PPPH Sbjct: 379 PGFPPRGMPPKEDWGPGPRGMGPGMGPPRPMGPPGPHGPPFGPRGPPPH 427 Score = 29.1 bits (62), Expect = 5.5 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPP-PXPPPXP--PPXPPPXPPXXPPPP 941 PG PP P PP P PP P PP PP Sbjct: 401 PGMGPPRPMGPPGPHGPPFGPRGPPPHGGPP 431 >SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 795 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP P P P P PP PPPP Sbjct: 682 PLTPPPPLPTPIASSEPLPLPP--PPPP 707 >SB_48061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 307 Score = 31.5 bits (68), Expect = 1.0 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXP 920 P P PP PPP PPP P Sbjct: 214 PFPDQPPGPPPGPPPLP 230 Score = 28.7 bits (61), Expect = 7.2 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXP 908 P PP PPP PPP P Sbjct: 214 PFPDQPPGPPPGPPPLP 230 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXP 932 P P PP PPP PP P Sbjct: 214 PFPDQPPGPPPGPPPLP 230 >SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1172 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G G GG GGG GGG G Sbjct: 442 GSGSTGNGNAGNGGAGGGGAGGGSTGG 468 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRT 851 GGG G G G GG GGG G T Sbjct: 438 GGGTGSGSTGNGNAGNGGAGGGGAGGGST 466 Score = 29.5 bits (63), Expect = 4.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G G G GG GG GG G Sbjct: 447 GNGNAGNGGAGGGGAGGGSTGGASSSG 473 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = -2 Query: 937 GGGXXGGXGGGX-GGGXGGGXGGGXXPGRT 851 GG G GGG G G G GGG G T Sbjct: 417 GGSSAGASGGGHKGAGGGSAAGGGTGSGST 446 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXGGXGGGXGG--GXGGGXGGGXXPG 857 GGG G G G G G GGG GG G Sbjct: 438 GGGTGSGSTGNGNAGNGGAGGGGAGGGSTG 467 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = +3 Query: 873 PPXPPPXPPPXP-PPXPPXXPPPP 941 PP PP P P P PP P PP P Sbjct: 1362 PPTPPRPPTPRPRPPTPRPGPPTP 1385 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +3 Query: 846 SXVLPGXXPPPXPPP--XPPPXPPPXPPXXPPP 938 S LP PPP P P PPP P P P P Sbjct: 1571 STTLPITPPPPTPSPPQTPPPVNTPPRPETPEP 1603 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Frame = +3 Query: 870 PPPXPPPXP-PPXPPPXPPXXPPPP 941 P P PP P PP P P PP P P Sbjct: 1358 PRPRPPTPPRPPTPRPRPPTPRPGP 1382 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPPP 941 P PP P P PP PP PP Sbjct: 1575 PITPPPPTPSPPQTPPPVNTPP 1596 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXP-PPXPPPXPPPXPPXXPPP 938 P PP P PP P P PP P P P Sbjct: 1358 PRPRPPTPPRPPTPRPRPPTPRPGPPTP 1385 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 2/28 (7%) Frame = +3 Query: 858 PGXXPPPXPP-PXP-PPXPPPXPPXXPP 935 P PP PP P P PP P P PP P Sbjct: 1360 PRPPTPPRPPTPRPRPPTPRPGPPTPRP 1387 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 1/24 (4%) Frame = +3 Query: 873 PPXPPPXPPPXP-PPXPPXXPPPP 941 P P P PP P PP P PP P Sbjct: 1355 PSTPRPRPPTPPRPPTPRPRPPTP 1378 Score = 28.3 bits (60), Expect = 9.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP P P P P PP P Sbjct: 1575 PITPPPPTPSPPQTPPPVNTPPRP 1598 >SB_17372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGGG GG G G G GGG G Sbjct: 188 GGGGTTGGGGSGGEGTTGGGVSG 210 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GG G G G GGG Sbjct: 186 GGGG--GGTTGGGGSGGEGTTGGG 207 >SB_55443| Best HMM Match : Homeobox (HMM E-Value=2.3e-26) Length = 245 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PPP P PP P PP P P Sbjct: 186 PGTPPPPMYPAFPPIFPSSPPPEYPGLP 213 >SB_50215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 31.5 bits (68), Expect = 1.0 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 885 PPXPPPXPPPXPPXXPPP 938 PP P P PPP PP PPP Sbjct: 74 PPQPTP-PPPRPPTPPPP 90 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/19 (63%), Positives = 12/19 (63%), Gaps = 1/19 (5%) Frame = +3 Query: 861 GXXPP-PXPPPXPPPXPPP 914 G PP P PPP PP PPP Sbjct: 71 GSTPPQPTPPPPRPPTPPP 89 Score = 29.5 bits (63), Expect = 4.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 894 PPPXPPPXPPXXPPPP 941 P P PPP P PPPP Sbjct: 75 PQPTPPPPRPPTPPPP 90 Score = 29.1 bits (62), Expect = 5.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPP 923 PP P P PP P P PP Sbjct: 74 PPQPTPPPPRPPTPPPP 90 >SB_45593| Best HMM Match : ArfGap (HMM E-Value=3.3e-37) Length = 732 Score = 31.5 bits (68), Expect = 1.0 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPP 923 P + +PG PPP P P P PP P Sbjct: 165 PRTTSQSSIPGVAPPPSSQPAPAPAPPQPAP 195 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGG 869 G GG GGG GG G GGG Sbjct: 637 GFHGGIGGGGMGGGFSGQGGG 657 >SB_18074| Best HMM Match : Trypan_PARP (HMM E-Value=0.081) Length = 524 Score = 31.5 bits (68), Expect = 1.0 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P P P P P P P P P Sbjct: 266 PEQEPEPEPEPEPEPEPEPEPEPEPEP 292 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P P P P P P P P P Sbjct: 274 PEPEPEPEPEPEPEPEPEPEPVHVPEP 300 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 P P P P P P P P P P P Sbjct: 272 PEPEPEPEPEPEPEPEPEPEPEP 294 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P + ++ P P P P P P P P P P P Sbjct: 247 PRQPVAEPEPERQPEPEPEPEQEPEPEPEPEPEPEP 282 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXP 932 P P P P P P P P P P P Sbjct: 270 PEPEPEPEPEPEPEPEPEPEPEPEP 294 Score = 28.3 bits (60), Expect = 9.5 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P P P P P P P P Sbjct: 260 PEPEPEPEQEPEPEPEPEPEPEPEPEP 286 Score = 28.3 bits (60), Expect = 9.5 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P P P P P P P P Sbjct: 262 PEPEPEQEPEPEPEPEPEPEPEPEPEP 288 Score = 28.3 bits (60), Expect = 9.5 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P P P P P P P P Sbjct: 264 PEPEQEPEPEPEPEPEPEPEPEPEPEP 290 >SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 246 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRTXER 842 GGG G G G GG G G GGG G R Sbjct: 84 GGGGMAGEGMGRGGIAGEGMGGGGMAGEGMSR 115 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG G G G GG G G GGG G Sbjct: 44 GGGGMAGEGMGRGGMAGEGMGGGGMAG 70 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG G G G GG G G GGG G Sbjct: 64 GGGGMAGEGMGRGGMAGEGMGGGGMAG 90 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG G G G GG G G GGG G Sbjct: 144 GGGGMAGEGMGGGGMAGEGMGGGGIAG 170 >SB_14693| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PPP P PP P PP P P Sbjct: 186 PGTPPPPMYPAFPPIFPSSPPPEYPGLP 213 >SB_44353| Best HMM Match : GRP (HMM E-Value=4.9) Length = 361 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGG 881 GGGG GG G GGG GGG Sbjct: 153 GGGGRRGGGGCCGGGGGGGG 172 >SB_41312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 357 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGG 869 G G GGG GGG GG GGG Sbjct: 147 GSVRGRGGGRGGGGGGCGGGG 167 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXG 887 G GG GG GGG GGG G Sbjct: 151 GRGGGRGGGGGGCGGGGG 168 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXG 875 G GG GGG GGG GGG G Sbjct: 151 GRGGGRGGG-GGGCGGGGG 168 >SB_36310| Best HMM Match : DEAD (HMM E-Value=1.4) Length = 1042 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LP P PP P PPP P PP P Sbjct: 999 LPRHFPRAARPPDSPRDPPPITPPPPPVP 1027 >SB_32409| Best HMM Match : Oxidored_q2 (HMM E-Value=0.081) Length = 185 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG G GGG G GG Sbjct: 128 GGGGSDGGGGSDGGGGDGEDDDGG 151 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG G GG GGG G G Sbjct: 124 GGGDGGGGSDGGGGSDGGGGDGEDDDG 150 Score = 29.5 bits (63), Expect = 4.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG 875 GGG GG GG G GGG G Sbjct: 124 GGGDGGGGSDGGGGSDGGGGDG 145 Score = 28.7 bits (61), Expect = 7.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 GGG GG G GGG GGG Sbjct: 65 GGGDGDNDDGGDGEDDGGGDGGG 87 >SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) Length = 291 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GGGG G G G G GG GG G + G Sbjct: 240 GGGGGYSGGGSGTHSGQAGGGGGSYCGGSSCSAVTGG 276 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GG G GGGG A GGGG Sbjct: 221 GAVGGFGGGGGGSEDNGASGGGGG 244 Score = 29.5 bits (63), Expect = 4.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG 875 GGG G GG GG GGG G Sbjct: 230 GGGSEDNGASGGGGGYSGGGSG 251 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 GGG G G GG GG GGG Sbjct: 227 GGGGGGSEDNGASGGGGGYSGGG 249 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG GG G GG PG Sbjct: 195 GGSIEKGWVGGRAGGMNSGYNGGPAPG 221 >SB_19172| Best HMM Match : GRP (HMM E-Value=4.9) Length = 278 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGG 881 GGGG GG G GGG GGG Sbjct: 70 GGGGRRGGGGCCGGGGGGGG 89 >SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) Length = 800 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG G GG GGG GG PG Sbjct: 336 GGGDPGGGDPG-GGDPGGGDPGGGDPG 361 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G G GG GGG GG PG Sbjct: 325 GGDGDHGDGDHGGGDPGGGDPGGGDPG 351 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG G G GG GGG G Sbjct: 341 GGGDPGGGDPGGGDPGGGDPGGGDHGG 367 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG G G GG GGG G Sbjct: 346 GGGDPGGGDPGGGDPGGGDHGGGDHGG 372 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG G G GG GGG G Sbjct: 366 GGGDHGGGDHGDGDHGGGDHGGGDHGG 392 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG G GG GGG GG PG Sbjct: 331 GDGDHGGGDPG-GGDPGGGDPGGGDPG 356 >SB_3426| Best HMM Match : Homeobox (HMM E-Value=3.4e-22) Length = 245 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PPP P PP P PP P P Sbjct: 186 PGTPPPPMYPAFPPSFPFSPPPEYPGLP 213 >SB_2796| Best HMM Match : RR_TM4-6 (HMM E-Value=1.9) Length = 224 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGG 881 GGGG GG G GGG GGG Sbjct: 153 GGGGRRGGGGCCGGGGGGGG 172 >SB_58920| Best HMM Match : GRP (HMM E-Value=0.35) Length = 243 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GG G G GGG G Sbjct: 101 GGGGDDDGSNGGGGDDDGSNGGGGDDDG 128 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GG G G GGG G Sbjct: 111 GGGGDDDGSNGGGGDDDGSNGGGGDDDG 138 >SB_55248| Best HMM Match : Adeno_E1A (HMM E-Value=7.5) Length = 198 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPP 935 G P PP PPP P P PP PP Sbjct: 140 GDSPVSSPPRTPPPEPTP-PPTPPP 163 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXP 932 P PP PPP P P PP PP P Sbjct: 143 PVSSPPRTPPPEPTP-PPTPPPLRP 166 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPP 935 PP PP P P PPP PP P Sbjct: 147 PPRTPP-PEPTPPPTPPPLRP 166 >SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXPPPP 941 PPP P PPP PPPP Sbjct: 197 PPPSGAPPPPPIGAPPPPPP 216 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/20 (60%), Positives = 12/20 (60%), Gaps = 2/20 (10%) Frame = +3 Query: 870 PPPXPPPXPPP--XPPPXPP 923 PPP P PPP PPP PP Sbjct: 197 PPPSGAPPPPPIGAPPPPPP 216 Score = 28.3 bits (60), Expect = 9.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 P P P PPP P PPPP Sbjct: 192 PSWNRPPPSGAPPPPPIGAPPPP 214 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPP 911 P PPP P PPP PP Sbjct: 199 PSGAPPPPPIGAPPPPPP 216 >SB_2886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG 875 GGGG G G G GG GG G Sbjct: 20 GGGGLGGSGGSGGSGGSGGSSG 41 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GG G G GG G Sbjct: 20 GGGGLGGSGGSGGSGGSGGSSG 41 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -2 Query: 922 GGXGGGXGGGXGGGXGGGXXPGRTXER 842 GG G G GG GG G G G+T ++ Sbjct: 20 GGGGLGGSGGSGGSGGSGGSSGQTGDK 46 >SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 421 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = +3 Query: 837 RSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 R ++ +P P P PP P PP PPPP Sbjct: 183 RLVNTRMPDESPEPTRPPPPLDDLDDLPPPPPPPP 217 >SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) Length = 441 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PP PPP P P P P PP Sbjct: 172 PEILPPTAPPPQPAPAISPSAPAISPP 198 >SB_34751| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1143 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPPPXPP 899 +LS +P PPP PPP PP Sbjct: 674 TLSCPVPARPPPPIPPPHPP 693 Score = 29.5 bits (63), Expect = 4.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPP 923 P P PPP PPP PP Sbjct: 678 PVPARPPPPIPPPHPP 693 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GG G GGG GG GG GG Sbjct: 419 GGAFGGSSGGGFGGSSGGSFGG 440 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GG GG GG GG GG GG Sbjct: 423 GGSSGGGFGGSSGGSFGGSSGG 444 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG G GG GG GG GG Sbjct: 427 GGGFGGSSGGSFGGSSGGSFGG 448 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG GG GG GG GG GG G Sbjct: 419 GGAFGGSSGGGFGGSSGGSFGGSSGG 444 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG GG GG GG GG GG G Sbjct: 423 GGSSGGGFGGSSGGSFGGSSGGSFGG 448 >SB_23696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 559 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXG 887 GGGG GG G G GGG G Sbjct: 419 GGGGRGGGGGDGGGGGEG 436 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GGG GGG G G G Sbjct: 419 GGGGRGG-GGGDGGGGGEGVQG 439 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 922 GGXGGGXGGGXGGGXGGG 869 GG G G GGG GGG G G Sbjct: 419 GGGGRGGGGGDGGGGGEG 436 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPP 935 +PG PP P P PP P P PP Sbjct: 59 IPGNPPPNTPIPGDPPPNTPIPGDPPP 85 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPP 935 +PG PP P P PP P P PP Sbjct: 69 IPGDPPPNTPIPGDPPPNTPIPGNPPP 95 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPP 935 +PG PP P P PP P P PP Sbjct: 89 IPGNPPPNTPIPGDPPPNTPIPGDPPP 115 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPP 935 +PG PP P P PP P P PP Sbjct: 49 IPGDPPPNIPIPGNPPPNTPIPGDPPP 75 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPP 935 +PG PP P P PP P P PP Sbjct: 79 IPGDPPPNTPIPGNPPPNTPIPGDPPP 105 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPP 935 +PG PP P P PP P P PP Sbjct: 39 IPGDRPPNTPIPGDPPPNIPIPGNPPP 65 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 +P P PPP P P PP PPP Sbjct: 374 MPAMFNPHVPPPMIGPVTVPPPPLIPPP 401 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 6/30 (20%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPX------PPXXPPPP 941 PPP PP PPP PP PPPP Sbjct: 394 PPPLIPPPQASIPPPTMIQTLPPPSVPPPP 423 >SB_56224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 798 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GG G GGG G G Sbjct: 193 GGGGGVGTTGGSTGAAGGGGGGTSTSTG 220 >SB_52294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 394 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/28 (57%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -2 Query: 940 GGGGXXGGXGG-GXGGGXGGGXGGGXXP 860 GG G G GG G GGG GG GGG P Sbjct: 351 GGRGGRGASGGRGRGGGR-GGFGGGAGP 377 Score = 28.7 bits (61), Expect = 7.2 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 935 GGGXXXVXGXXGXGGXXGXGXGXXSRENXGEGXXXXXGGXGXGGEG 798 GGG G G GG G G G G GG G GEG Sbjct: 338 GGGRGGRGGRPGRGGRGGRGASGGRGRGGGRG--GFGGGAGPQGEG 381 >SB_35308| Best HMM Match : VWA (HMM E-Value=1.1e-20) Length = 381 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GG GG GG G G GG GGG Sbjct: 291 GGISASGGAGGSGGAGGVGGGGGG 314 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGG 881 GG G GG GG GGG G G Sbjct: 297 GGAGGSGGAGGVGGGGGGTG 316 Score = 28.3 bits (60), Expect = 9.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 G G GG G G GG GGG Sbjct: 288 GSAGGISASGGAGGSGGAGGVGGG 311 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G G GG GG GGG G Sbjct: 291 GGISASGGAGGSGGAGGVGGGGGGTG 316 >SB_34754| Best HMM Match : TSP_1 (HMM E-Value=7.4e-12) Length = 439 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 4/32 (12%) Frame = +3 Query: 858 PGXXPPPX----PPPXPPPXPPPXPPXXPPPP 941 P PPP P PPP P PP PPP Sbjct: 111 PTTVPPPVVTDAPTTVPPPVQPTEPPSTRPPP 142 >SB_25716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRTXE 845 GGG G G G G G G GGG G+ E Sbjct: 65 GGGKGEGEGKGEGKSEGKGEGGGKGDGKGEE 95 >SB_18621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GG G G GGG GGG GGG Sbjct: 47 GGVGDDDGGGGGCGGGDDDDDGGG 70 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P PP P PPPP Sbjct: 209 PPPMGGPPPMGGPPGGYPPPPPPP 232 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 4/30 (13%) Frame = +3 Query: 861 GXXPPPXPPPX--PPPXPPP--XPPXXPPP 938 G PP PP PPP PPP P PPP Sbjct: 213 GGPPPMGGPPGGYPPPPPPPGAGDPAYPPP 242 >SB_13751| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 853 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G G G G G G G GGG G Sbjct: 785 GDGDGDGDGDGDGDGAGAGDGGGDGDG 811 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G G G G G GGG G G G Sbjct: 789 GDGDGDGDGDGAGAGDGGGDGDGDGDG 815 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G G G GGG G G G G G Sbjct: 793 GDGDGDGAGAGDGGGDGDGDGDGDGDG 819 Score = 29.5 bits (63), Expect = 4.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 G G GG G G G G G G G G Sbjct: 801 GAGDGGGDGDGDGDGDGDGDGAG 823 >SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = -2 Query: 940 GGGGXXGGXGGGXGG-GXGGGXGGG 869 GG G GGG G G GGG GGG Sbjct: 67 GGAGGDDDDGGGISGCGDGGGGGGG 91 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/26 (61%), Positives = 16/26 (61%), Gaps = 3/26 (11%) Frame = -2 Query: 937 GGGXXG-GXGGGXGGGXGG--GXGGG 869 GGG G G GGG GGG GG GGG Sbjct: 76 GGGISGCGDGGGGGGGAGGDDDDGGG 101 Score = 29.1 bits (62), Expect = 5.5 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXGGX--GGGXGGGXGGGXGGGXXPG 857 GG GG G G GGG GGG GG G Sbjct: 70 GGDDDDGGGISGCGDGGGGGGGAGGDDDDG 99 >SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) Length = 782 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GG G GGG G G Sbjct: 239 GGGGGVGTTGGSTGAAGGGGGGTSTSTG 266 >SB_44477| Best HMM Match : IBR (HMM E-Value=0.00086) Length = 627 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPP 935 S++ P PP P P PPP PP PP Sbjct: 151 SITQPPPRHSPPQTPVPPPPPLPPFAQVSLPP 182 >SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1430 Score = 30.3 bits (65), Expect = 2.4 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 861 GXXPPPXPPPXPPP 902 G PPP PPP PPP Sbjct: 791 GITPPPPPPPPPPP 804 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXPPP 938 PPP PPP PPP P P Sbjct: 795 PPPPPPPPPPPEDLIIPLP 813 Score = 29.9 bits (64), Expect = 3.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP P P Sbjct: 794 PPPPPPPPPPPPEDLIIPLP 813 Score = 29.5 bits (63), Expect = 4.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXP 908 G PP PPP PPP P Sbjct: 790 GGITPPPPPPPPPPPP 805 Score = 24.6 bits (51), Expect(2) = 5.8 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXP 920 PPP PPP P P P Sbjct: 797 PPPPPPPPPEDLIIPLP 813 Score = 22.6 bits (46), Expect(2) = 5.8 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +3 Query: 852 VLPGXXPPPXPPP 890 + P PPP PPP Sbjct: 792 ITPPPPPPPPPPP 804 >SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) Length = 398 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G G G G G GG GGG G Sbjct: 371 GGEPGAFGSGSGFGGGGSSGGGGGGG 396 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG G G G GG GGG G Sbjct: 179 GGGDYSGGCGYGSSYGGGGDYGGGPGYG 206 Score = 29.5 bits (63), Expect = 4.1 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 2/28 (7%) Frame = -2 Query: 934 GGXXGGXGGGX--GGGXGGGXGGGXXPG 857 GG GG GG GGG GGG GG G Sbjct: 152 GGYRGGYRGGRDRGGGYGGGGEGGYGMG 179 Score = 29.5 bits (63), Expect = 4.1 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 3/27 (11%) Frame = -2 Query: 940 GGGGXXGGX---GGGXGGGXGGGXGGG 869 GGGG GG GGG G G G GGG Sbjct: 194 GGGGDYGGGPGYGGGQGYGSYSGGGGG 220 >SB_43367| Best HMM Match : SAM_1 (HMM E-Value=0.085) Length = 325 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 837 RSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 R L L P P P P P P P P PPP Sbjct: 109 RVLKSPLKDREPAPLPVPTMAPTPVPRPSDTNPPP 143 >SB_38159| Best HMM Match : Peptidase_M28 (HMM E-Value=4.7e-09) Length = 1049 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = -2 Query: 937 GGGXXGGXGGGXG-GGXGGGXGGG 869 G G G G G G GG GGG GGG Sbjct: 255 GDGDGDGDGDGDGDGGVGGGGGGG 278 >SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) Length = 184 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%) Frame = +3 Query: 870 PPPXPPPXPPPXPP---PXPPXXPPPP 941 PPP PP P P P PP PP P Sbjct: 138 PPPPTPPQSTPKPRRVLPTPPPKPPTP 164 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 6/30 (20%) Frame = +3 Query: 870 PPPXPPPXPP------PXPPPXPPXXPPPP 941 PPP PP P P PPP PP P PP Sbjct: 139 PPPTPPQSTPKPRRVLPTPPPKPP-TPRPP 167 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/39 (35%), Positives = 17/39 (43%), Gaps = 5/39 (12%) Frame = +3 Query: 837 RSLSXVLPGXXPPPXPPPXPP-----PXPPPXPPXXPPP 938 + + +LP PP P P P PPP PP PP Sbjct: 129 KRIRRLLPTPPPPTPPQSTPKPRRVLPTPPPKPPTPRPP 167 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 29.9 bits (64), Expect = 3.1 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 7/35 (20%) Frame = +3 Query: 858 PGXXPP---PXPPPXPPPX-PPPX---PPXXPPPP 941 PG PP P P PP PPP PP PPPP Sbjct: 297 PGYPPPQYMPHPRMRPPTRIPPPGMGPPPRIPPPP 331 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P PP P PPP P P P Sbjct: 755 PKVTPKPPAPPQFAPVPPPCAPIPPMP 781 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 S S V P P PP P PP P P PP Sbjct: 739 SPSEVTTKSPPAPPLPPKVTPKPPAPPQFAPVPP 772 Score = 28.3 bits (60), Expect = 9.5 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPPPXP-PPXPPPXPPPXPPXXPPPP 941 P P P PP PP P PP P PP Sbjct: 751 PPLPPKVTPKPPAPPQFAPVPPPCAPIPP 779 >SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) Length = 246 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 S S + P PP P PPP P PPP Sbjct: 153 SSSLLPPPSSSPPLSSPPPPPPSTPSSSLLPPP 185 >SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG P PPP PP PP PPP Sbjct: 276 PGFPPRWGPPPHMPPDYRGFPPPNFPPP 303 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 4/31 (12%) Frame = +3 Query: 858 PGXXPPPXPPP----XPPPXPPPXPPXXPPP 938 P PPP PP PPP PP PPP Sbjct: 280 PRWGPPPHMPPDYRGFPPPNFPPPDFSRPPP 310 >SB_35820| Best HMM Match : TRAP_240kDa (HMM E-Value=0.006) Length = 1382 Score = 29.5 bits (63), Expect = 4.1 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGG 884 GGGG G GG GGG GG Sbjct: 772 GGGGMGLGMGGSGGGGGGG 790 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGG 881 GGG G GG GGG GGG Sbjct: 772 GGGGMGLGMGGSGGGGGGG 790 Score = 28.3 bits (60), Expect = 9.5 Identities = 13/19 (68%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Frame = -2 Query: 922 GGXGGGXG-GGXGGGXGGG 869 GG G G G GG GGG GGG Sbjct: 772 GGGGMGLGMGGSGGGGGGG 790 >SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) Length = 547 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GG G GGGG A GGGG Sbjct: 351 GAVGGFGGGGGGSEDNGASGGGGG 374 Score = 29.5 bits (63), Expect = 4.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG 875 GGG G GG GG GGG G Sbjct: 360 GGGSEDNGASGGGGGYSGGGSG 381 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 GGG G G GG GG GGG Sbjct: 357 GGGGGGSEDNGASGGGGGYSGGG 379 Score = 28.3 bits (60), Expect = 9.5 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GGGG G G G GG GG G + + G Sbjct: 370 GGGGGYSGGGSGITWNQAGGGGGSYCAGSSCKGVTGG 406 >SB_22536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 593 Score = 29.5 bits (63), Expect = 4.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG 875 GGG G GG GG GGG G Sbjct: 279 GGGSEDNGASGGGGGYSGGGSG 300 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG GG G GG PG Sbjct: 244 GGSITEGWVGGKAGGMNSGYNGGPPPG 270 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 29.5 bits (63), Expect = 4.1 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 12/35 (34%) Frame = +3 Query: 870 PPPXPPPX------PPPXPP------PXPPXXPPP 938 PPP PPP PPP PP PP PPP Sbjct: 50 PPPPPPPRFYDNDIPPPPPPRRGFYDDYPPPPPPP 84 >SB_59680| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 412 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 3/26 (11%) Frame = +3 Query: 870 PPPXPPPXPPPXPPP---XPPXXPPP 938 PPP P PPP PPP P PP Sbjct: 179 PPPLNPYQPPPFPPPHLMYPQPTAPP 204 >SB_52712| Best HMM Match : Dynein_light (HMM E-Value=3) Length = 404 Score = 29.5 bits (63), Expect = 4.1 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 922 GGXGGGXGGGXGGG 881 GG GGG GGG GGG Sbjct: 62 GGGGGGCGGGRGGG 75 Score = 29.5 bits (63), Expect = 4.1 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 910 GGXGGGXGGGXGGG 869 GG GGG GGG GGG Sbjct: 62 GGGGGGCGGGRGGG 75 >SB_37928| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 339 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPPPXPPPXPPPXPP 923 S S LP PPP PP PP PP Sbjct: 78 SKSSTLPRRHTTKSPPPKPPRVIPPKPP 105 >SB_26965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 827 Score = 29.5 bits (63), Expect = 4.1 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = -2 Query: 922 GGXGGGXGGGXGGGXGGGXXPGRTXER 842 GG GGG GGG G G G E+ Sbjct: 62 GGCGGGGGGGGDAGCSGSDTDGEEAEK 88 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG G G G Sbjct: 60 GGGGCGGGGGGGGDAGCSGSDTDG 83 >SB_17676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1271 Score = 29.5 bits (63), Expect = 4.1 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPP 923 P P P PP PPP PP Sbjct: 163 PADPAPMQPPAPPPSPP 179 >SB_8478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1033 Score = 29.5 bits (63), Expect = 4.1 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 922 GGXGGGXGGGXGGG 881 GG GGG GGG GGG Sbjct: 806 GGGGGGCGGGRGGG 819 Score = 29.5 bits (63), Expect = 4.1 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 910 GGXGGGXGGGXGGG 869 GG GGG GGG GGG Sbjct: 806 GGGGGGCGGGRGGG 819 >SB_7859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG G G GG GGG GG G Sbjct: 168 GGGDDDDGGDGDGGGDDGGGADGGGADG 195 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG GG G G G GG GGG G Sbjct: 169 GGDDDDGGDGDGGGDDGGGADGGGADGG 196 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G G GGG G G GGG G Sbjct: 159 GGDGGDDGDGGGDDDDGGDGDGGGDDGG 186 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG GG G GGG GG G Sbjct: 175 GGDGDGGGDDGG--GADGGGADGGDDDG 200 >SB_128| Best HMM Match : SH3BP5 (HMM E-Value=3.3) Length = 410 Score = 29.5 bits (63), Expect = 4.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 PPP P P PPP P PP Sbjct: 299 PPPAPVDEQQPGPPPAPSLLVPP 321 >SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 650 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPP 935 PPP P P P PP P PP Sbjct: 531 PPPQPYPPTQPSYPPTPSSYPP 552 Score = 28.7 bits (61), Expect = 7.2 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 1/23 (4%) Frame = +3 Query: 876 PXPPPXPPPXP-PPXPPXXPPPP 941 P P PPP P PP P PP P Sbjct: 525 PTQPYYPPPQPYPPTQPSYPPTP 547 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/25 (48%), Positives = 12/25 (48%), Gaps = 2/25 (8%) Frame = +3 Query: 873 PPXPPPXPPPXP--PPXPPXXPPPP 941 PP P PP P PP P PP P Sbjct: 187 PPTPSSYPPTQPSYPPTAPSYPPTP 211 >SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) Length = 386 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Frame = -2 Query: 934 GGXXGGXGGGXGGGX--GGGXGG 872 GG GG GGG GG GGG GG Sbjct: 90 GGGSGGFGGGLFGGMPFGGGMGG 112 >SB_30560| Best HMM Match : Herpes_UL73 (HMM E-Value=4.5) Length = 87 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXP 920 LP PP P P P P PP P Sbjct: 37 LPSTSLPPSPSPSPSPPSPPTP 58 >SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 386 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPP 938 P PP P PPP PP PP Sbjct: 125 PRAPPGGPGAPPPPPPPAVVPP 146 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPPP 941 P PP P PPP PP PP Sbjct: 125 PRAPPGGPGAPPPPPPPAVVPP 146 Score = 28.7 bits (61), Expect = 7.2 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 1/24 (4%) Frame = +3 Query: 873 PPXPPPXPP-PXPPPXPPXXPPPP 941 PP P P P PP P PPPP Sbjct: 115 PPAPTSVPSGPRAPPGGPGAPPPP 138 >SB_51163| Best HMM Match : Adeno_PIX (HMM E-Value=0.96) Length = 772 Score = 28.7 bits (61), Expect = 7.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXG 875 GGG G GG GGG GG G Sbjct: 519 GGGMEEGAGGMGGGGGAGGGG 539 Score = 28.7 bits (61), Expect = 7.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGG 881 GGG G G G GGG GGG Sbjct: 519 GGGMEEGAGGMGGGGGAGGG 538 >SB_39126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.7 bits (61), Expect = 7.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP P PPP P PP P P Sbjct: 2 PPATDPIPPPKLEPIPPEIDPIP 24 >SB_38223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 28.7 bits (61), Expect = 7.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPP 923 PPP PP PPP PP Sbjct: 92 PPPPPPQLENDFPPPPPP 109 >SB_33219| Best HMM Match : RhoGAP (HMM E-Value=0.0014) Length = 399 Score = 28.7 bits (61), Expect = 7.2 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP P P P PS SL P P PP P PPP Sbjct: 221 PPPRPCPAPRVRKTIPSSTDSL-----PRPGRPPSPSTRGMKPLPPP 262 >SB_30230| Best HMM Match : CH (HMM E-Value=0.0035) Length = 2440 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = +3 Query: 165 KRDAPKEDNSINTLAESAKKTIEELREKVESALAPETVKK 284 KRDAP DN S KK L +E+ +P + K Sbjct: 780 KRDAPLRDNDEQFRTYSRKKQHASLESSIEAPCSPRSASK 819 >SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) Length = 1439 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 2/29 (6%) Frame = +3 Query: 858 PGXXPPPXPPPX--PPPXPPPXPPXXPPP 938 P PPP PPP P P P PPP Sbjct: 555 PVTAPPPAPPPSVFAPSSAVPTPATAPPP 583 Score = 28.3 bits (60), Expect = 9.5 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 6/33 (18%) Frame = +3 Query: 858 PGXXPPPXPPPX---PP---PXPPPXPPXXPPP 938 P PPP PPP P P P PP PPP Sbjct: 533 PVTEPPPAPPPSVFAPSSGVPTPVTAPPPAPPP 565 >SB_28577| Best HMM Match : Chitin_bind_3 (HMM E-Value=0.00012) Length = 281 Score = 28.7 bits (61), Expect = 7.2 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXP 932 VLP P PPP PPP P P Sbjct: 210 VLPTLPPTKAPPPRSTRRPPPDTPAPP 236 >SB_7383| Best HMM Match : SapA (HMM E-Value=1.2e-13) Length = 492 Score = 28.7 bits (61), Expect = 7.2 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXG--GGXGGGXXPG 857 GGG G GG GGG G GG G G PG Sbjct: 132 GGGP--GYGGDYGGGLGHCGGPGHGHGPG 158 >SB_53084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 936 Score = 28.7 bits (61), Expect = 7.2 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 4/31 (12%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGG----GXGGGXXPG 857 GGG G GGG G GG G GGG G Sbjct: 492 GGGDDDGDGGGDDDGDGGVDDDGDGGGDDDG 522 >SB_49222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 28.7 bits (61), Expect = 7.2 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG G G G GG GGG G Sbjct: 58 GGGGQGGGQGVG-GQEVGGQGGGGQGVG 84 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 919 GXGGGXGGGXGGGXGGGXXPG 857 G G G GG GGG GGG G Sbjct: 49 GVGQGVGGQGGGGQGGGQGVG 69 >SB_36777| Best HMM Match : VWA (HMM E-Value=0) Length = 1303 Score = 28.7 bits (61), Expect = 7.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 P P P P P P P P PPP Sbjct: 1257 PSPSLVPNPVPQPAPAPAPAPPP 1279 >SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) Length = 1197 Score = 28.7 bits (61), Expect = 7.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPPP 941 P PP PP P PP PP P Sbjct: 853 PSAPPPLPPRPVGAPPSLPPRP 874 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 2/26 (7%) Frame = +3 Query: 870 PPPXPPPX--PPPXPPPXPPXXPPPP 941 PPP PP PP PP P P PP Sbjct: 856 PPPLPPRPVGAPPSLPPRPRTRPLPP 881 Score = 28.3 bits (60), Expect = 9.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP PP P P P PPPP Sbjct: 867 PPSLPPRPRTRPLPPKSDTPPPP 889 >SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 28.7 bits (61), Expect = 7.2 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 6/38 (15%) Frame = -2 Query: 940 GGGGXX------GGXGGGXGGGXGGGXGGGXXPGRTXE 845 GGGG G GGG GG GG GG G T + Sbjct: 291 GGGGDSTTDSDDGAGGGGGGGHFSGGAGGAAATGCTNQ 328 >SB_19709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 613 Score = 28.7 bits (61), Expect = 7.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 PPP PPP P P PPP Sbjct: 583 PPPHPPPPAHHVNKPGVPPPPPP 605 >SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) Length = 293 Score = 28.7 bits (61), Expect = 7.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PP PP P P P PP P Sbjct: 150 PGGYPPTSYPPQPYPAQPYPQQGYPPQP 177 >SB_1052| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1092 Score = 25.8 bits (54), Expect(2) = 7.6 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 885 PPXPPPXPPP 914 PP PPP PPP Sbjct: 781 PPIPPPTPPP 790 Score = 21.0 bits (42), Expect(2) = 7.6 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXP 908 +PG P PP PP P Sbjct: 732 VPGTCPTFPPPAECPPEP 749 >SB_21275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 327 Score = 24.6 bits (51), Expect(2) = 8.5 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +3 Query: 885 PPXPPPXPPPXPPXXPPP 938 PP PPP PP P P Sbjct: 187 PPPPPPPPPRFVPFTTGP 204 Score = 22.2 bits (45), Expect(2) = 8.5 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +3 Query: 837 RSLSXVLPGXXPPPXPPP 890 R ++ V PPP PPP Sbjct: 178 REIAVVASMPPPPPPPPP 195 >SB_58047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXP 912 PP PP P P S ++ P P P PP P P Sbjct: 187 PPGPPGPPGPGLVGSGSGAGAVIAGP-PGPPGPPGPPGP 224 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,852,681 Number of Sequences: 59808 Number of extensions: 489968 Number of successful extensions: 14026 Number of sequences better than 10.0: 269 Number of HSP's better than 10.0 without gapping: 1727 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7353 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2752873431 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -