BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_J23 (941 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY260762-1|AAP20225.1| 3567|Homo sapiens zinc finger homeodomain... 53 2e-06 AL096764-2|CAM28218.1| 1137|Homo sapiens chromosome X open readi... 52 2e-06 AL049563-1|CAM28289.1| 1137|Homo sapiens chromosome X open readi... 52 2e-06 AL834396-1|CAD39058.1| 1009|Homo sapiens hypothetical protein pr... 51 7e-06 AB067489-1|BAB67795.1| 1112|Homo sapiens KIAA1902 protein protein. 51 7e-06 BC146811-1|AAI46812.1| 854|Homo sapiens ZNF341 protein protein. 50 2e-05 BC146776-1|AAI46777.1| 1542|Homo sapiens SET binding protein 1 p... 50 2e-05 BC132873-1|AAI32874.1| 854|Homo sapiens ZNF341 protein protein. 50 2e-05 BC094738-1|AAH94738.1| 795|Homo sapiens ZNF341 protein protein. 50 2e-05 AY494951-1|AAS82582.1| 1250|Homo sapiens lamellipodin protein. 50 2e-05 AL050349-3|CAI21796.2| 847|Homo sapiens zinc finger protein 341... 50 2e-05 AJ584699-1|CAE48361.1| 1250|Homo sapiens RAPH1 protein protein. 50 2e-05 AB051468-1|BAB21772.1| 1236|Homo sapiens KIAA1681 protein protein. 50 2e-05 AB022660-1|BAA82444.1| 1542|Homo sapiens SET-binding protein (SE... 50 2e-05 AB007897-1|BAA24826.2| 1605|Homo sapiens KIAA0437 protein. 50 2e-05 AL078621-10|CAB81647.1| 232|Homo sapiens protein ( G islands. ... 49 2e-05 BC073988-1|AAH73988.1| 682|Homo sapiens FMNL1 protein protein. 49 3e-05 AY278319-1|AAP32476.1| 1100|Homo sapiens leukocyte formin protein. 49 3e-05 AF432213-1|AAL99920.1| 991|Homo sapiens CLL-associated antigen ... 49 3e-05 X66188-1|CAA46956.1| 421|Homo sapiens proacrosin protein. 48 4e-05 X54017-1|CAA37964.1| 421|Homo sapiens preproacrosin protein. 48 4e-05 M77381-1|AAA51575.1| 184|Homo sapiens acrosin protein. 48 4e-05 DQ854815-1|ABI75145.1| 112|Homo sapiens hyperpolarization-activ... 47 9e-05 AJ133727-1|CAB42630.1| 889|Homo sapiens hyperpolarization-activ... 47 9e-05 AJ012582-1|CAB42602.1| 889|Homo sapiens hyperpolarization-activ... 47 9e-05 AC005559-2|AAC33280.2| 528|Homo sapiens hyperpolarization activ... 47 9e-05 U16371-1|AAB60346.1| 31|Homo sapiens androgen receptor protein. 46 2e-04 Y00970-1|CAA68784.1| 421|Homo sapiens protein ( Human mRNA for ... 46 2e-04 D88460-1|BAA20128.1| 505|Homo sapiens N-WASP protein. 46 2e-04 CR456366-1|CAG30252.1| 421|Homo sapiens ACR protein. 46 2e-04 BC064999-1|AAH64999.1| 1068|Homo sapiens DAAM1 protein protein. 46 2e-04 BC052955-1|AAH52955.1| 505|Homo sapiens Wiskott-Aldrich syndrom... 46 2e-04 BC038428-1|AAH38428.1| 1068|Homo sapiens DAAM1 protein protein. 46 2e-04 BC024781-1|AAH24781.1| 662|Homo sapiens Similar to dishevelled ... 46 2e-04 AC006333-1|AAQ96857.1| 505|Homo sapiens unknown protein. 46 2e-04 AB014566-1|BAA31641.1| 1085|Homo sapiens KIAA0666 protein protein. 46 2e-04 BC008829-1|AAH08829.1| 355|Homo sapiens SHOX2 protein protein. 46 3e-04 AM295156-1|CAL26602.1| 505|Homo sapiens WASL protein protein. 46 3e-04 AB058759-1|BAB47485.1| 1134|Homo sapiens KIAA1856 protein protein. 46 3e-04 Z96050-3|CAB09424.1| 281|Homo sapiens Fas ligand (TNF superfami... 45 3e-04 X89102-1|CAA61474.1| 281|Homo sapiens Fasligand protein. 45 3e-04 U11821-1|AAC50124.1| 281|Homo sapiens Fas ligand protein. 45 3e-04 U08137-1|AAC50071.1| 281|Homo sapiens Fas ligand protein. 45 3e-04 M27430-1|AAA51886.1| 919|Homo sapiens AR protein. 45 3e-04 M23263-1|AAA51775.1| 918|Homo sapiens androgen receptor protein. 45 3e-04 M20132-1|AAA51729.1| 919|Homo sapiens AR protein. 45 3e-04 L29496-1|AAA51770.1| 734|Homo sapiens AR protein. 45 3e-04 EF064739-1|ABK41922.1| 281|Homo sapiens Fas ligand (TNF superfa... 45 3e-04 D38122-1|BAA07320.1| 281|Homo sapiens Fas ligand protein. 45 3e-04 BC035907-1|AAH35907.1| 308|Homo sapiens USP51 protein protein. 45 3e-04 BC017502-1|AAH17502.1| 281|Homo sapiens Fas ligand (TNF superfa... 45 3e-04 AY858799-1|AAX49569.1| 281|Homo sapiens CD95 ligand protein. 45 3e-04 AY225406-1|AAO43991.1| 281|Homo sapiens FAS ligand protein. 45 3e-04 AJ583823-1|CAE47750.2| 711|Homo sapiens ubiquitin specific prot... 45 3e-04 AF321914-1|AAK09423.1| 544|Homo sapiens androgen receptor protein. 45 3e-04 AF288573-1|AAG60017.1| 127|Homo sapiens FasL isoform protein. 45 3e-04 AL355338-1|CAH70366.2| 663|Homo sapiens Zic family member 5 (od... 45 5e-04 AF378304-1|AAK55418.1| 639|Homo sapiens zinc family member 5 pr... 45 5e-04 BC038446-1|AAH38446.1| 673|Homo sapiens SF1 protein protein. 44 6e-04 BC020238-1|AAH20238.1| 596|Homo sapiens SRP68 protein protein. 44 6e-04 AK097947-1|BAC05201.1| 209|Homo sapiens protein ( Homo sapiens ... 44 6e-04 AK074698-1|BAC11145.1| 627|Homo sapiens protein ( Homo sapiens ... 44 6e-04 AF065164-1|AAC28444.2| 889|Homo sapiens hyperpolarization-activ... 44 6e-04 AB075851-1|BAB85557.1| 830|Homo sapiens KIAA1971 protein protein. 44 6e-04 BC064998-1|AAH64998.1| 268|Homo sapiens CAPNS1 protein protein. 44 8e-04 BC023532-1|AAH23532.1| 641|Homo sapiens WW domain binding prote... 44 8e-04 BC016441-1|AAH16441.2| 400|Homo sapiens WBP11 protein protein. 44 8e-04 BC006419-1|AAH06419.1| 39|Homo sapiens Unknown (protein for IM... 44 8e-04 BC001621-1|AAH01621.1| 641|Homo sapiens WW domain binding prote... 44 8e-04 AF118023-1|AAD30425.1| 641|Homo sapiens SH3 domain-binding prot... 44 8e-04 AB029309-1|BAA88410.1| 641|Homo sapiens Npw38-binding protein N... 44 8e-04 AB005297-1|BAA23647.1| 1584|Homo sapiens BAI 1 protein. 44 8e-04 X86019-1|CAA60014.1| 494|Homo sapiens SH3-domain interacting pr... 44 0.001 X52426-1|CAA36673.1| 420|Homo sapiens cytokeratin 13 protein. 44 0.001 X14640-1|CAA32786.1| 458|Homo sapiens keratin 13 protein. 44 0.001 BX640870-1|CAE45928.1| 510|Homo sapiens hypothetical protein pr... 44 0.001 BC126184-1|AAI26185.1| 458|Homo sapiens keratin 13 protein. 44 0.001 BC110288-1|AAI10289.1| 403|Homo sapiens WIPF1 protein protein. 44 0.001 BC087835-1|AAH87835.1| 338|Homo sapiens FAM44A protein protein. 44 0.001 BC077718-1|AAH77718.2| 458|Homo sapiens keratin 13 protein. 44 0.001 BC065546-1|AAH65546.1| 338|Homo sapiens FAM44A protein protein. 44 0.001 BC002914-1|AAH02914.1| 358|Homo sapiens WIPF1 protein protein. 44 0.001 BC002661-1|AAH02661.3| 458|Homo sapiens keratin 13 protein. 44 0.001 AK223077-1|BAD96797.1| 458|Homo sapiens keratin 13 isoform a va... 44 0.001 AK223051-1|BAD96771.1| 458|Homo sapiens keratin 13 isoform a va... 44 0.001 AK128867-1|BAC87651.1| 121|Homo sapiens protein ( Homo sapiens ... 44 0.001 AK091683-1|BAC03720.1| 749|Homo sapiens protein ( Homo sapiens ... 44 0.001 AK056450-1|BAB71186.1| 568|Homo sapiens protein ( Homo sapiens ... 44 0.001 AF528529-1|AAM94279.1| 502|Homo sapiens hypothetical protein pr... 44 0.001 AF049259-1|AAC35754.1| 420|Homo sapiens keratin 13 protein. 44 0.001 AF031588-1|AAC03767.1| 503|Homo sapiens WASP interacting protei... 44 0.001 AC010894-2|AAY14708.1| 503|Homo sapiens unknown protein. 44 0.001 AB051500-1|BAB21804.2| 1652|Homo sapiens KIAA1713 protein protein. 44 0.001 U19927-1|AAC50140.1| 502|Homo sapiens WAS protein. 43 0.001 U12707-1|AAA62663.1| 502|Homo sapiens Wiskott-Aldrich syndrome ... 43 0.001 BC095481-1|AAH95481.1| 591|Homo sapiens enabled homolog (Drosop... 43 0.001 BC065238-1|AAH65238.1| 527|Homo sapiens ENAH protein protein. 43 0.001 BC012738-1|AAH12738.1| 502|Homo sapiens Wiskott-Aldrich syndrom... 43 0.001 BC002961-1|AAH02961.1| 514|Homo sapiens WAS protein protein. 43 0.001 AY345143-1|AAR04685.1| 570|Homo sapiens MENA protein. 43 0.001 AL591380-2|CAH71476.1| 570|Homo sapiens enabled homolog (Drosop... 43 0.001 AL591380-1|CAH71475.1| 817|Homo sapiens enabled homolog (Drosop... 43 0.001 AL356216-3|CAI22019.1| 570|Homo sapiens enabled homolog (Drosop... 43 0.001 AL356216-2|CAI22020.1| 817|Homo sapiens enabled homolog (Drosop... 43 0.001 AK127078-1|BAC86815.1| 844|Homo sapiens protein ( Homo sapiens ... 43 0.001 AK096246-1|BAC04736.1| 467|Homo sapiens protein ( Homo sapiens ... 43 0.001 AF519769-1|AAQ08487.1| 591|Homo sapiens mena protein protein. 43 0.001 AF115549-1|AAD26691.1| 502|Homo sapiens Wiskott-Aldrich Syndrom... 43 0.001 AF110377-1|AAD04629.1| 3859|Homo sapiens PCAF-associated factor ... 43 0.001 AF076974-1|AAD09420.1| 3830|Homo sapiens TRRAP protein protein. 43 0.001 AC018730-1|AAX88973.1| 500|Homo sapiens unknown protein. 43 0.001 AC004991-1|AAC27675.2| 2089|Homo sapiens unknown protein. 43 0.001 AB209489-1|BAD92726.1| 3587|Homo sapiens Transformation/transcri... 43 0.001 AB001835-1|BAA19459.1| 500|Homo sapiens Brain-1 protein. 43 0.001 U10063-1|AAA57161.1| 423|Homo sapiens POU domain factor protein. 43 0.002 M35851-1|AAA51772.1| 917|Homo sapiens androgen receptor protein. 43 0.002 M21748-1|AAA51771.1| 917|Homo sapiens androgen receptor protein. 43 0.002 L20433-1|AAA65605.1| 420|Homo sapiens octamer binding transcrip... 43 0.002 D21852-1|BAA04878.2| 974|Homo sapiens KIAA0029 protein. 43 0.002 BC049204-1|AAH49204.1| 251|Homo sapiens homeobox B4 protein. 43 0.002 BC041093-1|AAH41093.1| 1099|Homo sapiens R3H domain containing 1... 43 0.002 BC034003-1|AAH34003.1| 600|Homo sapiens PRR12 protein protein. 43 0.002 AL445209-3|CAI15184.1| 419|Homo sapiens POU domain, class 4, tr... 43 0.002 AL356358-1|CAI40496.1| 920|Homo sapiens androgen receptor (dihy... 43 0.002 AL158217-11|CAI22163.1| 854|Homo sapiens espin protein. 43 0.002 AL158016-1|CAI40853.1| 920|Homo sapiens androgen receptor (dihy... 43 0.002 AL137449-1|CAB70742.1| 246|Homo sapiens hypothetical protein pr... 43 0.002 AL049564-2|CAI43080.1| 920|Homo sapiens androgen receptor (dihy... 43 0.002 AL035288-1|CAA22892.1| 671|Homo sapiens hypothetical protein pr... 43 0.002 AL031848-3|CAI19773.1| 854|Homo sapiens espin protein. 43 0.002 AL021920-3|CAI19632.1| 671|Homo sapiens espin pseudogene protein. 43 0.002 AF321917-1|AAK09426.1| 531|Homo sapiens androgen receptor protein. 43 0.002 AF321916-1|AAK09425.1| 542|Homo sapiens androgen receptor protein. 43 0.002 AF321915-1|AAK09424.1| 539|Homo sapiens androgen receptor protein. 43 0.002 AF307160-1|AAG45052.1| 251|Homo sapiens HOXB4 protein. 43 0.002 AF287967-4|AAG31554.1| 251|Homo sapiens homeobox B4 protein. 43 0.002 AC016742-1|AAY14728.1| 784|Homo sapiens unknown protein. 43 0.002 AB033031-1|BAA86519.1| 1217|Homo sapiens KIAA1205 protein protein. 43 0.002 M96684-1|AAA60229.1| 322|Homo sapiens Pur protein. 42 0.002 BT019388-1|AAV38195.1| 322|Homo sapiens purine-rich element bin... 42 0.002 BC040943-1|AAH40943.1| 498|Homo sapiens WAS protein family, mem... 42 0.002 BC036087-1|AAH36087.1| 322|Homo sapiens purine-rich element bin... 42 0.002 AL121749-3|CAC10185.1| 694|Homo sapiens frizzled homolog 8 (Dro... 42 0.002 AL096774-6|CAC18518.1| 498|Homo sapiens WAS protein family, mem... 42 0.002 AK095189-1|BAC04495.1| 634|Homo sapiens protein ( Homo sapiens ... 42 0.002 AJ509090-1|CAD48858.1| 625|Homo sapiens Wiskott-Aldrich syndrom... 42 0.002 AF134304-1|AAD33053.2| 496|Homo sapiens Scar2 protein. 42 0.002 AB043703-1|BAB41064.1| 694|Homo sapiens seven-transmembrane rec... 42 0.002 AB026542-1|BAA81795.1| 498|Homo sapiens WASP-family protein pro... 42 0.002 X16667-1|CAA34657.1| 431|Homo sapiens protein ( Human HOX2G mRN... 42 0.003 U59298-1|AAD10852.1| 431|Homo sapiens hox homeobox transcriptio... 42 0.003 BC044311-1|AAH44311.2| 399|Homo sapiens hypothetical protein LO... 42 0.003 AF287967-5|AAG31555.1| 431|Homo sapiens homeobox B3 protein. 42 0.003 AB183864-1|BAD86792.1| 1271|Homo sapiens diacylglycerol kinase k... 42 0.003 Z29074-1|CAA82315.1| 623|Homo sapiens cytokeratin 9 protein. 42 0.004 X75015-1|CAA52924.1| 622|Homo sapiens keratin 9 protein. 42 0.004 X04106-1|CAA27726.1| 268|Homo sapiens protein ( Human mRNA for ... 42 0.004 S69510-1|AAC60619.1| 622|Homo sapiens cytokeratin 9 protein. 42 0.004 M31511-1|AAA35646.1| 268|Homo sapiens protein ( Human calcium-a... 42 0.004 M19156-1|AAA59468.1| 433|Homo sapiens KRT10 protein. 42 0.004 BT009775-1|AAP88777.1| 268|Homo sapiens calpain, small subunit ... 42 0.004 BC121170-1|AAI21171.1| 467|Homo sapiens KRT9 protein protein. 42 0.004 BC023643-1|AAH23643.1| 268|Homo sapiens calpain, small subunit ... 42 0.004 BC021933-1|AAH21933.1| 268|Homo sapiens calpain, small subunit ... 42 0.004 BC018931-1|AAH18931.1| 268|Homo sapiens calpain, small subunit ... 42 0.004 BC017308-1|AAH17308.1| 268|Homo sapiens calpain, small subunit ... 42 0.004 BC011903-1|AAH11903.1| 322|Homo sapiens CAPNS1 protein protein. 42 0.004 BC007779-1|AAH07779.1| 268|Homo sapiens calpain, small subunit ... 42 0.004 BC000592-1|AAH00592.1| 268|Homo sapiens calpain, small subunit ... 42 0.004 AY789642-1|AAV40829.1| 268|Homo sapiens calpain, small subunit ... 42 0.004 AF521671-1|AAN03447.1| 2165|Homo sapiens SWI/SNF chromatin remod... 42 0.004 AF253515-1|AAN70985.1| 1957|Homo sapiens BAF250b subunit protein. 42 0.004 AD001527-4|AAB51183.1| 268|Homo sapiens calcium-dependent prote... 42 0.004 AC002984-1|AAB81546.1| 268|Homo sapiens CANS_Human protein. 42 0.004 AB002337-1|BAA20797.2| 1709|Homo sapiens KIAA0339 protein protein. 42 0.004 Z46389-1|CAA86523.1| 380|Homo sapiens vasodilator-stimulated ph... 41 0.006 X98534-1|CAA67147.2| 378|Homo sapiens vasodilator-stimulated ph... 41 0.006 X67337-1|CAA47752.1| 551|Homo sapiens Human pre-mRNA cleavage f... 41 0.006 X67336-1|CAA47751.1| 551|Homo sapiens HPBRII-7 protein. 41 0.006 X14487-1|CAA32649.1| 593|Homo sapiens protein ( Human gene for ... 41 0.006 BC109221-1|AAI09222.1| 1019|Homo sapiens SLC4A5 protein protein. 41 0.006 BC038224-1|AAH38224.1| 380|Homo sapiens vasodilator-stimulated ... 41 0.006 BC034697-1|AAH34697.1| 584|Homo sapiens keratin 10 (epidermolyt... 41 0.006 BC026019-1|AAH26019.1| 380|Homo sapiens vasodilator-stimulated ... 41 0.006 BC005000-1|AAH05000.1| 478|Homo sapiens CPSF6 protein protein. 41 0.006 BC000714-1|AAH00714.1| 588|Homo sapiens CPSF6 protein protein. 41 0.006 AY388963-1|AAR26468.1| 837|Homo sapiens protocadherin 15 isofor... 41 0.006 AY029237-1|AAK31804.1| 1955|Homo sapiens protocadherin 15 protein. 41 0.006 AY029205-1|AAK31581.1| 1955|Homo sapiens protocadherin 15 protein. 41 0.006 AL365496-11|CAH73917.1| 837|Homo sapiens protocadherin 15 protein. 41 0.006 AL365496-10|CAM19874.1| 1957|Homo sapiens protocadherin 15 protein. 41 0.006 AL365496-9|CAM19873.1| 1952|Homo sapiens protocadherin 15 protein. 41 0.006 AL365496-8|CAM19872.1| 1932|Homo sapiens protocadherin 15 protein. 41 0.006 AL365496-7|CAH73916.1| 1955|Homo sapiens protocadherin 15 protein. 41 0.006 AL360214-13|CAM21542.1| 1957|Homo sapiens protocadherin 15 protein. 41 0.006 AL360214-12|CAM21543.1| 1952|Homo sapiens protocadherin 15 protein. 41 0.006 AL360214-11|CAM21544.1| 1932|Homo sapiens protocadherin 15 protein. 41 0.006 AL360214-10|CAI15201.1| 1955|Homo sapiens protocadherin 15 protein. 41 0.006 AL356114-13|CAM15124.1| 1957|Homo sapiens protocadherin 15 protein. 41 0.006 AL356114-12|CAM15123.1| 1952|Homo sapiens protocadherin 15 protein. 41 0.006 AL356114-11|CAM15125.1| 1932|Homo sapiens protocadherin 15 protein. 41 0.006 AL356114-10|CAH71769.1| 1955|Homo sapiens protocadherin 15 protein. 41 0.006 AL355338-2|CAH70367.1| 532|Homo sapiens Zic family member 2 (od... 41 0.006 AL353784-11|CAM16792.1| 1957|Homo sapiens protocadherin 15 protein. 41 0.006 AL353784-10|CAM16791.1| 1952|Homo sapiens protocadherin 15 protein. 41 0.006 AL353784-9|CAH72390.1| 1955|Homo sapiens protocadherin 15 protein. 41 0.006 AK223568-1|BAD97288.1| 551|Homo sapiens cleavage and polyadenyl... 41 0.006 AJ007041-1|CAB45385.1| 2715|Homo sapiens trithorax homologue 2 p... 41 0.006 AF453528-1|AAL50802.1| 760|Homo sapiens sodium bicarbonate cotr... 41 0.006 AF452248-1|AAL48291.1| 1051|Homo sapiens sodium bicarbonate cotr... 41 0.006 AF293338-1|AAK97073.1| 1040|Homo sapiens sodium bicarbonate cotr... 41 0.006 AF293337-1|AAK97072.1| 1121|Homo sapiens sodium bicarbonate cotr... 41 0.006 AF243499-1|AAK26741.1| 1137|Homo sapiens sodium bicarbonate cotr... 41 0.006 AF207661-1|AAG18492.1| 1074|Homo sapiens sodium bicarbonate cotr... 41 0.006 AF193855-1|AAG28409.1| 532|Homo sapiens zinc finger protein of ... 41 0.006 AF186605-1|AAD56420.1| 2605|Homo sapiens MLL2 protein protein. 41 0.006 AF104902-1|AAC96325.1| 533|Homo sapiens ZIC2 protein protein. 41 0.006 AF051782-1|AAC05373.1| 1248|Homo sapiens diaphanous 1 protein. 41 0.006 AC073263-6|AAX93062.1| 714|Homo sapiens unknown protein. 41 0.006 AB209752-1|BAD92989.1| 906|Homo sapiens sodium bicarbonate tran... 41 0.006 AB209373-1|BAD92610.1| 410|Homo sapiens CS0DA006YC23 variant pr... 41 0.006 AB002302-1|BAA20763.3| 2415|Homo sapiens KIAA0304 protein protein. 41 0.006 Z11933-1|CAA77990.1| 443|Homo sapiens N-Oct 3 octamer DNA (ATGC... 41 0.008 L37868-1|AAB59611.1| 443|Homo sapiens POU-domain transcription ... 41 0.008 BX537864-1|CAD97867.1| 270|Homo sapiens hypothetical protein pr... 41 0.008 BC094799-1|AAH94799.1| 1222|Homo sapiens valosin containing prot... 41 0.008 BC051699-1|AAH51699.2| 443|Homo sapiens POU class 3 homeobox 2 ... 41 0.008 BC037404-1|AAH37404.1| 1015|Homo sapiens formin binding protein ... 41 0.008 BC036035-1|AAH36035.1| 979|Homo sapiens DHX36 protein protein. 41 0.008 BC003413-1|AAH03413.1| 217|Homo sapiens nucleolar protein famil... 41 0.008 AL022395-2|CAB37982.1| 443|Homo sapiens POU domain, class 3, tr... 41 0.008 AK022987-1|BAB14348.1| 560|Homo sapiens protein ( Homo sapiens ... 41 0.008 AJ577134-1|CAE11803.1| 994|Homo sapiens putative DExH/D RNA hel... 41 0.008 AJ577133-1|CAE11802.1| 1008|Homo sapiens putative DExH/D RNA hel... 41 0.008 AJ276003-1|CAB76563.1| 217|Homo sapiens GAR1 protein protein. 41 0.008 AF217190-1|AAG36783.1| 1008|Homo sapiens MLEL1 protein protein. 41 0.008 AB058753-1|BAB47479.1| 1236|Homo sapiens KIAA1850 protein protein. 41 0.008 AB023231-1|BAA76858.2| 1050|Homo sapiens KIAA1014 protein protein. 41 0.008 Z86061-3|CAI42258.1| 1096|Homo sapiens diaphanous homolog 2 (Dro... 40 0.010 Z86061-2|CAI42257.1| 1101|Homo sapiens diaphanous homolog 2 (Dro... 40 0.010 Y15909-1|CAA75870.1| 1101|Homo sapiens DIA-156 protein protein. 40 0.010 Y15908-1|CAA75869.1| 1096|Homo sapiens DIA-12C protein protein. 40 0.010 X64624-1|CAA45907.1| 331|Homo sapiens RDC-1 protein. 40 0.010 X07696-1|CAA30535.1| 456|Homo sapiens protein ( Human mRNA for ... 40 0.010 U88666-1|AAC05299.1| 686|Homo sapiens serine kinase SRPK2 protein. 40 0.010 L35013-1|AAA60300.1| 424|Homo sapiens spliceosomal protein prot... 40 0.010 D10250-1|BAA01095.1| 2783|Homo sapiens alpha-fetoprotein enhance... 40 0.010 BT007261-1|AAP35925.1| 456|Homo sapiens keratin 15 protein. 40 0.010 BC117414-1|AAI17415.1| 1103|Homo sapiens DIAPH2 protein protein. 40 0.010 BC105018-1|AAI05019.1| 306|Homo sapiens RNA binding protein, au... 40 0.010 BC090883-1|AAH90883.1| 424|Homo sapiens splicing factor 3b, sub... 40 0.010 BC068547-1|AAH68547.1| 688|Homo sapiens SRPK2 protein protein. 40 0.010 BC035214-1|AAH35214.1| 688|Homo sapiens SFRS protein kinase 2 p... 40 0.010 BC013886-1|AAH13886.1| 424|Homo sapiens splicing factor 3b, sub... 40 0.010 BC004273-1|AAH04273.1| 424|Homo sapiens splicing factor 3b, sub... 40 0.010 BC002641-1|AAH02641.1| 456|Homo sapiens keratin 15 protein. 40 0.010 AY354201-1|AAQ63886.1| 546|Homo sapiens SFRS protein kinase 2 i... 40 0.010 AM404259-1|CAL49295.1| 1200|Homo sapiens breast cancer anti-estr... 40 0.010 AM404183-1|CAL49297.1| 1200|Homo sapiens breast cancer anti-estr... 40 0.010 AM404182-1|CAL49296.1| 1220|Homo sapiens breast cancer anti-estr... 40 0.010 AL669876-2|CAH71114.1| 1096|Homo sapiens diaphanous homolog 2 (D... 40 0.010 AL669876-1|CAH71113.1| 1101|Homo sapiens diaphanous homolog 2 (D... 40 0.010 AL606530-3|CAI39842.1| 1096|Homo sapiens diaphanous homolog 2 (D... 40 0.010 AL606530-2|CAI39841.1| 1101|Homo sapiens diaphanous homolog 2 (D... 40 0.010 AL592157-3|CAI40545.1| 1096|Homo sapiens diaphanous homolog 2 (D... 40 0.010 AL592157-2|CAI40544.1| 1101|Homo sapiens diaphanous homolog 2 (D... 40 0.010 AL591493-2|CAI12554.1| 424|Homo sapiens splicing factor 3b, sub... 40 0.010 AL590487-2|CAI12648.1| 424|Homo sapiens splicing factor 3b, sub... 40 0.010 AL391821-1|CAH71361.1| 1101|Homo sapiens diaphanous homolog 2 (D... 40 0.010 AL354995-2|CAI14980.1| 760|Homo sapiens dachshund homolog 1 (Dr... 40 0.010 AL354995-1|CAI14979.1| 708|Homo sapiens dachshund homolog 1 (Dr... 40 0.010 AL163542-2|CAH73005.1| 760|Homo sapiens dachshund homolog 1 (Dr... 40 0.010 AL163542-1|CAH73006.1| 708|Homo sapiens dachshund homolog 1 (Dr... 40 0.010 AL161624-2|CAI40916.1| 1096|Homo sapiens diaphanous homolog 2 (D... 40 0.010 AL161624-1|CAI40915.1| 1101|Homo sapiens diaphanous homolog 2 (D... 40 0.010 AL139809-2|CAD13477.2| 1096|Homo sapiens diaphanous homolog 2 (D... 40 0.010 AL139809-1|CAI39928.1| 1101|Homo sapiens diaphanous homolog 2 (D... 40 0.010 AL139186-2|CAC12840.2| 760|Homo sapiens dachshund homolog 1 (Dr... 40 0.010 AL139186-1|CAI16673.1| 708|Homo sapiens dachshund homolog 1 (Dr... 40 0.010 AL138698-3|CAH73304.1| 760|Homo sapiens dachshund homolog 1 (Dr... 40 0.010 AL138698-2|CAH73303.1| 708|Homo sapiens dachshund homolog 1 (Dr... 40 0.010 AL096814-1|CAD92526.1| 1200|Homo sapiens transcriptional regulat... 40 0.010 AL031668-6|CAB43742.1| 290|Homo sapiens RNA binding protein, au... 40 0.010 AL031668-5|CAI22150.1| 306|Homo sapiens RNA binding protein, au... 40 0.010 AL031668-4|CAI22149.1| 237|Homo sapiens RNA binding protein, au... 40 0.010 AL031053-2|CAB39108.2| 1096|Homo sapiens diaphanous homolog 2 (D... 40 0.010 AL031053-1|CAI42515.1| 1101|Homo sapiens diaphanous homolog 2 (D... 40 0.010 AK223322-1|BAD97042.1| 424|Homo sapiens splicing factor 3b, sub... 40 0.010 AF386649-1|AAL26987.1| 1362|Homo sapiens bromodomain-containing ... 40 0.010 AF356492-1|AAL08487.1| 706|Homo sapiens dachshund protein. 40 0.010 AF297872-1|AAL01653.1| 1200|Homo sapiens zinc finger transcripti... 40 0.010 AF202320-1|AAF27047.1| 456|Homo sapiens keratin 15 protein. 40 0.010 AF148457-1|AAF04487.1| 306|Homo sapiens heterogeneous nuclear r... 40 0.010 AF102546-1|AAF01351.1| 706|Homo sapiens dachshund protein. 40 0.010 AC005070-2|AAC29140.1| 675|Homo sapiens serine kinase SRPK2 pro... 40 0.010 AC005070-1|AAC29141.1| 675|Homo sapiens WUGSC:H_RG152G17.1a pro... 40 0.010 AB067470-1|BAB67776.1| 1480|Homo sapiens KIAA1883 protein protein. 40 0.010 U41371-1|AAA97461.1| 872|Homo sapiens spliceosome associated pr... 40 0.013 L21990-1|AAA60301.1| 464|Homo sapiens spiceosomal protein protein. 40 0.013 L20969-1|AAC00042.1| 809|Homo sapiens cyclic AMP phosphodiester... 40 0.013 D87459-1|BAA13399.2| 567|Homo sapiens KIAA0269 protein. 40 0.013 BX537771-1|CAD97834.1| 799|Homo sapiens hypothetical protein pr... 40 0.013 BC132975-1|AAI32976.1| 914|Homo sapiens AR protein protein. 40 0.013 BC060820-1|AAH60820.1| 895|Homo sapiens zinc finger protein 281... 40 0.013 BC053577-1|AAH53577.1| 877|Homo sapiens SF3B2 protein protein. 40 0.013 BC051905-1|AAH51905.1| 895|Homo sapiens zinc finger protein 281... 40 0.013 BC050072-1|AAH50072.1| 489|Homo sapiens forkhead box G1 protein. 40 0.013 BC044591-1|AAH44591.1| 559|Homo sapiens WAS protein family, mem... 40 0.013 BC015804-1|AAH15804.1| 481|Homo sapiens SF3A2 protein protein. 40 0.013 BC009903-1|AAH09903.1| 464|Homo sapiens splicing factor 3a, sub... 40 0.013 BC004434-1|AAH04434.1| 464|Homo sapiens splicing factor 3a, sub... 40 0.013 BC000401-1|AAH00401.2| 894|Homo sapiens SF3B2 protein protein. 40 0.013 AY950679-1|AAY34147.1| 659|Homo sapiens MEX3C protein. 40 0.013 AL590009-1|CAI12485.1| 559|Homo sapiens WAS protein family, mem... 40 0.013 AJ132592-1|CAB70968.1| 895|Homo sapiens zinc finger protein pro... 40 0.013 AF134303-1|AAD33052.1| 559|Homo sapiens Scar1 protein. 40 0.013 AF125158-1|AAD21084.1| 895|Homo sapiens zinc finger DNA binding... 40 0.013 AC005263-1|AAC25613.1| 464|Homo sapiens SP62_HUMAN protein. 40 0.013 AB028974-1|BAA83003.2| 402|Homo sapiens KIAA1051 protein protein. 40 0.013 X75346-1|CAA53094.1| 396|Homo sapiens MAP kinase activated prot... 40 0.017 U36561-1|AAA79948.1| 528|Homo sapiens fus-like protein protein. 40 0.017 U12779-1|AAA20851.1| 370|Homo sapiens MAP kinase activated prot... 40 0.017 L32832-1|AAC14462.1| 3703|Homo sapiens zinc finger homeodomain p... 40 0.017 BC052584-1|AAH52584.1| 400|Homo sapiens mitogen-activated prote... 40 0.017 BC036060-1|AAH36060.2| 400|Homo sapiens mitogen-activated prote... 40 0.017 BC028050-1|AAH28050.1| 634|Homo sapiens CREB regulated transcri... 40 0.017 BC023614-1|AAH23614.2| 604|Homo sapiens CRTC1 protein protein. 40 0.017 BC017075-1|AAH17075.2| 475|Homo sapiens CRTC1 protein protein. 40 0.017 AY360171-1|AAQ98856.1| 650|Homo sapiens transducer of regulated... 40 0.017 AY040323-1|AAK93832.1| 593|Homo sapiens mucoepidermoid suscepti... 40 0.017 AL591846-12|CAI13544.1| 400|Homo sapiens mitogen-activated prot... 40 0.017 AL591846-11|CAI13543.1| 370|Homo sapiens mitogen-activated prot... 40 0.017 AC006123-1|AAC97072.1| 414|Homo sapiens KIAA0616 protein protein. 40 0.017 AC004943-1|AAC79153.1| 2553|Homo sapiens unknown protein. 40 0.017 AB051514-1|BAB21818.1| 1130|Homo sapiens KIAA1727 protein protein. 40 0.017 AB014516-1|BAA31591.1| 634|Homo sapiens KIAA0616 protein protein. 40 0.017 X98893-1|CAA67398.1| 589|Homo sapiens hTAFII68 protein. 39 0.023 U51334-1|AAC50932.1| 592|Homo sapiens putative RNA binding prot... 39 0.023 M77663-1|AAA59199.1| 384|Homo sapiens keratin 10 protein. 39 0.023 L12392-1|AAB38240.1| 3144|Homo sapiens Huntington's Disease prot... 39 0.023 BX649186-1|CAE46204.1| 669|Homo sapiens hypothetical protein pr... 39 0.023 BC150273-1|AAI50274.1| 1422|Homo sapiens YEATS domain containing... 39 0.023 BC068504-1|AAH68504.1| 849|Homo sapiens diaphanous homolog 3 (D... 39 0.023 BC051877-1|AAH51877.1| 557|Homo sapiens ariadne homolog, ubiqui... 39 0.023 BC048963-1|AAH48963.1| 849|Homo sapiens diaphanous homolog 3 (D... 39 0.023 BC046099-1|AAH46099.2| 592|Homo sapiens TAF15 RNA polymerase II... 39 0.023 BC034952-1|AAH34952.1| 849|Homo sapiens diaphanous homolog 3 (D... 39 0.023 AY818645-1|AAW78862.1| 1112|Homo sapiens diaphanous-related form... 39 0.023 AY750055-1|AAW73254.1| 1152|Homo sapiens diaphanous homolog 3 pr... 39 0.023 AY197697-1|AAO13485.1| 589|Homo sapiens TAF15 RNA polymerase II... 39 0.023 AL833083-1|CAD89973.1| 1067|Homo sapiens hypothetical protein pr... 39 0.023 AL590999-1|CAI16176.2| 1068|Homo sapiens dishevelled associated ... 39 0.023 AL590383-2|CAH71374.2| 2279|Homo sapiens zinc finger protein 318... 39 0.023 AL583834-6|CAI14459.2| 2279|Homo sapiens zinc finger protein 318... 39 0.023 AL390878-5|CAI14158.2| 1193|Homo sapiens diaphanous homolog 3 (D... 39 0.023 AL390878-4|CAM19740.1| 1123|Homo sapiens diaphanous homolog 3 (D... 39 0.023 AL390878-3|CAM19739.1| 1182|Homo sapiens diaphanous homolog 3 (D... 39 0.023 AL390878-2|CAM19741.1| 1147|Homo sapiens diaphanous homolog 3 (D... 39 0.023 AL390878-1|CAM19738.1| 1112|Homo sapiens diaphanous homolog 3 (D... 39 0.023 AL359266-4|CAM15405.1| 1193|Homo sapiens diaphanous homolog 3 (D... 39 0.023 AL359266-3|CAM15403.1| 1123|Homo sapiens diaphanous homolog 3 (D... 39 0.023 AL359266-2|CAM15406.1| 1182|Homo sapiens diaphanous homolog 3 (D... 39 0.023 AL359266-1|CAM15404.1| 1147|Homo sapiens diaphanous homolog 3 (D... 39 0.023 AL357412-1|CAI23288.2| 1068|Homo sapiens dishevelled associated ... 39 0.023 AL356502-5|CAI14102.2| 1193|Homo sapiens diaphanous homolog 3 (D... 39 0.023 AL356502-4|CAM19400.1| 1123|Homo sapiens diaphanous homolog 3 (D... 39 0.023 AL356502-3|CAM19399.1| 1182|Homo sapiens diaphanous homolog 3 (D... 39 0.023 AL356502-2|CAM19401.1| 1147|Homo sapiens diaphanous homolog 3 (D... 39 0.023 AL356502-1|CAM19398.1| 1112|Homo sapiens diaphanous homolog 3 (D... 39 0.023 AL354829-5|CAM14267.1| 1193|Homo sapiens diaphanous homolog 3 (D... 39 0.023 AL354829-4|CAM14265.1| 1123|Homo sapiens diaphanous homolog 3 (D... 39 0.023 AL354829-3|CAI39756.2| 1182|Homo sapiens diaphanous homolog 3 (D... 39 0.023 AL354829-2|CAM14266.1| 1147|Homo sapiens diaphanous homolog 3 (D... 39 0.023 AL354829-1|CAI39757.2| 1112|Homo sapiens diaphanous homolog 3 (D... 39 0.023 AL136089-1|CAI20010.2| 1068|Homo sapiens dishevelled associated ... 39 0.023 AK128195-1|BAC87319.1| 976|Homo sapiens BP4). protein. 39 0.023 AK075231-1|BAC11488.1| 169|Homo sapiens protein ( Homo sapiens ... 39 0.023 AK027872-1|BAB55422.1| 509|Homo sapiens protein ( Homo sapiens ... 39 0.023 AK027184-1|BAB15686.1| 412|Homo sapiens protein ( Homo sapiens ... 39 0.023 AJ243190-1|CAB45870.1| 557|Homo sapiens UbcH 7-binding protein ... 39 0.023 AF121141-1|AAD17298.1| 2099|Homo sapiens endocrine regulator pro... 39 0.023 AF090114-1|AAD47387.1| 2099|Homo sapiens unknown protein. 39 0.023 AF072832-1|AAD28088.1| 557|Homo sapiens UbcH 7-binding protein ... 39 0.023 AB244758-1|BAE96352.1| 1123|Homo sapiens mammalian diaphanous ho... 39 0.023 AB244756-1|BAE96350.1| 1182|Homo sapiens mammalian diaphanous ho... 39 0.023 AB209887-1|BAD93124.1| 725|Homo sapiens WD repeat domain 26 var... 39 0.023 AB095934-1|BAC23110.2| 1032|Homo sapiens KIAA2014 protein protein. 39 0.023 AB033023-1|BAA86511.1| 1487|Homo sapiens KIAA1197 protein protein. 39 0.023 AB016794-1|BAA36753.1| 3144|Homo sapiens huntingtin protein. 39 0.023 AB010067-2|BAA33812.1| 589|Homo sapiens RBP56/hTAFII68 protein. 39 0.023 AB010067-1|BAA33811.1| 592|Homo sapiens RBP56/hTAFII68 protein. 39 0.023 AB002379-1|BAA20835.2| 1114|Homo sapiens KIAA0381 protein protein. 39 0.023 X58964-1|CAA41730.1| 979|Homo sapiens MHC class II regulatory ... 39 0.030 X56597-1|CAA39935.1| 321|Homo sapiens fibrillarin protein. 39 0.030 X05418-1|CAA28991.1| 215|Homo sapiens keratin type II (AA1-215)... 39 0.030 U88154-1|AAC17709.1| 1021|Homo sapiens proline and glutamic acid... 39 0.030 U88153-1|AAC17708.2| 1284|Homo sapiens PELP1 protein. 39 0.030 S79867-1|AAB35421.1| 473|Homo sapiens type I keratin 16 protein. 39 0.030 M59849-1|AAA52453.1| 321|Homo sapiens fibrillarin protein. 39 0.030 M28439-1|AAA59460.1| 470|Homo sapiens keratin type 16 protein. 39 0.030 L38696-1|AAC28898.1| 291|Homo sapiens autoantigen p542 protein. 39 0.030 J00124-1|AAB59562.1| 472|Homo sapiens keratin protein. 39 0.030 CR457069-1|CAG33350.1| 321|Homo sapiens FBL protein. 39 0.030 BT020144-1|AAV38946.1| 321|Homo sapiens fibrillarin protein. 39 0.030 BT006830-1|AAP35476.1| 321|Homo sapiens fibrillarin protein. 39 0.030 BC103753-1|AAI03754.1| 307|Homo sapiens RNA binding protein, au... 39 0.030 BC069058-1|AAH69058.1| 1130|Homo sapiens proline, glutamic acid ... 39 0.030 BC049826-1|AAH49826.1| 979|Homo sapiens regulatory factor X, 1 ... 39 0.030 BC042437-1|AAH42437.1| 472|Homo sapiens keratin 14 (epidermolys... 39 0.030 BC039169-1|AAH39169.1| 473|Homo sapiens keratin 16 (focal non-e... 39 0.030 BC030289-1|AAH30289.1| 180|Homo sapiens SIX3 protein protein. 39 0.030 BC019260-1|AAH19260.1| 321|Homo sapiens fibrillarin protein. 39 0.030 BC010457-1|AAH10457.2| 1048|Homo sapiens PELP1 protein protein. 39 0.030 BC002875-1|AAH02875.2| 743|Homo sapiens PELP1 protein protein. 39 0.030 AY882602-1|AAW80659.1| 1061|Homo sapiens transcription factor HM... 39 0.030 AL162671-1|CAB83141.1| 164|Homo sapiens human homeobox protein ... 39 0.030 AK222915-1|BAD96635.1| 307|Homo sapiens RNA binding protein (au... 39 0.030 AJ628418-1|CAF31522.1| 600|Homo sapiens keratin 3 protein. 39 0.030 AJ315949-1|CAC51389.1| 231|Homo sapiens hypothetical protein pr... 39 0.030 AJ012611-1|CAB42539.1| 332|Homo sapiens SIX3 protein protein. 39 0.030 AF547989-1|AAN41255.1| 1130|Homo sapiens MNAR protein. 39 0.030 AF361354-1|AAL50049.1| 426|Homo sapiens voltage-dependent calci... 39 0.030 AF288388-1|AAK20031.1| 414|Homo sapiens calcium channel gamma s... 39 0.030 AF092047-1|AAD11939.1| 332|Homo sapiens homeobox protein Six3 p... 39 0.030 AF083891-1|AAD51091.1| 332|Homo sapiens SIX3 protein protein. 39 0.030 AF061812-1|AAC99326.1| 473|Homo sapiens keratin 16 protein. 39 0.030 AF061809-1|AAD15829.1| 473|Homo sapiens keratin 16 protein. 39 0.030 AF049339-1|AAD15753.1| 332|Homo sapiens Six3 protein. 39 0.030 AC012354-1|AAX93283.1| 332|Homo sapiens unknown protein. 39 0.030 AC006950-1|AAD15623.1| 227|Homo sapiens FBRL_HUMAN [AA 1- 227] ... 39 0.030 AC005393-3|AAC28913.1| 318|Homo sapiens FBRL_HUMAN protein. 39 0.030 Z93020-1|CAI21594.1| 729|Homo sapiens RAN binding protein 9 pro... 38 0.040 Y08765-1|CAA70018.1| 639|Homo sapiens SF1-Hl1 isoform protein. 38 0.040 U47742-1|AAC50662.1| 2004|Homo sapiens monocytic leukaemia zinc ... 38 0.040 L49380-1|AAB04033.1| 639|Homo sapiens transcription factor ZFM1... 38 0.040 BC052781-1|AAH52781.1| 802|Homo sapiens RANBP9 protein protein. 38 0.040 BC044636-1|AAH44636.1| 520|Homo sapiens YLPM1 protein protein. 38 0.040 BC032358-1|AAH32358.1| 418|Homo sapiens Enah/Vasp-like protein. 38 0.040 BC023997-1|AAH23997.1| 416|Homo sapiens EVL protein protein. 38 0.040 BC008669-1|AAH08669.1| 360|Homo sapiens PRR11 protein protein. 38 0.040 BC000773-1|AAH00773.1| 265|Homo sapiens Similar to zinc finger ... 38 0.040 AY296059-1|AAQ62697.1| 1494|Homo sapiens BCL9-2 protein. 38 0.040 AL441883-5|CAI19841.1| 729|Homo sapiens RAN binding protein 9 p... 38 0.040 AK091050-1|BAC03574.1| 723|Homo sapiens protein ( Homo sapiens ... 38 0.040 AK090435-1|BAC03416.1| 1766|Homo sapiens FLJ00353 protein protein. 38 0.040 AK001891-1|BAA91964.1| 360|Homo sapiens protein ( Homo sapiens ... 38 0.040 AK000296-1|BAA91064.1| 210|Homo sapiens protein ( Homo sapiens ... 38 0.040 AF305687-1|AAG22558.1| 282|Homo sapiens transcription factor AT... 38 0.040 AF131766-1|AAD20040.1| 362|Homo sapiens Similar to Ena-VASP lik... 38 0.040 AF112209-1|AAF17197.1| 416|Homo sapiens Ena-VASP-like protein p... 38 0.040 AF087843-1|AAP97156.1| 418|Homo sapiens B6 protein. 38 0.040 AF052504-1|AAF21709.1| 418|Homo sapiens RNB6 protein. 38 0.040 AC007956-2|AAF61275.1| 1822|Homo sapiens unknown protein. 38 0.040 AB094091-1|BAC76045.1| 1499|Homo sapiens DLNB11 protein. 38 0.040 AB084087-1|BAC67014.1| 1422|Homo sapiens Formactin2 protein. 38 0.040 AB055311-1|BAB62525.1| 729|Homo sapiens RanBPM protein. 38 0.040 AB051482-1|BAB21786.1| 1199|Homo sapiens KIAA1695 protein protein. 38 0.040 AB028987-1|BAA83016.2| 1315|Homo sapiens KIAA1064 protein protein. 38 0.040 AB021663-1|BAA78477.2| 282|Homo sapiens leucine-zipper protein ... 38 0.040 AB002344-1|BAA21572.2| 1682|Homo sapiens KIAA0346 protein. 38 0.040 M21389-1|AAA36143.1| 590|Homo sapiens protein ( Human keratin t... 38 0.053 M19723-1|AAA36145.1| 508|Homo sapiens protein ( Human type II k... 38 0.053 D29833-1|BAA06213.1| 79|Homo sapiens proline rich peptide P-B ... 38 0.053 BT007186-1|AAP35850.1| 472|Homo sapiens keratin 14 (epidermolys... 38 0.053 BC125224-1|AAI25225.1| 748|Homo sapiens LRCH2 protein protein. 38 0.053 BC122558-1|AAI22559.1| 578|Homo sapiens keratin 77 protein. 38 0.053 BC118598-1|AAI18599.1| 345|Homo sapiens KRT1B protein protein. 38 0.053 BC108290-1|AAI08291.1| 316|Homo sapiens LOR protein protein. 38 0.053 BC094830-1|AAH94830.1| 472|Homo sapiens keratin 14 (epidermolys... 38 0.053 BC071906-1|AAH71906.1| 590|Homo sapiens keratin 5 (epidermolysi... 38 0.053 BC042132-1|AAH42132.1| 590|Homo sapiens keratin 5 (epidermolysi... 38 0.053 BC034690-1|AAH34690.1| 316|Homo sapiens LOR protein protein. 38 0.053 BC024292-1|AAH24292.1| 590|Homo sapiens keratin 5 (epidermolysi... 38 0.053 BC019097-1|AAH19097.1| 472|Homo sapiens keratin 14 (epidermolys... 38 0.053 BC015327-1|AAH15327.1| 79|Homo sapiens submaxillary gland andr... 38 0.053 BC002690-1|AAH02690.1| 472|Homo sapiens keratin 14 (epidermolys... 38 0.053 AK092276-1|BAC03847.1| 355|Homo sapiens protein ( Homo sapiens ... 38 0.053 AJ564104-1|CAD91892.1| 578|Homo sapiens keratin 1b protein. 38 0.053 AF499137-1|AAQ07403.1| 903|Homo sapiens synaptopodin protein. 38 0.053 AF499136-1|AAQ07402.1| 903|Homo sapiens synaptopodin protein. 38 0.053 AF274874-1|AAF97931.1| 590|Homo sapiens keratin 5 protein. 38 0.053 AF091395-1|AAC43042.1| 3038|Homo sapiens Trio isoform protein. 38 0.053 AB209754-1|BAD92991.1| 2202|Homo sapiens triple functional domai... 38 0.053 AB031740-1|BAA88517.1| 79|Homo sapiens salivary proline-rich p... 38 0.053 AB028952-1|BAA82981.2| 1015|Homo sapiens KIAA1029 protein protein. 38 0.053 AB037850-1|BAA92667.1| 1795|Homo sapiens KIAA1429 protein protein. 33 0.063 BC113380-1|AAI13381.1| 1147|Homo sapiens KIAA1429 protein. 33 0.065 BC112288-1|AAI12289.1| 1147|Homo sapiens hypothetical protein LO... 33 0.065 X05421-1|CAA28996.1| 233|Homo sapiens keratin type II protein. 38 0.070 M98776-1|AAB47721.1| 644|Homo sapiens keratin 1 protein. 38 0.070 J04029-1|AAA60544.1| 561|Homo sapiens keratin 10 protein. 38 0.070 D86982-1|BAA13218.1| 1180|Homo sapiens KIAA0229 protein. 38 0.070 D50857-1|BAA09454.1| 1865|Homo sapiens DOCK180 protein protein. 38 0.070 BX470201-1|CAH72560.2| 1865|Homo sapiens dedicator of cytokinesi... 38 0.070 BX470155-1|CAI22477.2| 1865|Homo sapiens dedicator of cytokinesi... 38 0.070 BC132832-1|AAI32833.1| 1134|Homo sapiens ankyrin repeat and ster... 38 0.070 BC080591-1|AAH80591.1| 189|Homo sapiens HNRPA3 protein protein. 38 0.070 BC063697-1|AAH63697.1| 644|Homo sapiens keratin 1 (epidermolyti... 38 0.070 BC027713-1|AAH27713.1| 804|Homo sapiens heterogeneous nuclear r... 38 0.070 BC022396-1|AAH22396.1| 472|Homo sapiens Unknown (protein for IM... 38 0.070 >AY260762-1|AAP20225.1| 3567|Homo sapiens zinc finger homeodomain 4 protein protein. Length = 3567 Score = 52.8 bits (121), Expect = 2e-06 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP PPP PP PPPP Sbjct: 1989 PLQAPPPTPPPPPPPPPPPPPPPPPPPP 2016 Score = 48.0 bits (109), Expect = 5e-05 Identities = 17/26 (65%), Positives = 17/26 (65%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P PPP PPP PPP PPP PP PP Sbjct: 1995 PTPPPPPPPPPPPPPPPPPPPPSAPP 2020 Score = 47.6 bits (108), Expect = 7e-05 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP PPP PPP PPP PP PP Sbjct: 1994 PPTPPPPPPPPPPPPPPPPPPPPSAPP 2020 Score = 47.2 bits (107), Expect = 9e-05 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP PPP PP PP Sbjct: 1993 PPPTPPPPPPPPPPPPPPPPPPPPSAPP 2020 Score = 40.3 bits (90), Expect = 0.010 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP PPP PPP PP PP P Sbjct: 1999 PPPPPPPPPPPPPPPPPPSAPPQVQLP 2025 Score = 39.1 bits (87), Expect = 0.023 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 +P P P P P PPP PP PPPP Sbjct: 1982 IPNTVSTPLQAPPPTPPPPPPPPPPPPPP 2010 Score = 37.5 bits (83), Expect = 0.070 Identities = 16/47 (34%), Positives = 19/47 (40%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP+PP P P+ + P P P PP P P PPP Sbjct: 1968 PPAPPQPSSMGPVKIPNTVSTPLQAPPPTPPPPPPPPPPPPPPPPPP 2014 Score = 33.5 bits (73), Expect = 1.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPP 938 P PP PPP PPP PP P P Sbjct: 1955 PETPPPPPP-PPPLPPAPPQP 1974 Score = 32.7 bits (71), Expect = 2.0 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 P P PPP PPP P PP P Sbjct: 1952 PSSPETPPPPPPPPPLPPAPPQP 1974 Score = 32.7 bits (71), Expect = 2.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPP 935 PPP PPP P P PP P P Sbjct: 1958 PPPPPPPPPLPPAPPQPSSMGP 1979 Score = 32.3 bits (70), Expect = 2.6 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPXP 920 L + P P PPP PPP PP P Sbjct: 1947 LYPISPSSPETPPPPPPPPPLPPAPP 1972 Score = 32.3 bits (70), Expect = 2.6 Identities = 16/45 (35%), Positives = 18/45 (40%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXP 930 PP+PP P PP P P P P P PP P + P Sbjct: 1994 PPTPPPPPPPPPPPPPPP-------PPPPPSAPPQVQLPVSLDLP 2031 Score = 31.9 bits (69), Expect = 3.5 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPXPPXXP 932 +S P PPP PPP PP PP P Sbjct: 1950 ISPSSPETPPPPPPPPPLPPAPPQPSSMGP 1979 Score = 30.7 bits (66), Expect = 8.0 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 7/54 (12%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPS-------PXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P P PS P P P PP P P PPP Sbjct: 1959 PPPPPPPPLPPAPPQPSSMGPVKIPNTVSTPLQAPPPTPPPPPPPPPPPPPPPP 2012 >AL096764-2|CAM28218.1| 1137|Homo sapiens chromosome X open reading frame 45 protein. Length = 1137 Score = 52.4 bits (120), Expect = 2e-06 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 LP PPP PPP PPP PPP PP PPP Sbjct: 918 LPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 52.4 bits (120), Expect = 2e-06 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP PPP PP PPPP Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPP 942 Score = 52.4 bits (120), Expect = 2e-06 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP PPP PP PPPP Sbjct: 920 PPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 52.4 bits (120), Expect = 2e-06 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP PPP PP PPPP Sbjct: 921 PPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 52.4 bits (120), Expect = 2e-06 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP PPP PP PPPP Sbjct: 922 PPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 50.0 bits (114), Expect = 1e-05 Identities = 18/27 (66%), Positives = 18/27 (66%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PP PPP PPP PPP PP PPPP Sbjct: 915 GASLPPPPPPPPPPPPPPPPPPPPPPP 941 Score = 32.3 bits (70), Expect = 2.6 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 814 PXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P P P SL P P P PP P P PPP Sbjct: 903 PSYPCHSAIPHAGASLPPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 31.9 bits (69), Expect = 3.5 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 7/34 (20%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXP-------PPXPPXXPPP 938 P PPP PPP PP P PP PPP Sbjct: 932 PPPPPPPPPPPPPPALDVGETSNLQPPPPLPPPP 965 Score = 31.5 bits (68), Expect = 4.6 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P PP P P P P P PP T PP Sbjct: 919 PPPPPPPPPPPPPPPPPP-------PPPPPPPPPALDVGETSNLQPP 958 Score = 31.1 bits (67), Expect = 6.1 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXP--XPXPXXPPXP 903 PP PP P PP P P + P P PP P Sbjct: 928 PPPPPPPPPPPPPPPPPPALDVGETSNLQPPPPLPPPP 965 >AL049563-1|CAM28289.1| 1137|Homo sapiens chromosome X open reading frame 45 protein. Length = 1137 Score = 52.4 bits (120), Expect = 2e-06 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 LP PPP PPP PPP PPP PP PPP Sbjct: 918 LPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 52.4 bits (120), Expect = 2e-06 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP PPP PP PPPP Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPP 942 Score = 52.4 bits (120), Expect = 2e-06 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP PPP PP PPPP Sbjct: 920 PPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 52.4 bits (120), Expect = 2e-06 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP PPP PP PPPP Sbjct: 921 PPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 52.4 bits (120), Expect = 2e-06 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP PPP PP PPPP Sbjct: 922 PPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 50.0 bits (114), Expect = 1e-05 Identities = 18/27 (66%), Positives = 18/27 (66%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PP PPP PPP PPP PP PPPP Sbjct: 915 GASLPPPPPPPPPPPPPPPPPPPPPPP 941 Score = 32.3 bits (70), Expect = 2.6 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 814 PXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P P P SL P P P PP P P PPP Sbjct: 903 PSYPCHSAIPHAGASLPPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 31.9 bits (69), Expect = 3.5 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 7/34 (20%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXP-------PPXPPXXPPP 938 P PPP PPP PP P PP PPP Sbjct: 932 PPPPPPPPPPPPPPALDVGETSNLQPPPPLPPPP 965 Score = 31.5 bits (68), Expect = 4.6 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P PP P P P P P PP T PP Sbjct: 919 PPPPPPPPPPPPPPPPPP-------PPPPPPPPPALDVGETSNLQPP 958 Score = 31.1 bits (67), Expect = 6.1 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXP--XPXPXXPPXP 903 PP PP P PP P P + P P PP P Sbjct: 928 PPPPPPPPPPPPPPPPPPALDVGETSNLQPPPPLPPPP 965 >AL834396-1|CAD39058.1| 1009|Homo sapiens hypothetical protein protein. Length = 1009 Score = 50.8 bits (116), Expect = 7e-06 Identities = 18/27 (66%), Positives = 18/27 (66%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PP PPP PPP PPP PP PPPP Sbjct: 462 GPVTPPMPPPPPPPPPPPPPPPPPPPP 488 Score = 49.6 bits (113), Expect = 2e-05 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P P PPP PPP PPP PP PPPP Sbjct: 463 PVTPPMPPPPPPPPPPPPPPPPPPPPPP 490 Score = 48.4 bits (110), Expect = 4e-05 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP PPP PP PP P Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPLP 492 Score = 48.0 bits (109), Expect = 5e-05 Identities = 18/29 (62%), Positives = 18/29 (62%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 V P PPP PPP PPP PPP PP P P Sbjct: 464 VTPPMPPPPPPPPPPPPPPPPPPPPPPLP 492 Score = 46.0 bits (104), Expect = 2e-04 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 PPP PPP PPP PPP PP P P Sbjct: 472 PPPPPPPPPPPPPPPPPPPLPGP 494 Score = 45.6 bits (103), Expect = 3e-04 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP PPP PP P P Sbjct: 467 PMPPPPPPPPPPPPPPPPPPPPPPLPGP 494 Score = 45.2 bits (102), Expect = 3e-04 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPP 935 +P PPP PPP PPP PPP PP P Sbjct: 468 MPPPPPPPPPPPPPPPPPPPPPPLPGP 494 Score = 40.3 bits (90), Expect = 0.010 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP P P P PP Sbjct: 476 PPPPPPPPPPPPPPPLPGPAAETVPAPP 503 Score = 38.7 bits (86), Expect = 0.030 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 9/37 (24%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPP---------PXPPXXPPPP 941 P PPP PPP PPP PP P PP PP P Sbjct: 473 PPPPPPPPPPPPPPPPPPLPGPAAETVPAPPLAPPLP 509 Score = 37.5 bits (83), Expect = 0.070 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 14/46 (30%) Frame = +3 Query: 846 SXVLPGXXPP--------------PXPPPXPPPXPPPXPPXXPPPP 941 S LP PP P PP PPP PPP PP PPPP Sbjct: 439 SGPLPPPPPPLPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPP 484 Score = 35.1 bits (77), Expect = 0.37 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXP 912 PP PP P PP P P + P P P PP P P Sbjct: 475 PPPPPPPPPPPPPPPPLPGPAAETVPAP-PLAPPLPSAP 512 Score = 34.7 bits (76), Expect = 0.49 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXT 918 PP PP P PP P P P P P P P T Sbjct: 477 PPPPPPPPPPPPPPLPGPAAETVPAPPLAPPLPSAPPLPGT 517 Score = 32.3 bits (70), Expect = 2.6 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P PP P PP + P P P PP P P PPP Sbjct: 443 PPPPPPLPPSSDTPETVQNGPVTPPMPPPP-PPPPPPPPPPPPPPP 487 Score = 32.3 bits (70), Expect = 2.6 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 9/37 (24%) Frame = +3 Query: 858 PGXXPPPXPPPXPP---------PXPPPXPPXXPPPP 941 P PPP PPP PP P PP PP PP Sbjct: 477 PPPPPPPPPPPPPPLPGPAAETVPAPPLAPPLPSAPP 513 Score = 31.1 bits (67), Expect = 6.1 Identities = 16/46 (34%), Positives = 19/46 (41%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P PP P PP +P ++ P P PP P P PPP Sbjct: 441 PLPPPP-PPLPPSSDTPE-TVQNGPVTPPMPPPPPPPPPPPPPPPP 484 Score = 31.1 bits (67), Expect = 6.1 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P +PP P PP P P P P P PP P PP Sbjct: 463 PVTPPMPPPPPPPPPPPP------PPPPPPPPPPLPGPAAETVPAPP 503 >AB067489-1|BAB67795.1| 1112|Homo sapiens KIAA1902 protein protein. Length = 1112 Score = 50.8 bits (116), Expect = 7e-06 Identities = 18/27 (66%), Positives = 18/27 (66%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PP PPP PPP PPP PP PPPP Sbjct: 565 GPVTPPMPPPPPPPPPPPPPPPPPPPP 591 Score = 49.6 bits (113), Expect = 2e-05 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P P PPP PPP PPP PP PPPP Sbjct: 566 PVTPPMPPPPPPPPPPPPPPPPPPPPPP 593 Score = 48.4 bits (110), Expect = 4e-05 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP PPP PP PP P Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPLP 595 Score = 48.0 bits (109), Expect = 5e-05 Identities = 18/29 (62%), Positives = 18/29 (62%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 V P PPP PPP PPP PPP PP P P Sbjct: 567 VTPPMPPPPPPPPPPPPPPPPPPPPPPLP 595 Score = 46.0 bits (104), Expect = 2e-04 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 PPP PPP PPP PPP PP P P Sbjct: 575 PPPPPPPPPPPPPPPPPPPLPGP 597 Score = 45.6 bits (103), Expect = 3e-04 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP PPP PP P P Sbjct: 570 PMPPPPPPPPPPPPPPPPPPPPPPLPGP 597 Score = 45.2 bits (102), Expect = 3e-04 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPP 935 +P PPP PPP PPP PPP PP P Sbjct: 571 MPPPPPPPPPPPPPPPPPPPPPPLPGP 597 Score = 40.3 bits (90), Expect = 0.010 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP P P P PP Sbjct: 579 PPPPPPPPPPPPPPPLPGPASETVPAPP 606 Score = 38.7 bits (86), Expect = 0.030 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 9/37 (24%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPP---------PXPPXXPPPP 941 P PPP PPP PPP PP P PP PP P Sbjct: 576 PPPPPPPPPPPPPPPPPPLPGPASETVPAPPLAPPLP 612 Score = 37.5 bits (83), Expect = 0.070 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 14/46 (30%) Frame = +3 Query: 846 SXVLPGXXPP--------------PXPPPXPPPXPPPXPPXXPPPP 941 S LP PP P PP PPP PPP PP PPPP Sbjct: 542 SGPLPPPPPPLPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPP 587 Score = 34.7 bits (76), Expect = 0.49 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXP 912 PP PP P PP P P + P P P PP P P Sbjct: 578 PPPPPPPPPPPPPPPPLPGPASETVPAP-PLAPPLPSAP 615 Score = 34.7 bits (76), Expect = 0.49 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXT 918 PP PP P PP P P P P P P P T Sbjct: 580 PPPPPPPPPPPPPPLPGPASETVPAPPLAPPLPSAPPLPGT 620 Score = 32.3 bits (70), Expect = 2.6 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P PP P PP + P P P PP P P PPP Sbjct: 546 PPPPPPLPPSSDTPETVQNGPVTPPMPPPP-PPPPPPPPPPPPPPP 590 Score = 32.3 bits (70), Expect = 2.6 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 9/37 (24%) Frame = +3 Query: 858 PGXXPPPXPPPXPP---------PXPPPXPPXXPPPP 941 P PPP PPP PP P PP PP PP Sbjct: 580 PPPPPPPPPPPPPPLPGPASETVPAPPLAPPLPSAPP 616 Score = 31.1 bits (67), Expect = 6.1 Identities = 16/46 (34%), Positives = 19/46 (41%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P PP P PP +P ++ P P PP P P PPP Sbjct: 544 PLPPPP-PPLPPSSDTPE-TVQNGPVTPPMPPPPPPPPPPPPPPPP 587 Score = 31.1 bits (67), Expect = 6.1 Identities = 17/47 (36%), Positives = 19/47 (40%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P +PP P PP P P P P P PP P P + P P Sbjct: 566 PVTPPMPPPPPPPPPPPPP------PPPPPPPPPLP-GPASETVPAP 605 >BC146811-1|AAI46812.1| 854|Homo sapiens ZNF341 protein protein. Length = 854 Score = 49.6 bits (113), Expect = 2e-05 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP PPP PPP PPP PP PPPP Sbjct: 178 PPPPPPPPPPLPPPPPPQPPPPP 200 Score = 44.4 bits (100), Expect = 6e-04 Identities = 19/34 (55%), Positives = 20/34 (58%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 S+ L PPP PPP PP PPP PP PPPP Sbjct: 170 SVPSYLTQPPPPPPPPPPLPPPPPPQPP--PPPP 201 Score = 41.9 bits (94), Expect = 0.003 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP PPP PP PP Sbjct: 181 PPPPPPPLPPP-PPPQPPPPPPQSLGPP 207 Score = 33.5 bits (73), Expect = 1.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP P P PPP PP P P Sbjct: 186 PPLPPPPPPQPPPPPPQSLGPPGRPNP 212 >BC146776-1|AAI46777.1| 1542|Homo sapiens SET binding protein 1 protein. Length = 1542 Score = 49.6 bits (113), Expect = 2e-05 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP PPP PPP PPP PP PPPP Sbjct: 1466 PPLPPPPPPPLPPPPPPPLPPPP 1488 Score = 45.6 bits (103), Expect = 3e-04 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 PPP PPP PPP PPP PP P P Sbjct: 1469 PPPPPPPLPPPPPPPLPPPPPLP 1491 Score = 42.3 bits (95), Expect = 0.002 Identities = 17/27 (62%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXP-PXXP 932 LP PPP PPP PPP PPP P P P Sbjct: 1468 LPPPPPPPLPPPPPPPLPPPPPLPKTP 1494 Score = 38.7 bits (86), Expect = 0.030 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPPPXPP-PXPPPXPPPXPPXXPPPP 941 P PPP PP P PPP P P PP P P Sbjct: 1466 PPLPPPPPPPLPPPPPPPLPPPPPLPKTP 1494 >BC132873-1|AAI32874.1| 854|Homo sapiens ZNF341 protein protein. Length = 854 Score = 49.6 bits (113), Expect = 2e-05 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP PPP PPP PPP PP PPPP Sbjct: 178 PPPPPPPPPPLPPPPPPQPPPPP 200 Score = 44.4 bits (100), Expect = 6e-04 Identities = 19/34 (55%), Positives = 20/34 (58%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 S+ L PPP PPP PP PPP PP PPPP Sbjct: 170 SVPSYLTQPPPPPPPPPPLPPPPPPQPP--PPPP 201 Score = 41.9 bits (94), Expect = 0.003 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP PPP PP PP Sbjct: 181 PPPPPPPLPPP-PPPQPPPPPPQSLGPP 207 Score = 33.5 bits (73), Expect = 1.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP P P PPP PP P P Sbjct: 186 PPLPPPPPPQPPPPPPQSLGPPGRPNP 212 >BC094738-1|AAH94738.1| 795|Homo sapiens ZNF341 protein protein. Length = 795 Score = 49.6 bits (113), Expect = 2e-05 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP PPP PPP PPP PP PPPP Sbjct: 119 PPPPPPPPPPLPPPPPPQPPPPP 141 Score = 44.4 bits (100), Expect = 6e-04 Identities = 19/34 (55%), Positives = 20/34 (58%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 S+ L PPP PPP PP PPP PP PPPP Sbjct: 111 SVPSYLTQPPPPPPPPPPLPPPPPPQPP--PPPP 142 Score = 41.9 bits (94), Expect = 0.003 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP PPP PP PP Sbjct: 122 PPPPPPPLPPP-PPPQPPPPPPQSLGPP 148 Score = 33.5 bits (73), Expect = 1.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP P P PPP PP P P Sbjct: 127 PPLPPPPPPQPPPPPPQSLGPPGRPNP 153 >AY494951-1|AAS82582.1| 1250|Homo sapiens lamellipodin protein. Length = 1250 Score = 49.6 bits (113), Expect = 2e-05 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP PPP PPP PPP PP PPPP Sbjct: 626 PPLPPPPPPPPPPPPPPPPPPPP 648 Score = 45.6 bits (103), Expect = 3e-04 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 PP PPP PPP PPP PP PPP Sbjct: 626 PPLPPPPPPPPPPPPPPPPPPPP 648 Score = 45.2 bits (102), Expect = 3e-04 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXP 932 P PPP PPP PPP PPP PP P Sbjct: 626 PPLPPPPPPPPPPPPPPPPPPPPLP 650 Score = 44.4 bits (100), Expect = 6e-04 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 P P PPP PPP PPP PP PP P Sbjct: 627 PLPPPPPPPPPPPPPPPPPPPPLP 650 Score = 44.0 bits (99), Expect = 8e-04 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 V P P PP PPP PPP PP PPPP Sbjct: 616 VTPYTASQPSPPLPPPPPPPPPPPPPPPPP 645 Score = 43.6 bits (98), Expect = 0.001 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PP PPP PPP PPP PP P P Sbjct: 624 PSPPLPPPPPPPPPPPPPPPPPPPPLP 650 Score = 42.3 bits (95), Expect = 0.002 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +3 Query: 846 SXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 S LP PPP PPP PPP PPP P P Sbjct: 625 SPPLPPPPPPPPPPPPPPPPPPPPLPSQSAP 655 Score = 39.1 bits (87), Expect = 0.023 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP PPP PPP P P PP PP P Sbjct: 760 PPTPPP-PPPIPAPLPPQAPPKP 781 Score = 36.7 bits (81), Expect = 0.12 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 PPP P P P P PPP P P P Sbjct: 928 PPPPPSPVPAPPPPPPPTASPTP 950 Score = 34.3 bits (75), Expect = 0.65 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 4/36 (11%) Frame = +3 Query: 846 SXVLPGXXPPPXPPPX----PPPXPPPXPPXXPPPP 941 S +P PP PP PPP P P P PPPP Sbjct: 908 SIPVPSPDFPPPPPESSLVFPPPPPSPVPAPPPPPP 943 Score = 33.5 bits (73), Expect = 1.1 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 8/36 (22%) Frame = +3 Query: 858 PGXXPPPXP--PPXPP------PXPPPXPPXXPPPP 941 P P P P PP PP P PPP P PPPP Sbjct: 906 PSSIPVPSPDFPPPPPESSLVFPPPPPSPVPAPPPP 941 Score = 32.7 bits (71), Expect = 2.0 Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXP-PPXPPPXPPXXPPPP 941 ++ V P PPP P P P PP PP P P P Sbjct: 755 ITQVAPPTPPPPPPIPAPLPPQAPPKPLVTIPAP 788 Score = 32.7 bits (71), Expect = 2.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +1 Query: 802 SPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXT 918 +PP P PP P F P P P PP P P T Sbjct: 802 APPTPTPPVPPAKKQPAFPASYIP-PSPPTPPVPVPPPT 839 Score = 32.7 bits (71), Expect = 2.0 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P SL P P P PPP PPP P P P Sbjct: 921 PESSLVFPPPPPSPVPAPPPPPPPTASPTPDKSGSP 956 Score = 31.1 bits (67), Expect = 6.1 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 V P PP PPP PPP P P P Sbjct: 703 VPPNGVVPPPPPPPPPPTPGSAMAQLKPAP 732 Score = 31.1 bits (67), Expect = 6.1 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXP 920 P S V P P P P P PPP P P Sbjct: 919 PPPESSLVFPPPPPSPVPAPPPPPPPTASP 948 >AL050349-3|CAI21796.2| 847|Homo sapiens zinc finger protein 341 protein. Length = 847 Score = 49.6 bits (113), Expect = 2e-05 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP PPP PPP PPP PP PPPP Sbjct: 178 PPPPPPPPPPLPPPPPPQPPPPP 200 Score = 44.4 bits (100), Expect = 6e-04 Identities = 19/34 (55%), Positives = 20/34 (58%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 S+ L PPP PPP PP PPP PP PPPP Sbjct: 170 SVPSYLTQPPPPPPPPPPLPPPPPPQPP--PPPP 201 Score = 41.9 bits (94), Expect = 0.003 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP PPP PP PP Sbjct: 181 PPPPPPPLPPP-PPPQPPPPPPQSLGPP 207 Score = 33.5 bits (73), Expect = 1.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP P P PPP PP P P Sbjct: 186 PPLPPPPPPQPPPPPPQSLGPPGRPNP 212 >AJ584699-1|CAE48361.1| 1250|Homo sapiens RAPH1 protein protein. Length = 1250 Score = 49.6 bits (113), Expect = 2e-05 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP PPP PPP PPP PP PPPP Sbjct: 626 PPLPPPPPPPPPPPPPPPPPPPP 648 Score = 45.6 bits (103), Expect = 3e-04 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 PP PPP PPP PPP PP PPP Sbjct: 626 PPLPPPPPPPPPPPPPPPPPPPP 648 Score = 45.2 bits (102), Expect = 3e-04 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXP 932 P PPP PPP PPP PPP PP P Sbjct: 626 PPLPPPPPPPPPPPPPPPPPPPPLP 650 Score = 44.4 bits (100), Expect = 6e-04 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 P P PPP PPP PPP PP PP P Sbjct: 627 PLPPPPPPPPPPPPPPPPPPPPLP 650 Score = 44.0 bits (99), Expect = 8e-04 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 V P P PP PPP PPP PP PPPP Sbjct: 616 VTPYTASQPSPPLPPPPPPPPPPPPPPPPP 645 Score = 43.6 bits (98), Expect = 0.001 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PP PPP PPP PPP PP P P Sbjct: 624 PSPPLPPPPPPPPPPPPPPPPPPPPLP 650 Score = 42.3 bits (95), Expect = 0.002 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +3 Query: 846 SXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 S LP PPP PPP PPP PPP P P Sbjct: 625 SPPLPPPPPPPPPPPPPPPPPPPPLPSQSAP 655 Score = 39.1 bits (87), Expect = 0.023 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP PPP PPP P P PP PP P Sbjct: 760 PPTPPP-PPPIPAPLPPQAPPKP 781 Score = 36.7 bits (81), Expect = 0.12 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 PPP P P P P PPP P P P Sbjct: 928 PPPPPSPVPAPPPPPPPTASPTP 950 Score = 34.3 bits (75), Expect = 0.65 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 4/36 (11%) Frame = +3 Query: 846 SXVLPGXXPPPXPPPX----PPPXPPPXPPXXPPPP 941 S +P PP PP PPP P P P PPPP Sbjct: 908 SIPVPSPDFPPPPPESSLVFPPPPPSPVPAPPPPPP 943 Score = 33.5 bits (73), Expect = 1.1 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 8/36 (22%) Frame = +3 Query: 858 PGXXPPPXP--PPXPP------PXPPPXPPXXPPPP 941 P P P P PP PP P PPP P PPPP Sbjct: 906 PSSIPVPSPDFPPPPPESSLVFPPPPPSPVPAPPPP 941 Score = 32.7 bits (71), Expect = 2.0 Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXP-PPXPPPXPPXXPPPP 941 ++ V P PPP P P P PP PP P P P Sbjct: 755 ITQVAPPTPPPPPPIPAPLPPQAPPKPLVTIPAP 788 Score = 32.7 bits (71), Expect = 2.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +1 Query: 802 SPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXT 918 +PP P PP P F P P P PP P P T Sbjct: 802 APPTPTPPVPPAKKQPAFPASYIP-PSPPTPPVPVPPPT 839 Score = 32.7 bits (71), Expect = 2.0 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P SL P P P PPP PPP P P P Sbjct: 921 PESSLVFPPPPPSPVPAPPPPPPPTASPTPDKSGSP 956 Score = 31.1 bits (67), Expect = 6.1 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 V P PP PPP PPP P P P Sbjct: 703 VPPNGVVPPPPPPPPPPTPGSAMAQLKPAP 732 Score = 31.1 bits (67), Expect = 6.1 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXP 920 P S V P P P P P PPP P P Sbjct: 919 PPPESSLVFPPPPPSPVPAPPPPPPPTASP 948 >AB051468-1|BAB21772.1| 1236|Homo sapiens KIAA1681 protein protein. Length = 1236 Score = 49.6 bits (113), Expect = 2e-05 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP PPP PPP PPP PP PPPP Sbjct: 612 PPLPPPPPPPPPPPPPPPPPPPP 634 Score = 45.6 bits (103), Expect = 3e-04 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 PP PPP PPP PPP PP PPP Sbjct: 612 PPLPPPPPPPPPPPPPPPPPPPP 634 Score = 45.2 bits (102), Expect = 3e-04 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXP 932 P PPP PPP PPP PPP PP P Sbjct: 612 PPLPPPPPPPPPPPPPPPPPPPPLP 636 Score = 44.4 bits (100), Expect = 6e-04 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 P P PPP PPP PPP PP PP P Sbjct: 613 PLPPPPPPPPPPPPPPPPPPPPLP 636 Score = 44.0 bits (99), Expect = 8e-04 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 V P P PP PPP PPP PP PPPP Sbjct: 602 VTPYTASQPSPPLPPPPPPPPPPPPPPPPP 631 Score = 43.6 bits (98), Expect = 0.001 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PP PPP PPP PPP PP P P Sbjct: 610 PSPPLPPPPPPPPPPPPPPPPPPPPLP 636 Score = 42.3 bits (95), Expect = 0.002 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +3 Query: 846 SXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 S LP PPP PPP PPP PPP P P Sbjct: 611 SPPLPPPPPPPPPPPPPPPPPPPPLPSQSAP 641 Score = 39.1 bits (87), Expect = 0.023 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP PPP PPP P P PP PP P Sbjct: 746 PPTPPP-PPPIPAPLPPQAPPKP 767 Score = 36.7 bits (81), Expect = 0.12 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 PPP P P P P PPP P P P Sbjct: 914 PPPPPSPVPAPPPPPPPTASPTP 936 Score = 34.3 bits (75), Expect = 0.65 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 4/36 (11%) Frame = +3 Query: 846 SXVLPGXXPPPXPPPX----PPPXPPPXPPXXPPPP 941 S +P PP PP PPP P P P PPPP Sbjct: 894 SIPVPSPDFPPPPPESSLVFPPPPPSPVPAPPPPPP 929 Score = 33.5 bits (73), Expect = 1.1 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 8/36 (22%) Frame = +3 Query: 858 PGXXPPPXP--PPXPP------PXPPPXPPXXPPPP 941 P P P P PP PP P PPP P PPPP Sbjct: 892 PSSIPVPSPDFPPPPPESSLVFPPPPPSPVPAPPPP 927 Score = 32.7 bits (71), Expect = 2.0 Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXP-PPXPPPXPPXXPPPP 941 ++ V P PPP P P P PP PP P P P Sbjct: 741 ITQVAPPTPPPPPPIPAPLPPQAPPKPLVTIPAP 774 Score = 32.7 bits (71), Expect = 2.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +1 Query: 802 SPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXT 918 +PP P PP P F P P P PP P P T Sbjct: 788 APPTPTPPVPPAKKQPAFPASYIP-PSPPTPPVPVPPPT 825 Score = 32.7 bits (71), Expect = 2.0 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P SL P P P PPP PPP P P P Sbjct: 907 PESSLVFPPPPPSPVPAPPPPPPPTASPTPDKSGSP 942 Score = 31.1 bits (67), Expect = 6.1 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 V P PP PPP PPP P P P Sbjct: 689 VPPNGVVPPPPPPPPPPTPGSAMAQLKPAP 718 Score = 31.1 bits (67), Expect = 6.1 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXP 920 P S V P P P P P PPP P P Sbjct: 905 PPPESSLVFPPPPPSPVPAPPPPPPPTASP 934 >AB022660-1|BAA82444.1| 1542|Homo sapiens SET-binding protein (SEB) protein. Length = 1542 Score = 49.6 bits (113), Expect = 2e-05 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP PPP PPP PPP PP PPPP Sbjct: 1466 PPLPPPPPPPLPPPPPPPLPPPP 1488 Score = 45.6 bits (103), Expect = 3e-04 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 PPP PPP PPP PPP PP P P Sbjct: 1469 PPPPPPPLPPPPPPPLPPPPPLP 1491 Score = 42.3 bits (95), Expect = 0.002 Identities = 17/27 (62%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXP-PXXP 932 LP PPP PPP PPP PPP P P P Sbjct: 1468 LPPPPPPPLPPPPPPPLPPPPPLPKTP 1494 Score = 38.7 bits (86), Expect = 0.030 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPPPXPP-PXPPPXPPPXPPXXPPPP 941 P PPP PP P PPP P P PP P P Sbjct: 1466 PPLPPPPPPPLPPPPPPPLPPPPPLPKTP 1494 >AB007897-1|BAA24826.2| 1605|Homo sapiens KIAA0437 protein. Length = 1605 Score = 49.6 bits (113), Expect = 2e-05 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP PPP PPP PPP PP PPPP Sbjct: 1529 PPLPPPPPPPLPPPPPPPLPPPP 1551 Score = 45.6 bits (103), Expect = 3e-04 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 PPP PPP PPP PPP PP P P Sbjct: 1532 PPPPPPPLPPPPPPPLPPPPPLP 1554 Score = 42.3 bits (95), Expect = 0.002 Identities = 17/27 (62%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXP-PXXP 932 LP PPP PPP PPP PPP P P P Sbjct: 1531 LPPPPPPPLPPPPPPPLPPPPPLPKTP 1557 Score = 38.7 bits (86), Expect = 0.030 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPPPXPP-PXPPPXPPPXPPXXPPPP 941 P PPP PP P PPP P P PP P P Sbjct: 1529 PPLPPPPPPPLPPPPPPPLPPPPPLPKTP 1557 >AL078621-10|CAB81647.1| 232|Homo sapiens protein ( G islands. ).). Length = 232 Score = 49.2 bits (112), Expect = 2e-05 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP P P PP PPPP Sbjct: 157 PPPSPPPPPPPPPSPLPPPPPPPP 180 Score = 46.0 bits (104), Expect = 2e-04 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P R L P P P P P PPP PPP P PPPP Sbjct: 142 PPRPLPPRPPAAQPRPPPSPPPPPPPPPSPLPPPPPP 178 Score = 44.4 bits (100), Expect = 6e-04 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP PPP P P PPP PP P P Sbjct: 157 PPPSPPPPPPPPPSPLPPPPPPPPPTP 183 Score = 43.6 bits (98), Expect = 0.001 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P PPP PPP P P PP PPP Sbjct: 155 PRPPPSPPPPPPPPPSPLPPPPPPPPP 181 Score = 41.9 bits (94), Expect = 0.003 Identities = 18/28 (64%), Positives = 18/28 (64%), Gaps = 4/28 (14%) Frame = +3 Query: 870 PPPXP-PPXPP---PXPPPXPPXXPPPP 941 PPP P PP PP P PPP PP PPPP Sbjct: 141 PPPRPLPPRPPAAQPRPPPSPPPPPPPP 168 Score = 35.5 bits (78), Expect = 0.28 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXT 918 PP P P PP P P P P P PP P P T Sbjct: 142 PPRPLPPRPPAAQPRPPPSPPPPPPPPPSPLPPPPPPPPPT 182 >BC073988-1|AAH73988.1| 682|Homo sapiens FMNL1 protein protein. Length = 682 Score = 48.8 bits (111), Expect = 3e-05 Identities = 20/32 (62%), Positives = 20/32 (62%), Gaps = 3/32 (9%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPP---XPPPXPPXXPPPP 941 LPG PPP PPP PPP P P PP PPPP Sbjct: 162 LPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPP 193 Score = 42.3 bits (95), Expect = 0.002 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 LPG PP PP P PPP PP PPP Sbjct: 150 LPGSPEPPPAPPLPGDLPPPPPPPPPPP 177 Score = 41.9 bits (94), Expect = 0.003 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 5/41 (12%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPX-----PPPXPPPXPPXXPPP 938 P L LP PPP PPP PPP PPP PP PP Sbjct: 158 PAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGPP 198 Score = 36.3 bits (80), Expect = 0.16 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 4/32 (12%) Frame = +3 Query: 858 PGXXPPPXPP----PXPPPXPPPXPPXXPPPP 941 PG PPP PP P P PP PP PP P Sbjct: 120 PGAAPPPPPPLPGLPSPQEAPPSAPPQAPPLP 151 Score = 35.9 bits (79), Expect = 0.21 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 9/37 (24%) Frame = +3 Query: 858 PGXXPPPXPP----PXPPPXPP-----PXPPXXPPPP 941 P PP PP P PPP PP P PP PPPP Sbjct: 140 PPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPP 176 Score = 35.5 bits (78), Expect = 0.28 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LPG P PP PP PP P PPP Sbjct: 130 LPGLPSPQEAPPSAPPQAPPLPGSPEPPP 158 Score = 34.3 bits (75), Expect = 0.65 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 7/35 (20%) Frame = +3 Query: 858 PGXXPPPXPPPXPP----PXPPPXPPX---XPPPP 941 P PP PP PP P PPP PP PPPP Sbjct: 136 PQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPP 170 Score = 34.3 bits (75), Expect = 0.65 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +1 Query: 796 PPSPPXPX--PPXXXXXPSPXFSLXXXPXPXPXXPPXPXXP 912 PP+PP P PP P P + P P P PP P P Sbjct: 157 PPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGP 197 Score = 31.5 bits (68), Expect = 4.6 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P +PP P P P P P P P PP P PPP Sbjct: 145 PQAPPLPGSPEPPPAP-PLPGDLPPPPPPPPPPPGTDGPVPPPPPPP 190 Score = 30.7 bits (66), Expect = 8.0 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PPS P PP P P P PP P PPP Sbjct: 140 PPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPPPGTDGPVPPP 186 >AY278319-1|AAP32476.1| 1100|Homo sapiens leukocyte formin protein. Length = 1100 Score = 48.8 bits (111), Expect = 3e-05 Identities = 20/32 (62%), Positives = 20/32 (62%), Gaps = 3/32 (9%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPP---XPPPXPPXXPPPP 941 LPG PPP PPP PPP P P PP PPPP Sbjct: 580 LPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPP 611 Score = 42.3 bits (95), Expect = 0.002 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 LPG PP PP P PPP PP PPP Sbjct: 568 LPGSPEPPPAPPLPGDLPPPPPPPPPPP 595 Score = 41.9 bits (94), Expect = 0.003 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 5/41 (12%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPX-----PPPXPPPXPPXXPPP 938 P L LP PPP PPP PPP PPP PP PP Sbjct: 576 PAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGPP 616 Score = 36.3 bits (80), Expect = 0.16 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 4/32 (12%) Frame = +3 Query: 858 PGXXPPPXPP----PXPPPXPPPXPPXXPPPP 941 PG PPP PP P P PP PP PP P Sbjct: 538 PGAAPPPPPPLPGLPSPQEAPPSAPPQAPPLP 569 Score = 35.9 bits (79), Expect = 0.21 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 9/37 (24%) Frame = +3 Query: 858 PGXXPPPXPP----PXPPPXPP-----PXPPXXPPPP 941 P PP PP P PPP PP P PP PPPP Sbjct: 558 PPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPP 594 Score = 35.5 bits (78), Expect = 0.28 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LPG P PP PP PP P PPP Sbjct: 548 LPGLPSPQEAPPSAPPQAPPLPGSPEPPP 576 Score = 34.3 bits (75), Expect = 0.65 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 7/35 (20%) Frame = +3 Query: 858 PGXXPPPXPPPXPP----PXPPPXPPX---XPPPP 941 P PP PP PP P PPP PP PPPP Sbjct: 554 PQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPP 588 Score = 34.3 bits (75), Expect = 0.65 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +1 Query: 796 PPSPPXPX--PPXXXXXPSPXFSLXXXPXPXPXXPPXPXXP 912 PP+PP P PP P P + P P P PP P P Sbjct: 575 PPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGP 615 Score = 31.5 bits (68), Expect = 4.6 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P +PP P P P P P P P PP P PPP Sbjct: 563 PQAPPLPGSPEPPPAP-PLPGDLPPPPPPPPPPPGTDGPVPPPPPPP 608 Score = 30.7 bits (66), Expect = 8.0 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 1/48 (2%) Frame = +1 Query: 796 PPSPPXPXPPXXXXX-PSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PPS P PP P P L P P PP P PPP Sbjct: 558 PPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPPPGTDGPVPPPP 605 >AF432213-1|AAL99920.1| 991|Homo sapiens CLL-associated antigen KW-13 protein. Length = 991 Score = 48.8 bits (111), Expect = 3e-05 Identities = 20/32 (62%), Positives = 20/32 (62%), Gaps = 3/32 (9%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPP---XPPPXPPXXPPPP 941 LPG PPP PPP PPP P P PP PPPP Sbjct: 471 LPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPP 502 Score = 42.3 bits (95), Expect = 0.002 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 LPG PP PP P PPP PP PPP Sbjct: 459 LPGSPEPPPAPPLPGDLPPPPPPPPPPP 486 Score = 41.9 bits (94), Expect = 0.003 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 5/41 (12%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPX-----PPPXPPPXPPXXPPP 938 P L LP PPP PPP PPP PPP PP PP Sbjct: 467 PAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGPP 507 Score = 36.3 bits (80), Expect = 0.16 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 4/32 (12%) Frame = +3 Query: 858 PGXXPPPXPP----PXPPPXPPPXPPXXPPPP 941 PG PPP PP P P PP PP PP P Sbjct: 429 PGAAPPPPPPLPGLPSPQEAPPSAPPQAPPLP 460 Score = 35.9 bits (79), Expect = 0.21 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 9/37 (24%) Frame = +3 Query: 858 PGXXPPPXPP----PXPPPXPP-----PXPPXXPPPP 941 P PP PP P PPP PP P PP PPPP Sbjct: 449 PPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPP 485 Score = 35.5 bits (78), Expect = 0.28 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LPG P PP PP PP P PPP Sbjct: 439 LPGLPSPQEAPPSAPPQAPPLPGSPEPPP 467 Score = 34.3 bits (75), Expect = 0.65 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 7/35 (20%) Frame = +3 Query: 858 PGXXPPPXPPPXPP----PXPPPXPPX---XPPPP 941 P PP PP PP P PPP PP PPPP Sbjct: 445 PQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPP 479 Score = 34.3 bits (75), Expect = 0.65 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +1 Query: 796 PPSPPXPX--PPXXXXXPSPXFSLXXXPXPXPXXPPXPXXP 912 PP+PP P PP P P + P P P PP P P Sbjct: 466 PPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGP 506 Score = 31.5 bits (68), Expect = 4.6 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P +PP P P P P P P P PP P PPP Sbjct: 454 PQAPPLPGSPEPPPAP-PLPGDLPPPPPPPPPPPGTDGPVPPPPPPP 499 Score = 30.7 bits (66), Expect = 8.0 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PPS P PP P P P PP P PPP Sbjct: 449 PPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPPPGTDGPVPPP 495 >X66188-1|CAA46956.1| 421|Homo sapiens proacrosin protein. Length = 421 Score = 48.4 bits (110), Expect = 4e-05 Identities = 21/39 (53%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPP--PXPPXXPPPP 941 P R L P PPP P P PPP PP P PP PPPP Sbjct: 331 PPRPLPPRPPAAQPPPPPSPPPPPPPPASPLPPPPPPPP 369 Score = 41.9 bits (94), Expect = 0.003 Identities = 18/28 (64%), Positives = 18/28 (64%), Gaps = 4/28 (14%) Frame = +3 Query: 870 PPPXP-PPXPP---PXPPPXPPXXPPPP 941 PPP P PP PP P PPP PP PPPP Sbjct: 330 PPPRPLPPRPPAAQPPPPPSPPPPPPPP 357 Score = 41.1 bits (92), Expect = 0.006 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP PPP P PPP PP P P Sbjct: 346 PPPSPPPPPPPPASPLPPPPPPPPPTP 372 Score = 32.3 bits (70), Expect = 2.6 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXT 918 PP P P PP P P P P PP P P T Sbjct: 331 PPRPLPPRPPAAQPPPPPSPPPPPPPPASPLPPPPPPPPPT 371 Score = 31.9 bits (69), Expect = 3.5 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXP 930 PP PP PP P P P P P PP P T P Sbjct: 336 PPRPPAAQPPPPPSPPPPP-PPPASPLPPPPPPPPPTPSSTTKLP 379 >X54017-1|CAA37964.1| 421|Homo sapiens preproacrosin protein. Length = 421 Score = 48.4 bits (110), Expect = 4e-05 Identities = 21/39 (53%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPP--PXPPXXPPPP 941 P R L P PPP P P PPP PP P PP PPPP Sbjct: 331 PPRPLPPRPPAAQPPPPPSPPPPPPPPASPLPPPPPPPP 369 Score = 41.9 bits (94), Expect = 0.003 Identities = 18/28 (64%), Positives = 18/28 (64%), Gaps = 4/28 (14%) Frame = +3 Query: 870 PPPXP-PPXPP---PXPPPXPPXXPPPP 941 PPP P PP PP P PPP PP PPPP Sbjct: 330 PPPRPLPPRPPAAQPPPPPSPPPPPPPP 357 Score = 41.1 bits (92), Expect = 0.006 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP PPP P PPP PP P P Sbjct: 346 PPPSPPPPPPPPASPLPPPPPPPPPTP 372 Score = 32.3 bits (70), Expect = 2.6 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXT 918 PP P P PP P P P P PP P P T Sbjct: 331 PPRPLPPRPPAAQPPPPPSPPPPPPPPASPLPPPPPPPPPT 371 Score = 31.9 bits (69), Expect = 3.5 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXP 930 PP PP PP P P P P P PP P T P Sbjct: 336 PPRPPAAQPPPPPSPPPPP-PPPASPLPPPPPPPPPTPSSTTKLP 379 >M77381-1|AAA51575.1| 184|Homo sapiens acrosin protein. Length = 184 Score = 48.4 bits (110), Expect = 4e-05 Identities = 21/39 (53%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPP--PXPPXXPPPP 941 P R L P PPP P P PPP PP P PP PPPP Sbjct: 94 PPRPLPPRPPAAQPPPPPSPPPPPPPPASPLPPPPPPPP 132 Score = 41.9 bits (94), Expect = 0.003 Identities = 18/28 (64%), Positives = 18/28 (64%), Gaps = 4/28 (14%) Frame = +3 Query: 870 PPPXP-PPXPP---PXPPPXPPXXPPPP 941 PPP P PP PP P PPP PP PPPP Sbjct: 93 PPPRPLPPRPPAAQPPPPPSPPPPPPPP 120 Score = 41.1 bits (92), Expect = 0.006 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP PPP P PPP PP P P Sbjct: 109 PPPSPPPPPPPPASPLPPPPPPPPPTP 135 Score = 32.3 bits (70), Expect = 2.6 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXT 918 PP P P PP P P P P PP P P T Sbjct: 94 PPRPLPPRPPAAQPPPPPSPPPPPPPPASPLPPPPPPPPPT 134 Score = 31.9 bits (69), Expect = 3.5 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXP 930 PP PP PP P P P P P PP P T P Sbjct: 99 PPRPPAAQPPPPPSPPPPP-PPPASPLPPPPPPPPPTPSSTTKLP 142 >DQ854815-1|ABI75145.1| 112|Homo sapiens hyperpolarization-activated cyclic nucleotide-gated potassium channel 2 protein. Length = 112 Score = 47.2 bits (107), Expect = 9e-05 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG P P PPP PPP PP P PPPP Sbjct: 14 PGATPAPGPPPPPPPAPPQQQPPPPPPP 41 Score = 44.8 bits (101), Expect = 5e-04 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PP PP PP PPP Sbjct: 18 PAPGPPPPPPPAPPQQQPPPPPPPAPPP 45 Score = 44.4 bits (100), Expect = 6e-04 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P PPP PPP PPP P P PP PP Sbjct: 31 PQQQPPPPPPPAPPPGPGPAPPQHPP 56 Score = 43.6 bits (98), Expect = 0.001 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG P P P PPP PPP PP PPP Sbjct: 10 PGESPGATPAPGPPPPPPPAPPQQQPPP 37 Score = 38.7 bits (86), Expect = 0.030 Identities = 19/37 (51%), Positives = 19/37 (51%), Gaps = 9/37 (24%) Frame = +3 Query: 858 PGXXPPPXP-------PPXPPPXPPPXPPXXPP--PP 941 PG PPP P PP PPP PPP P PP PP Sbjct: 20 PGPPPPPPPAPPQQQPPPPPPPAPPPGPGPAPPQHPP 56 Score = 32.3 bits (70), Expect = 2.6 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPP 933 PP PP P PP P P P P P P P PP Sbjct: 22 PPPPPPPAPPQQQPPPPP----PPAPPPGPGPAPPQHPPRAEALPP 63 Score = 31.5 bits (68), Expect = 4.6 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPP 935 G P P P P PPP PP PP Sbjct: 7 GGRPGESPGATPAPGPPPPPPPAPP 31 >AJ133727-1|CAB42630.1| 889|Homo sapiens hyperpolarization-activated cyclic nucleotide-gated channel hHCN2 protein. Length = 889 Score = 47.2 bits (107), Expect = 9e-05 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG P P PPP PPP PP P PPPP Sbjct: 14 PGATPAPGPPPPPPPAPPQQQPPPPPPP 41 Score = 44.8 bits (101), Expect = 5e-04 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PP PP PP PPP Sbjct: 18 PAPGPPPPPPPAPPQQQPPPPPPPAPPP 45 Score = 44.4 bits (100), Expect = 6e-04 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P PPP PPP PPP P P PP PP Sbjct: 31 PQQQPPPPPPPAPPPGPGPAPPQHPP 56 Score = 43.6 bits (98), Expect = 0.001 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG P P P PPP PPP PP PPP Sbjct: 10 PGESPGATPAPGPPPPPPPAPPQQQPPP 37 Score = 38.7 bits (86), Expect = 0.030 Identities = 19/37 (51%), Positives = 19/37 (51%), Gaps = 9/37 (24%) Frame = +3 Query: 858 PGXXPPPXP-------PPXPPPXPPPXPPXXPP--PP 941 PG PPP P PP PPP PPP P PP PP Sbjct: 20 PGPPPPPPPAPPQQQPPPPPPPAPPPGPGPAPPQHPP 56 Score = 32.3 bits (70), Expect = 2.6 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPP 933 PP PP P PP P P P P P P P PP Sbjct: 22 PPPPPPPAPPQQQPPPPP----PPAPPPGPGPAPPQHPPRAEALPP 63 Score = 31.5 bits (68), Expect = 4.6 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPP 935 G P P P P PPP PP PP Sbjct: 7 GGRPGESPGATPAPGPPPPPPPAPP 31 Score = 29.9 bits (64), Expect(2) = 1.2 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%) Frame = +3 Query: 870 PPPXPPP---XPPPXPPPXPPXXPPPP 941 PPP P P P P PP PP P P Sbjct: 761 PPPGPAPAAASPGPPPPASPPGAPASP 787 Score = 22.2 bits (45), Expect(2) = 1.2 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 861 GXXPPPXPPP 890 G PPP PPP Sbjct: 712 GLFPPPPPPP 721 >AJ012582-1|CAB42602.1| 889|Homo sapiens hyperpolarization-activated cation channel HCN2 protein. Length = 889 Score = 47.2 bits (107), Expect = 9e-05 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG P P PPP PPP PP P PPPP Sbjct: 14 PGATPAPGPPPPPPPAPPQQQPPPPPPP 41 Score = 44.8 bits (101), Expect = 5e-04 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PP PP PP PPP Sbjct: 18 PAPGPPPPPPPAPPQQQPPPPPPPAPPP 45 Score = 44.4 bits (100), Expect = 6e-04 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P PPP PPP PPP P P PP PP Sbjct: 31 PQQQPPPPPPPAPPPGPGPAPPQHPP 56 Score = 43.6 bits (98), Expect = 0.001 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG P P P PPP PPP PP PPP Sbjct: 10 PGESPGATPAPGPPPPPPPAPPQQQPPP 37 Score = 38.7 bits (86), Expect = 0.030 Identities = 19/37 (51%), Positives = 19/37 (51%), Gaps = 9/37 (24%) Frame = +3 Query: 858 PGXXPPPXP-------PPXPPPXPPPXPPXXPP--PP 941 PG PPP P PP PPP PPP P PP PP Sbjct: 20 PGPPPPPPPAPPQQQPPPPPPPAPPPGPGPAPPQHPP 56 Score = 32.3 bits (70), Expect = 2.6 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPP 933 PP PP P PP P P P P P P P PP Sbjct: 22 PPPPPPPAPPQQQPPPPP----PPAPPPGPGPAPPQHPPRAEALPP 63 Score = 31.5 bits (68), Expect = 4.6 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPP 935 G P P P P PPP PP PP Sbjct: 7 GGRPGESPGATPAPGPPPPPPPAPP 31 Score = 29.9 bits (64), Expect(2) = 1.2 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%) Frame = +3 Query: 870 PPPXPPP---XPPPXPPPXPPXXPPPP 941 PPP P P P P PP PP P P Sbjct: 761 PPPGPAPAAASPGPPPPASPPGAPASP 787 Score = 22.2 bits (45), Expect(2) = 1.2 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 861 GXXPPPXPPP 890 G PPP PPP Sbjct: 712 GLFPPPPPPP 721 >AC005559-2|AAC33280.2| 528|Homo sapiens hyperpolarization activated cyclic nucleotide-gated potassium channel 2 protein. Length = 528 Score = 47.2 bits (107), Expect = 9e-05 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG P P PPP PPP PP P PPPP Sbjct: 14 PGATPAPGPPPPPPPAPPQQQPPPPPPP 41 Score = 44.8 bits (101), Expect = 5e-04 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PP PP PP PPP Sbjct: 18 PAPGPPPPPPPAPPQQQPPPPPPPAPPP 45 Score = 44.4 bits (100), Expect = 6e-04 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P PPP PPP PPP P P PP PP Sbjct: 31 PQQQPPPPPPPAPPPGPGPAPPQHPP 56 Score = 43.6 bits (98), Expect = 0.001 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG P P P PPP PPP PP PPP Sbjct: 10 PGESPGATPAPGPPPPPPPAPPQQQPPP 37 Score = 38.7 bits (86), Expect = 0.030 Identities = 19/37 (51%), Positives = 19/37 (51%), Gaps = 9/37 (24%) Frame = +3 Query: 858 PGXXPPPXP-------PPXPPPXPPPXPPXXPP--PP 941 PG PPP P PP PPP PPP P PP PP Sbjct: 20 PGPPPPPPPAPPQQQPPPPPPPAPPPGPGPAPPQHPP 56 Score = 32.3 bits (70), Expect = 2.6 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPP 933 PP PP P PP P P P P P P P PP Sbjct: 22 PPPPPPPAPPQQQPPPPP----PPAPPPGPGPAPPQHPPRAEALPP 63 Score = 31.5 bits (68), Expect = 4.6 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPP 935 G P P P P PPP PP PP Sbjct: 7 GGRPGESPGATPAPGPPPPPPPAPP 31 >U16371-1|AAB60346.1| 31|Homo sapiens androgen receptor protein. Length = 31 Score = 46.4 bits (105), Expect = 2e-04 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG GGG G Sbjct: 4 GGGGGGGGGGGGGGGGGGGGGGGGGEAG 31 Score = 38.7 bits (86), Expect = 0.030 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GGG GGG GGG G Sbjct: 1 GPCGGGGGGGGGGGGGGGGGGGGGG 25 Score = 37.9 bits (84), Expect = 0.053 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GGG GGG GGG G Sbjct: 1 GPCGGGGGGGGGGGGGGGGGGGGGGG 26 >Y00970-1|CAA68784.1| 421|Homo sapiens protein ( Human mRNA for acrosin (EC 3.4.21.10). ). Length = 421 Score = 46.0 bits (104), Expect = 2e-04 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP P PP PPPP Sbjct: 346 PPPSPPPPPPPPASPLPPPPPPPP 369 Score = 41.9 bits (94), Expect = 0.003 Identities = 18/28 (64%), Positives = 18/28 (64%), Gaps = 4/28 (14%) Frame = +3 Query: 870 PPPXP-PPXPP---PXPPPXPPXXPPPP 941 PPP P PP PP P PPP PP PPPP Sbjct: 330 PPPRPLPPRPPAAQPRPPPSPPPPPPPP 357 Score = 41.9 bits (94), Expect = 0.003 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PP PPP PPP P PP PPPP Sbjct: 347 PPSPPPPPPPPASPLPPPPPPPPP 370 Score = 41.1 bits (92), Expect = 0.006 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP PPP P PPP PP P P Sbjct: 346 PPPSPPPPPPPPASPLPPPPPPPPPTP 372 Score = 40.3 bits (90), Expect = 0.010 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P PPP PP P P PP PPP Sbjct: 344 PRPPPSPPPPPPPPASPLPPPPPPPPP 370 Score = 32.3 bits (70), Expect = 2.6 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXT 918 PP P P PP P P P P PP P P T Sbjct: 331 PPRPLPPRPPAAQPRPPPSPPPPPPPPASPLPPPPPPPPPT 371 >D88460-1|BAA20128.1| 505|Homo sapiens N-WASP protein. Length = 505 Score = 46.0 bits (104), Expect = 2e-04 Identities = 24/66 (36%), Positives = 25/66 (37%), Gaps = 6/66 (9%) Frame = +3 Query: 762 PPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXP------PPXPPPXPPPXPP 923 PP P R P +L P PPP P P PPP PPP PP Sbjct: 323 PPPPPSRPSVEVPPPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPP 382 Query: 924 XXPPPP 941 PPPP Sbjct: 383 PGPPPP 388 Score = 40.7 bits (91), Expect = 0.008 Identities = 19/57 (33%), Positives = 22/57 (38%) Frame = +3 Query: 762 PPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXP 932 PP P + + P S + G PP PPP PPP PP PP P Sbjct: 336 PPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLP 392 Score = 36.7 bits (81), Expect = 0.12 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 2/26 (7%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPP--XXPPPP 941 PPP PP P PPP PP PPPP Sbjct: 277 PPPPPPSRGGPPPPPPPPHSSGPPPP 302 Score = 35.5 bits (78), Expect = 0.28 Identities = 22/68 (32%), Positives = 23/68 (33%), Gaps = 2/68 (2%) Frame = +3 Query: 744 GSXPXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPPXPP 923 G P PP P P R+ P PPP PP P PP PP Sbjct: 285 GGPPPPPPPPHSSGPPPPPARGRGAPPPPPSRA-----PTAAPPPPPPSRPSVEVPPPPP 339 Query: 924 --XXPPPP 941 PPPP Sbjct: 340 NRMYPPPP 347 Score = 33.5 bits (73), Expect = 1.1 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 4/32 (12%) Frame = +3 Query: 858 PGXXPPPXPPPXP----PPXPPPXPPXXPPPP 941 P PP PPP P PP PP PPPP Sbjct: 282 PSRGGPPPPPPPPHSSGPPPPPARGRGAPPPP 313 >CR456366-1|CAG30252.1| 421|Homo sapiens ACR protein. Length = 421 Score = 46.0 bits (104), Expect = 2e-04 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP P PP PPPP Sbjct: 346 PPPSPPPPPPPPASPLPPPPPPPP 369 Score = 41.9 bits (94), Expect = 0.003 Identities = 18/28 (64%), Positives = 18/28 (64%), Gaps = 4/28 (14%) Frame = +3 Query: 870 PPPXP-PPXPP---PXPPPXPPXXPPPP 941 PPP P PP PP P PPP PP PPPP Sbjct: 330 PPPRPLPPRPPAAQPRPPPSPPPPPPPP 357 Score = 41.9 bits (94), Expect = 0.003 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PP PPP PPP P PP PPPP Sbjct: 347 PPSPPPPPPPPASPLPPPPPPPPP 370 Score = 41.1 bits (92), Expect = 0.006 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP PPP P PPP PP P P Sbjct: 346 PPPSPPPPPPPPASPLPPPPPPPPPTP 372 Score = 40.3 bits (90), Expect = 0.010 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P PPP PP P P PP PPP Sbjct: 344 PRPPPSPPPPPPPPASPLPPPPPPPPP 370 Score = 32.3 bits (70), Expect = 2.6 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXT 918 PP P P PP P P P P PP P P T Sbjct: 331 PPRPLPPRPPAAQPRPPPSPPPPPPPPASPLPPPPPPPPPT 371 >BC064999-1|AAH64999.1| 1068|Homo sapiens DAAM1 protein protein. Length = 1068 Score = 46.0 bits (104), Expect = 2e-04 Identities = 20/34 (58%), Positives = 21/34 (61%), Gaps = 5/34 (14%) Frame = +3 Query: 855 LPGXX-PPPXPPPXP----PPXPPPXPPXXPPPP 941 +PG PPP PPP P PP PPP PP PPPP Sbjct: 544 VPGSLLPPPPPPPLPGGMLPPPPPPLPPGGPPPP 577 Score = 41.5 bits (93), Expect = 0.004 Identities = 18/34 (52%), Positives = 19/34 (55%), Gaps = 4/34 (11%) Frame = +3 Query: 852 VLPGXXPPPXP----PPXPPPXPPPXPPXXPPPP 941 +LP PPP P PP PPP PP PP P PP Sbjct: 548 LLPPPPPPPLPGGMLPPPPPPLPPGGPPPPPGPP 581 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPP 935 LPG PP PPP PP PPP PP PP Sbjct: 557 LPGGMLPPPPPPLPPGGPPP-PPGPPP 582 Score = 37.5 bits (83), Expect = 0.070 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 2/25 (8%) Frame = +3 Query: 870 PPPXPP--PXPPPXPPPXPPXXPPP 938 PPP PP P PPP PPP PPP Sbjct: 566 PPPLPPGGPPPPPGPPPLGAIMPPP 590 >BC052955-1|AAH52955.1| 505|Homo sapiens Wiskott-Aldrich syndrome-like protein. Length = 505 Score = 46.0 bits (104), Expect = 2e-04 Identities = 24/66 (36%), Positives = 25/66 (37%), Gaps = 6/66 (9%) Frame = +3 Query: 762 PPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXP------PPXPPPXPPPXPP 923 PP P R P +L P PPP P P PPP PPP PP Sbjct: 323 PPPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPP 382 Query: 924 XXPPPP 941 PPPP Sbjct: 383 PGPPPP 388 Score = 40.7 bits (91), Expect = 0.008 Identities = 19/57 (33%), Positives = 22/57 (38%) Frame = +3 Query: 762 PPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXP 932 PP P + + P S + G PP PPP PPP PP PP P Sbjct: 336 PPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLP 392 Score = 36.7 bits (81), Expect = 0.12 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 2/26 (7%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPP--XXPPPP 941 PPP PP P PPP PP PPPP Sbjct: 277 PPPPPPSRGGPPPPPPPPHNSGPPPP 302 Score = 35.5 bits (78), Expect = 0.28 Identities = 22/68 (32%), Positives = 23/68 (33%), Gaps = 2/68 (2%) Frame = +3 Query: 744 GSXPXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPPXPP 923 G P PP P P R+ P PPP PP P PP PP Sbjct: 285 GGPPPPPPPPHNSGPPPPPARGRGAPPPPPSRA-----PTAAPPPPPPSRPSVAVPPPPP 339 Query: 924 --XXPPPP 941 PPPP Sbjct: 340 NRMYPPPP 347 Score = 33.5 bits (73), Expect = 1.1 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 4/32 (12%) Frame = +3 Query: 858 PGXXPPPXPPPXP----PPXPPPXPPXXPPPP 941 P PP PPP P PP PP PPPP Sbjct: 282 PSRGGPPPPPPPPHNSGPPPPPARGRGAPPPP 313 >BC038428-1|AAH38428.1| 1068|Homo sapiens DAAM1 protein protein. Length = 1068 Score = 46.0 bits (104), Expect = 2e-04 Identities = 20/34 (58%), Positives = 21/34 (61%), Gaps = 5/34 (14%) Frame = +3 Query: 855 LPGXX-PPPXPPPXP----PPXPPPXPPXXPPPP 941 +PG PPP PPP P PP PPP PP PPPP Sbjct: 544 VPGSLLPPPPPPPLPGGMLPPPPPPLPPGGPPPP 577 Score = 41.5 bits (93), Expect = 0.004 Identities = 18/34 (52%), Positives = 19/34 (55%), Gaps = 4/34 (11%) Frame = +3 Query: 852 VLPGXXPPPXP----PPXPPPXPPPXPPXXPPPP 941 +LP PPP P PP PPP PP PP P PP Sbjct: 548 LLPPPPPPPLPGGMLPPPPPPLPPGGPPPPPGPP 581 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPP 935 LPG PP PPP PP PPP PP PP Sbjct: 557 LPGGMLPPPPPPLPPGGPPP-PPGPPP 582 Score = 37.5 bits (83), Expect = 0.070 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 2/25 (8%) Frame = +3 Query: 870 PPPXPP--PXPPPXPPPXPPXXPPP 938 PPP PP P PPP PPP PPP Sbjct: 566 PPPLPPGGPPPPPGPPPLGAIMPPP 590 >BC024781-1|AAH24781.1| 662|Homo sapiens Similar to dishevelled associated activator of morphogenesis 2 protein. Length = 662 Score = 46.0 bits (104), Expect = 2e-04 Identities = 20/34 (58%), Positives = 21/34 (61%), Gaps = 5/34 (14%) Frame = +3 Query: 855 LPGXX-PPPXPPPXP----PPXPPPXPPXXPPPP 941 +PG PPP PPP P PP PPP PP PPPP Sbjct: 138 VPGSLLPPPPPPPLPGGMLPPPPPPLPPGGPPPP 171 Score = 41.5 bits (93), Expect = 0.004 Identities = 18/34 (52%), Positives = 19/34 (55%), Gaps = 4/34 (11%) Frame = +3 Query: 852 VLPGXXPPPXP----PPXPPPXPPPXPPXXPPPP 941 +LP PPP P PP PPP PP PP P PP Sbjct: 142 LLPPPPPPPLPGGMLPPPPPPLPPGGPPPPPGPP 175 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPP 935 LPG PP PPP PP PPP PP PP Sbjct: 151 LPGGMLPPPPPPLPPGGPPP-PPGPPP 176 Score = 37.5 bits (83), Expect = 0.070 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 2/25 (8%) Frame = +3 Query: 870 PPPXPP--PXPPPXPPPXPPXXPPP 938 PPP PP P PPP PPP PPP Sbjct: 160 PPPLPPGGPPPPPGPPPLGAIMPPP 184 >AC006333-1|AAQ96857.1| 505|Homo sapiens unknown protein. Length = 505 Score = 46.0 bits (104), Expect = 2e-04 Identities = 24/66 (36%), Positives = 25/66 (37%), Gaps = 6/66 (9%) Frame = +3 Query: 762 PPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXP------PPXPPPXPPPXPP 923 PP P R P +L P PPP P P PPP PPP PP Sbjct: 323 PPPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPP 382 Query: 924 XXPPPP 941 PPPP Sbjct: 383 PGPPPP 388 Score = 40.7 bits (91), Expect = 0.008 Identities = 19/57 (33%), Positives = 22/57 (38%) Frame = +3 Query: 762 PPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXP 932 PP P + + P S + G PP PPP PPP PP PP P Sbjct: 336 PPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLP 392 Score = 36.7 bits (81), Expect = 0.12 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 2/26 (7%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPP--XXPPPP 941 PPP PP P PPP PP PPPP Sbjct: 277 PPPPPPSRGGPPPPPPPPHNSGPPPP 302 Score = 35.5 bits (78), Expect = 0.28 Identities = 22/68 (32%), Positives = 23/68 (33%), Gaps = 2/68 (2%) Frame = +3 Query: 744 GSXPXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPPXPP 923 G P PP P P R+ P PPP PP P PP PP Sbjct: 285 GGPPPPPPPPHNSGPPPPPARGRGAPPPPPSRA-----PTAAPPPPPPSRPSVAVPPPPP 339 Query: 924 --XXPPPP 941 PPPP Sbjct: 340 NRMYPPPP 347 Score = 33.5 bits (73), Expect = 1.1 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 4/32 (12%) Frame = +3 Query: 858 PGXXPPPXPPPXP----PPXPPPXPPXXPPPP 941 P PP PPP P PP PP PPPP Sbjct: 282 PSRGGPPPPPPPPHNSGPPPPPARGRGAPPPP 313 >AB014566-1|BAA31641.1| 1085|Homo sapiens KIAA0666 protein protein. Length = 1085 Score = 46.0 bits (104), Expect = 2e-04 Identities = 20/34 (58%), Positives = 21/34 (61%), Gaps = 5/34 (14%) Frame = +3 Query: 855 LPGXX-PPPXPPPXP----PPXPPPXPPXXPPPP 941 +PG PPP PPP P PP PPP PP PPPP Sbjct: 551 VPGSLLPPPPPPPLPGGMLPPPPPPLPPGGPPPP 584 Score = 41.5 bits (93), Expect = 0.004 Identities = 18/34 (52%), Positives = 19/34 (55%), Gaps = 4/34 (11%) Frame = +3 Query: 852 VLPGXXPPPXP----PPXPPPXPPPXPPXXPPPP 941 +LP PPP P PP PPP PP PP P PP Sbjct: 555 LLPPPPPPPLPGGMLPPPPPPLPPGGPPPPPGPP 588 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPP 935 LPG PP PPP PP PPP PP PP Sbjct: 564 LPGGMLPPPPPPLPPGGPPP-PPGPPP 589 Score = 37.5 bits (83), Expect = 0.070 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 2/25 (8%) Frame = +3 Query: 870 PPPXPP--PXPPPXPPPXPPXXPPP 938 PPP PP P PPP PPP PPP Sbjct: 573 PPPLPPGGPPPPPGPPPLGAIMPPP 597 >BC008829-1|AAH08829.1| 355|Homo sapiens SHOX2 protein protein. Length = 355 Score = 45.6 bits (103), Expect = 3e-04 Identities = 20/33 (60%), Positives = 21/33 (63%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXER 842 GGGG GG GGG GG GGG GGG GR+ R Sbjct: 63 GGGGGGGGGGGGGGGVGGGGAGGGAGGGRSPVR 95 Score = 41.5 bits (93), Expect = 0.004 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG GGG G Sbjct: 60 GGGG--GGGGGGGGGGGGGGVGGGGAGG 85 Score = 39.9 bits (89), Expect = 0.013 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GG GGG G Sbjct: 60 GGGGGGGGGGGGGGGGGGVGGGGAGGG 86 >AM295156-1|CAL26602.1| 505|Homo sapiens WASL protein protein. Length = 505 Score = 45.6 bits (103), Expect = 3e-04 Identities = 24/66 (36%), Positives = 25/66 (37%), Gaps = 6/66 (9%) Frame = +3 Query: 762 PPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXP------PPXPPPXPPPXPP 923 PP P R P +L P PPP P P PPP PPP PP Sbjct: 323 PPPPPSRPSVAVPPPPPNRMYPPPPPALLSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPP 382 Query: 924 XXPPPP 941 PPPP Sbjct: 383 PGPPPP 388 Score = 40.7 bits (91), Expect = 0.008 Identities = 19/57 (33%), Positives = 22/57 (38%) Frame = +3 Query: 762 PPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXP 932 PP P + + P S + G PP PPP PPP PP PP P Sbjct: 336 PPPPNRMYPPPPPALLSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLP 392 Score = 38.7 bits (86), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPP 938 P PPP PPP PPP PP PPP Sbjct: 370 PVAPPPPPPPPPPPGPP--PPP 389 Score = 36.7 bits (81), Expect = 0.12 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 2/26 (7%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPP--XXPPPP 941 PPP PP P PPP PP PPPP Sbjct: 277 PPPPPPSRGGPPPPPPPPHNSGPPPP 302 Score = 35.5 bits (78), Expect = 0.28 Identities = 22/68 (32%), Positives = 23/68 (33%), Gaps = 2/68 (2%) Frame = +3 Query: 744 GSXPXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPPXPP 923 G P PP P P R+ P PPP PP P PP PP Sbjct: 285 GGPPPPPPPPHNSGPPPPPARGRGAPPPPPSRA-----PTAAPPPPPPSRPSVAVPPPPP 339 Query: 924 --XXPPPP 941 PPPP Sbjct: 340 NRMYPPPP 347 Score = 33.5 bits (73), Expect = 1.1 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 4/32 (12%) Frame = +3 Query: 858 PGXXPPPXPPPXP----PPXPPPXPPXXPPPP 941 P PP PPP P PP PP PPPP Sbjct: 282 PSRGGPPPPPPPPHNSGPPPPPARGRGAPPPP 313 >AB058759-1|BAB47485.1| 1134|Homo sapiens KIAA1856 protein protein. Length = 1134 Score = 45.6 bits (103), Expect = 3e-04 Identities = 20/36 (55%), Positives = 20/36 (55%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P L LP PPP P P PPP PPP PP PPP Sbjct: 973 PPPPLPLRLPPLPPPPLPRPHPPP-PPPLPPLLPPP 1007 Score = 45.2 bits (102), Expect = 3e-04 Identities = 17/29 (58%), Positives = 17/29 (58%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LP P PPP PPP PP PP PPPP Sbjct: 948 LPSEARAPPPPPPPPPHPPLPPPPLPPPP 976 Score = 41.5 bits (93), Expect = 0.004 Identities = 18/31 (58%), Positives = 18/31 (58%), Gaps = 2/31 (6%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXP--PPP 941 LP PP PPP P P PPP PP P PPP Sbjct: 977 LPLRLPPLPPPPLPRPHPPPPPPLPPLLPPP 1007 Score = 39.1 bits (87), Expect = 0.023 Identities = 17/32 (53%), Positives = 17/32 (53%), Gaps = 5/32 (15%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPP-----XPPXXPPP 938 P PPP PP PPP PPP PP PPP Sbjct: 957 PPPPPPPHPPLPPPPLPPPPLPLRLPPLPPPP 988 Score = 38.7 bits (86), Expect = 0.030 Identities = 18/33 (54%), Positives = 18/33 (54%), Gaps = 5/33 (15%) Frame = +3 Query: 858 PGXXPPPXPPPXPPP--XPPPXP---PXXPPPP 941 P PPP PP PPP PPP P P PPPP Sbjct: 956 PPPPPPPPHPPLPPPPLPPPPLPLRLPPLPPPP 988 Score = 38.3 bits (85), Expect = 0.040 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP P PP PPP P PPPP Sbjct: 970 PPLPPPPLPLRLPPLPPPPLPRPHPPPP 997 Score = 33.1 bits (72), Expect = 1.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +1 Query: 805 PPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP P PP P P P P PP P P PPP Sbjct: 956 PPPPPPPPHPPLPPPPLPPPPLPLRLPPLPP-PPLPRPHPPPPP 998 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 4/28 (14%) Frame = +3 Query: 870 PPPXPPPXPP----PXPPPXPPXXPPPP 941 PPP P P P PPP PP PP P Sbjct: 941 PPPRAPALPSEARAPPPPPPPPPHPPLP 968 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXP 932 LP PPP PPP PP PPP P Sbjct: 989 LPRPHPPP-PPPLPPLLPPPQTRTLP 1013 Score = 31.5 bits (68), Expect = 4.6 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 808 PXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P P PP P P L P P PP P P PPP Sbjct: 955 PPPPPPPPPHPPLPPPPLPPPPLPL-RLPPLPPPPLPRPHPPP 996 >Z96050-3|CAB09424.1| 281|Homo sapiens Fas ligand (TNF superfamily, member 6) protein. Length = 281 Score = 45.2 bits (102), Expect = 3e-04 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PP PPP PP PPP PP PP P Sbjct: 40 PGQRRPPPPPPPPPLPPPPPPPPLPPLP 67 Score = 44.4 bits (100), Expect = 6e-04 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP PPP P P PP Sbjct: 47 PPPPPPPLPPPPPPPPLPPLPLPP 70 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/25 (64%), Positives = 16/25 (64%), Gaps = 2/25 (8%) Frame = +3 Query: 870 PPPXPPP--XPPPXPPPXPPXXPPP 938 PPP PPP PPP PPP PP PP Sbjct: 46 PPPPPPPPLPPPPPPPPLPPLPLPP 70 Score = 35.5 bits (78), Expect = 0.28 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 P P PP PPP PP PPPP Sbjct: 37 PRRPGQRRPPPPPPPPPLPPPPP 59 Score = 35.1 bits (77), Expect = 0.37 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 VLP P P P PPP PP PPPP Sbjct: 29 VLPCPTSVPRRPGQRRPPPPPPPPPLPPPP 58 >X89102-1|CAA61474.1| 281|Homo sapiens Fasligand protein. Length = 281 Score = 45.2 bits (102), Expect = 3e-04 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PP PPP PP PPP PP PP P Sbjct: 40 PGQRRPPPPPPPPPLPPPPPPPPLPPLP 67 Score = 44.4 bits (100), Expect = 6e-04 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP PPP P P PP Sbjct: 47 PPPPPPPLPPPPPPPPLPPLPLPP 70 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/25 (64%), Positives = 16/25 (64%), Gaps = 2/25 (8%) Frame = +3 Query: 870 PPPXPPP--XPPPXPPPXPPXXPPP 938 PPP PPP PPP PPP PP PP Sbjct: 46 PPPPPPPPLPPPPPPPPLPPLPLPP 70 Score = 35.5 bits (78), Expect = 0.28 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 P P PP PPP PP PPPP Sbjct: 37 PRRPGQRRPPPPPPPPPLPPPPP 59 Score = 35.1 bits (77), Expect = 0.37 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 VLP P P P PPP PP PPPP Sbjct: 29 VLPCPTSVPRRPGQRRPPPPPPPPPLPPPP 58 >U11821-1|AAC50124.1| 281|Homo sapiens Fas ligand protein. Length = 281 Score = 45.2 bits (102), Expect = 3e-04 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PP PPP PP PPP PP PP P Sbjct: 40 PGQRRPPPPPPPPPLPPPPPPPPLPPLP 67 Score = 44.4 bits (100), Expect = 6e-04 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP PPP P P PP Sbjct: 47 PPPPPPPLPPPPPPPPLPPLPLPP 70 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/25 (64%), Positives = 16/25 (64%), Gaps = 2/25 (8%) Frame = +3 Query: 870 PPPXPPP--XPPPXPPPXPPXXPPP 938 PPP PPP PPP PPP PP PP Sbjct: 46 PPPPPPPPLPPPPPPPPLPPLPLPP 70 Score = 35.5 bits (78), Expect = 0.28 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 P P PP PPP PP PPPP Sbjct: 37 PRRPGQRRPPPPPPPPPLPPPPP 59 Score = 35.1 bits (77), Expect = 0.37 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 VLP P P P PPP PP PPPP Sbjct: 29 VLPCPTSVPRRPGQRRPPPPPPPPPLPPPP 58 >U08137-1|AAC50071.1| 281|Homo sapiens Fas ligand protein. Length = 281 Score = 45.2 bits (102), Expect = 3e-04 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PP PPP PP PPP PP PP P Sbjct: 40 PGQRRPPPPPPPPPLPPPPPPPPLPPLP 67 Score = 44.4 bits (100), Expect = 6e-04 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP PPP P P PP Sbjct: 47 PPPPPPPLPPPPPPPPLPPLPLPP 70 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/25 (64%), Positives = 16/25 (64%), Gaps = 2/25 (8%) Frame = +3 Query: 870 PPPXPPP--XPPPXPPPXPPXXPPP 938 PPP PPP PPP PPP PP PP Sbjct: 46 PPPPPPPPLPPPPPPPPLPPLPLPP 70 Score = 35.5 bits (78), Expect = 0.28 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 P P PP PPP PP PPPP Sbjct: 37 PRRPGQRRPPPPPPPPPLPPPPP 59 Score = 35.1 bits (77), Expect = 0.37 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 VLP P P P PPP PP PPPP Sbjct: 29 VLPCPTSVPRRPGQRRPPPPPPPPPLPPPP 58 >M27430-1|AAA51886.1| 919|Homo sapiens AR protein. Length = 919 Score = 45.2 bits (102), Expect = 3e-04 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG GGG GGG Sbjct: 449 GGGGGGGGGGGGGGGGGGGGGGGG 472 Score = 44.0 bits (99), Expect = 8e-04 Identities = 18/27 (66%), Positives = 18/27 (66%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GGG GGG G Sbjct: 449 GGGGGGGGGGGGGGGGGGGGGGGGEAG 475 Score = 42.3 bits (95), Expect = 0.002 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXP 860 GGGG GG GGG GGG GGG G P Sbjct: 453 GGGGGGGGGGGGGGGGGGGGEAGAVAP 479 Score = 39.5 bits (88), Expect = 0.017 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG GGG G Sbjct: 452 GGGGGGGGGGGGGGGGGGGGGEAG 475 Score = 38.7 bits (86), Expect = 0.030 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GGG GGG GGG G Sbjct: 446 GPCGGGGGGGGGGGGGGGGGGGGGG 470 Score = 37.9 bits (84), Expect = 0.053 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GGG GGG GGG G Sbjct: 446 GPCGGGGGGGGGGGGGGGGGGGGGGG 471 Score = 34.7 bits (76), Expect = 0.49 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GGG GGG GGG GGG G Sbjct: 442 GQLYGPCGGGGGGGGGGGGGGGGGGG 467 >M23263-1|AAA51775.1| 918|Homo sapiens androgen receptor protein. Length = 918 Score = 45.2 bits (102), Expect = 3e-04 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG GGG GGG Sbjct: 445 GGGGGGGGGGGGGGGGGGGGGGGG 468 Score = 45.2 bits (102), Expect = 3e-04 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG GGG GGG Sbjct: 446 GGGGGGGGGGGGGGGGGGGGGGGG 469 Score = 45.2 bits (102), Expect = 3e-04 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG GGG GGG Sbjct: 447 GGGGGGGGGGGGGGGGGGGGGGGG 470 Score = 45.2 bits (102), Expect = 3e-04 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG GGG GGG Sbjct: 448 GGGGGGGGGGGGGGGGGGGGGGGG 471 Score = 43.6 bits (98), Expect = 0.001 Identities = 18/27 (66%), Positives = 18/27 (66%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GGG GGG G Sbjct: 445 GGGGGGGGGGGGGGGGGGGGGGGGGGG 471 Score = 39.1 bits (87), Expect = 0.023 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXP 860 GGGG GG GGG GGG GGG P Sbjct: 452 GGGGGGGGGGGGGGGGGGGGEAEAVAP 478 Score = 38.7 bits (86), Expect = 0.030 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GGG GGG GGG G Sbjct: 442 GPCGGGGGGGGGGGGGGGGGGGGGG 466 Score = 37.9 bits (84), Expect = 0.053 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GGG GGG GGG G Sbjct: 442 GPCGGGGGGGGGGGGGGGGGGGGGGG 467 Score = 34.7 bits (76), Expect = 0.49 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GGG GGG GGG GGG G Sbjct: 438 GQLYGPCGGGGGGGGGGGGGGGGGGG 463 >M20132-1|AAA51729.1| 919|Homo sapiens AR protein. Length = 919 Score = 45.2 bits (102), Expect = 3e-04 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG GGG GGG Sbjct: 449 GGGGGGGGGGGGGGGGGGGGGGGG 472 Score = 44.0 bits (99), Expect = 8e-04 Identities = 18/27 (66%), Positives = 18/27 (66%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GGG GGG G Sbjct: 449 GGGGGGGGGGGGGGGGGGGGGGGGEAG 475 Score = 42.3 bits (95), Expect = 0.002 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXP 860 GGGG GG GGG GGG GGG G P Sbjct: 453 GGGGGGGGGGGGGGGGGGGGEAGAVAP 479 Score = 39.5 bits (88), Expect = 0.017 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG GGG G Sbjct: 452 GGGGGGGGGGGGGGGGGGGGGEAG 475 Score = 38.7 bits (86), Expect = 0.030 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GGG GGG GGG G Sbjct: 446 GPCGGGGGGGGGGGGGGGGGGGGGG 470 Score = 37.9 bits (84), Expect = 0.053 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GGG GGG GGG G Sbjct: 446 GPCGGGGGGGGGGGGGGGGGGGGGGG 471 Score = 34.7 bits (76), Expect = 0.49 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GGG GGG GGG GGG G Sbjct: 442 GQLYGPCGGGGGGGGGGGGGGGGGGG 467 >L29496-1|AAA51770.1| 734|Homo sapiens AR protein. Length = 734 Score = 45.2 bits (102), Expect = 3e-04 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG GGG GGG Sbjct: 261 GGGGGGGGGGGGGGGGGGGGGGGG 284 Score = 45.2 bits (102), Expect = 3e-04 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG GGG GGG Sbjct: 262 GGGGGGGGGGGGGGGGGGGGGGGG 285 Score = 45.2 bits (102), Expect = 3e-04 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG GGG GGG Sbjct: 263 GGGGGGGGGGGGGGGGGGGGGGGG 286 Score = 45.2 bits (102), Expect = 3e-04 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG GGG GGG Sbjct: 264 GGGGGGGGGGGGGGGGGGGGGGGG 287 Score = 43.6 bits (98), Expect = 0.001 Identities = 18/27 (66%), Positives = 18/27 (66%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GGG GGG G Sbjct: 261 GGGGGGGGGGGGGGGGGGGGGGGGGGG 287 Score = 39.1 bits (87), Expect = 0.023 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXP 860 GGGG GG GGG GGG GGG P Sbjct: 268 GGGGGGGGGGGGGGGGGGGGEAEAVAP 294 Score = 38.7 bits (86), Expect = 0.030 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GGG GGG GGG G Sbjct: 258 GPCGGGGGGGGGGGGGGGGGGGGGG 282 Score = 37.9 bits (84), Expect = 0.053 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GGG GGG GGG G Sbjct: 258 GPCGGGGGGGGGGGGGGGGGGGGGGG 283 Score = 34.7 bits (76), Expect = 0.49 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GGG GGG GGG GGG G Sbjct: 254 GQLYGPCGGGGGGGGGGGGGGGGGGG 279 >EF064739-1|ABK41922.1| 281|Homo sapiens Fas ligand (TNF superfamily, member 6) protein. Length = 281 Score = 45.2 bits (102), Expect = 3e-04 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PP PPP PP PPP PP PP P Sbjct: 40 PGQRRPPPPPPPPPLPPPPPPPPLPPLP 67 Score = 44.4 bits (100), Expect = 6e-04 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP PPP P P PP Sbjct: 47 PPPPPPPLPPPPPPPPLPPLPLPP 70 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/25 (64%), Positives = 16/25 (64%), Gaps = 2/25 (8%) Frame = +3 Query: 870 PPPXPPP--XPPPXPPPXPPXXPPP 938 PPP PPP PPP PPP PP PP Sbjct: 46 PPPPPPPPLPPPPPPPPLPPLPLPP 70 Score = 35.5 bits (78), Expect = 0.28 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 P P PP PPP PP PPPP Sbjct: 37 PRRPGQRRPPPPPPPPPLPPPPP 59 Score = 35.1 bits (77), Expect = 0.37 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 VLP P P P PPP PP PPPP Sbjct: 29 VLPCPTSVPRRPGQRRPPPPPPPPPLPPPP 58 >D38122-1|BAA07320.1| 281|Homo sapiens Fas ligand protein. Length = 281 Score = 45.2 bits (102), Expect = 3e-04 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PP PPP PP PPP PP PP P Sbjct: 40 PGQRRPPPPPPPPPLPPPPPPPPLPPLP 67 Score = 44.4 bits (100), Expect = 6e-04 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP PPP P P PP Sbjct: 47 PPPPPPPLPPPPPPPPLPPLPLPP 70 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/25 (64%), Positives = 16/25 (64%), Gaps = 2/25 (8%) Frame = +3 Query: 870 PPPXPPP--XPPPXPPPXPPXXPPP 938 PPP PPP PPP PPP PP PP Sbjct: 46 PPPPPPPPLPPPPPPPPLPPLPLPP 70 Score = 35.5 bits (78), Expect = 0.28 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 P P PP PPP PP PPPP Sbjct: 37 PRRPGQRRPPPPPPPPPLPPPPP 59 Score = 35.1 bits (77), Expect = 0.37 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 VLP P P P PPP PP PPPP Sbjct: 29 VLPCPTSVPRRPGQRRPPPPPPPPPLPPPP 58 >BC035907-1|AAH35907.1| 308|Homo sapiens USP51 protein protein. Length = 308 Score = 45.2 bits (102), Expect = 3e-04 Identities = 18/34 (52%), Positives = 19/34 (55%) Frame = +3 Query: 837 RSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 R+ S PG PP PP PPP PPP PP P P Sbjct: 111 RARSRSQPGLSAPPPPPARPPPPPPPPPPPAPRP 144 Score = 32.3 bits (70), Expect = 2.6 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 14/47 (29%) Frame = +3 Query: 840 SLSXVLPGXXPPPXP--------------PPXPPPXPPPXPPXXPPP 938 S S V P P P P PP PP PPP PP PPP Sbjct: 94 SSSPVCPRRKPRPRPQPRARSRSQPGLSAPPPPPARPPPPPPPPPPP 140 >BC017502-1|AAH17502.1| 281|Homo sapiens Fas ligand (TNF superfamily, member 6) protein. Length = 281 Score = 45.2 bits (102), Expect = 3e-04 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PP PPP PP PPP PP PP P Sbjct: 40 PGQRRPPPPPPPPPLPPPPPPPPLPPLP 67 Score = 44.4 bits (100), Expect = 6e-04 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP PPP P P PP Sbjct: 47 PPPPPPPLPPPPPPPPLPPLPLPP 70 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/25 (64%), Positives = 16/25 (64%), Gaps = 2/25 (8%) Frame = +3 Query: 870 PPPXPPP--XPPPXPPPXPPXXPPP 938 PPP PPP PPP PPP PP PP Sbjct: 46 PPPPPPPPLPPPPPPPPLPPLPLPP 70 Score = 35.5 bits (78), Expect = 0.28 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 P P PP PPP PP PPPP Sbjct: 37 PRRPGQRRPPPPPPPPPLPPPPP 59 Score = 35.1 bits (77), Expect = 0.37 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 VLP P P P PPP PP PPPP Sbjct: 29 VLPCPTSVPRRPGQRRPPPPPPPPPLPPPP 58 >AY858799-1|AAX49569.1| 281|Homo sapiens CD95 ligand protein. Length = 281 Score = 45.2 bits (102), Expect = 3e-04 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PP PPP PP PPP PP PP P Sbjct: 40 PGQRRPPPPPPPPPLPPPPPPPPLPPLP 67 Score = 44.4 bits (100), Expect = 6e-04 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP PPP P P PP Sbjct: 47 PPPPPPPLPPPPPPPPLPPLPLPP 70 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/25 (64%), Positives = 16/25 (64%), Gaps = 2/25 (8%) Frame = +3 Query: 870 PPPXPPP--XPPPXPPPXPPXXPPP 938 PPP PPP PPP PPP PP PP Sbjct: 46 PPPPPPPPLPPPPPPPPLPPLPLPP 70 Score = 35.5 bits (78), Expect = 0.28 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 P P PP PPP PP PPPP Sbjct: 37 PRRPGQRRPPPPPPPPPLPPPPP 59 Score = 35.1 bits (77), Expect = 0.37 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 VLP P P P PPP PP PPPP Sbjct: 29 VLPCPTSVPRRPGQRRPPPPPPPPPLPPPP 58 >AY225406-1|AAO43991.1| 281|Homo sapiens FAS ligand protein. Length = 281 Score = 45.2 bits (102), Expect = 3e-04 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PP PPP PP PPP PP PP P Sbjct: 40 PGQRRPPPPPPPPPLPPPPPPPPLPPLP 67 Score = 44.4 bits (100), Expect = 6e-04 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP PPP P P PP Sbjct: 47 PPPPPPPLPPPPPPPPLPPLPLPP 70 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/25 (64%), Positives = 16/25 (64%), Gaps = 2/25 (8%) Frame = +3 Query: 870 PPPXPPP--XPPPXPPPXPPXXPPP 938 PPP PPP PPP PPP PP PP Sbjct: 46 PPPPPPPPLPPPPPPPPLPPLPLPP 70 Score = 35.5 bits (78), Expect = 0.28 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 P P PP PPP PP PPPP Sbjct: 37 PRRPGQRRPPPPPPPPPLPPPPP 59 Score = 35.1 bits (77), Expect = 0.37 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 VLP P P P PPP PP PPPP Sbjct: 29 VLPCPTSVPRRPGQRRPPPPPPPPPLPPPP 58 >AJ583823-1|CAE47750.2| 711|Homo sapiens ubiquitin specific proteinase 51 protein. Length = 711 Score = 45.2 bits (102), Expect = 3e-04 Identities = 18/34 (52%), Positives = 19/34 (55%) Frame = +3 Query: 837 RSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 R+ S PG PP PP PPP PPP PP P P Sbjct: 111 RARSRSQPGLSAPPPPPARPPPPPPPPPPPAPRP 144 Score = 32.3 bits (70), Expect = 2.6 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 14/47 (29%) Frame = +3 Query: 840 SLSXVLPGXXPPPXP--------------PPXPPPXPPPXPPXXPPP 938 S S V P P P P PP PP PPP PP PPP Sbjct: 94 SSSPVCPRRKPRPRPQPRARSRSQPGLSAPPPPPARPPPPPPPPPPP 140 >AF321914-1|AAK09423.1| 544|Homo sapiens androgen receptor protein. Length = 544 Score = 45.2 bits (102), Expect = 3e-04 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG GGG GGG Sbjct: 455 GGGGGGGGGGGGGGGGGGGGGGGG 478 Score = 44.0 bits (99), Expect = 8e-04 Identities = 18/27 (66%), Positives = 18/27 (66%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GGG GGG G Sbjct: 455 GGGGGGGGGGGGGGGGGGGGGGGGEAG 481 Score = 42.3 bits (95), Expect = 0.002 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXP 860 GGGG GG GGG GGG GGG G P Sbjct: 459 GGGGGGGGGGGGGGGGGGGGEAGAVAP 485 Score = 39.5 bits (88), Expect = 0.017 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG GGG G Sbjct: 458 GGGGGGGGGGGGGGGGGGGGGEAG 481 Score = 38.7 bits (86), Expect = 0.030 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GGG GGG GGG G Sbjct: 452 GPCGGGGGGGGGGGGGGGGGGGGGG 476 Score = 37.9 bits (84), Expect = 0.053 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GGG GGG GGG G Sbjct: 452 GPCGGGGGGGGGGGGGGGGGGGGGGG 477 Score = 34.7 bits (76), Expect = 0.49 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GGG GGG GGG GGG G Sbjct: 448 GQLYGPCGGGGGGGGGGGGGGGGGGG 473 >AF288573-1|AAG60017.1| 127|Homo sapiens FasL isoform protein. Length = 127 Score = 45.2 bits (102), Expect = 3e-04 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PP PPP PP PPP PP PP P Sbjct: 40 PGQRRPPPPPPPPPLPPPPPPPPLPPLP 67 Score = 44.4 bits (100), Expect = 6e-04 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP PPP P P PP Sbjct: 47 PPPPPPPLPPPPPPPPLPPLPLPP 70 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/25 (64%), Positives = 16/25 (64%), Gaps = 2/25 (8%) Frame = +3 Query: 870 PPPXPPP--XPPPXPPPXPPXXPPP 938 PPP PPP PPP PPP PP PP Sbjct: 46 PPPPPPPPLPPPPPPPPLPPLPLPP 70 Score = 35.5 bits (78), Expect = 0.28 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 P P PP PPP PP PPPP Sbjct: 37 PRRPGQRRPPPPPPPPPLPPPPP 59 Score = 35.1 bits (77), Expect = 0.37 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 VLP P P P PPP PP PPPP Sbjct: 29 VLPCPTSVPRRPGQRRPPPPPPPPPLPPPP 58 >AL355338-1|CAH70366.2| 663|Homo sapiens Zic family member 5 (odd-paired homolog, Drosophila) protein. Length = 663 Score = 44.8 bits (101), Expect = 5e-04 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +3 Query: 846 SXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 S P PPP PP P P PPP PP PPP Sbjct: 143 SGAQPSAPPPPAPPLPPTPSPPPPPPPPPPP 173 Score = 36.7 bits (81), Expect = 0.12 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPP 911 L G PPP PPP PPP PP Sbjct: 406 LAGLPPPPPPPPPPPPPPP 424 Score = 36.7 bits (81), Expect = 0.12 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = +3 Query: 870 PPPXPPPXPPPXPPP 914 PPP PPP PPP PPP Sbjct: 410 PPPPPPPPPPPPPPP 424 Score = 34.3 bits (75), Expect = 0.65 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPP 938 P PPP PPP PPP P P Sbjct: 410 PPPPPPPPPPPPPPPAGGAKP 430 Score = 34.3 bits (75), Expect = 0.65 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP PP P Sbjct: 411 PPPPPPPPPPPPPPAGGAKP 430 Score = 33.5 bits (73), Expect(2) = 0.006 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 897 PPXPPPXPPXXPPPP 941 PP PPP PP PPPP Sbjct: 410 PPPPPPPPPPPPPPP 424 Score = 26.6 bits (56), Expect(2) = 0.006 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +3 Query: 870 PPPXPPPXPPPXPPP 914 PPP PPP P P P Sbjct: 356 PPPAPPPPPAPAQHP 370 >AF378304-1|AAK55418.1| 639|Homo sapiens zinc family member 5 protein protein. Length = 639 Score = 44.8 bits (101), Expect = 5e-04 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +3 Query: 846 SXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 S P PPP PP P P PPP PP PPP Sbjct: 119 SGAQPSAPPPPAPPLPPTPSPPPPPPPPPPP 149 Score = 36.7 bits (81), Expect = 0.12 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPP 911 L G PPP PPP PPP PP Sbjct: 382 LAGLPPPPPPPPPPPPPPP 400 Score = 36.7 bits (81), Expect = 0.12 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = +3 Query: 870 PPPXPPPXPPPXPPP 914 PPP PPP PPP PPP Sbjct: 386 PPPPPPPPPPPPPPP 400 Score = 34.3 bits (75), Expect = 0.65 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPP 938 P PPP PPP PPP P P Sbjct: 386 PPPPPPPPPPPPPPPAGGAKP 406 Score = 34.3 bits (75), Expect = 0.65 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP PP P Sbjct: 387 PPPPPPPPPPPPPPAGGAKP 406 Score = 33.5 bits (73), Expect(2) = 0.006 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 897 PPXPPPXPPXXPPPP 941 PP PPP PP PPPP Sbjct: 386 PPPPPPPPPPPPPPP 400 Score = 26.6 bits (56), Expect(2) = 0.006 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +3 Query: 870 PPPXPPPXPPPXPPP 914 PPP PPP P P P Sbjct: 332 PPPAPPPPPAPAQHP 346 >BC038446-1|AAH38446.1| 673|Homo sapiens SF1 protein protein. Length = 673 Score = 44.4 bits (100), Expect = 6e-04 Identities = 25/70 (35%), Positives = 27/70 (38%) Frame = +3 Query: 732 GXWGGSXPXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPP 911 G GG P PP P +L+ P PP PPP PPP PP Sbjct: 23 GPKGGFEPGPPPAPGPG-AGLLAPGPPPPPPVGSMGALTAAFPFAALPPPPPP-PPPPPP 80 Query: 912 PXPPXXPPPP 941 PP PPPP Sbjct: 81 QQPPPPPPPP 90 Score = 43.2 bits (97), Expect = 0.001 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 PPP PPP PPP PP PP P P Sbjct: 70 PPPPPPPPPPPQQPPPPPPPPSP 92 Score = 42.7 bits (96), Expect = 0.002 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP P PP PP P Sbjct: 69 PPPPPPPPPPPPQQPPPPPPPPSP 92 Score = 41.9 bits (94), Expect = 0.003 Identities = 18/34 (52%), Positives = 18/34 (52%), Gaps = 6/34 (17%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPP------XPPXXPPPP 941 P PPP PP PPP PPP PP PPPP Sbjct: 71 PPPPPPPPPPQQPPPPPPPPSPGASYPPPQPPPP 104 Score = 38.3 bits (85), Expect = 0.040 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPPPXPPPXP-PPXPPPXPPXXPPPP 941 P PPP PPP P PPP PP PPPP Sbjct: 80 PQQPPPPPPPPSPGASYPPPQPP--PPPP 106 Score = 36.7 bits (81), Expect = 0.12 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PPP P P PP PPPP Sbjct: 78 PPPQQPPPPPPPPSPGASYPPPQPPPPP 105 Score = 35.9 bits (79), Expect = 0.21 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 5/32 (15%) Frame = +3 Query: 861 GXXPPPX-----PPPXPPPXPPPXPPXXPPPP 941 G PPP PPP PP PP PP P PP Sbjct: 593 GMMPPPPMGMMPPPPPPPSGQPPPPPSGPLPP 624 Score = 35.5 bits (78), Expect = 0.28 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PP PP PPP P PPPP Sbjct: 92 PGASYPPPQPPPPPPLYQRVSPPQPPPP 119 Score = 35.1 bits (77), Expect = 0.37 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSL-XXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P PP P P S P P P PP + PPP Sbjct: 71 PPPPPPPPPPQQPPPPPPPPSPGASYPPPQPPPPPPLYQRVSPPQPPP 118 Score = 34.3 bits (75), Expect = 0.65 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P PP P P P P PP P P P Sbjct: 70 PPPPPPPPPPPQQPPPPPPPPSPGASYPPPQPPPPPPLYQRVSPPQP 116 Score = 33.5 bits (73), Expect = 1.1 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 3/26 (11%) Frame = +3 Query: 870 PPPXPPPXPP---PXPPPXPPXXPPP 938 PPP PPP PP PP PP PP Sbjct: 97 PPPQPPPPPPLYQRVSPPQPPPPQPP 122 Score = 32.3 bits (70), Expect = 2.6 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPP 897 PPSP PP P P + P P P PP Sbjct: 89 PPSPGASYPPPQPPPPPPLYQRVSPPQPPPPQPP 122 Score = 31.1 bits (67), Expect = 6.1 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 7/37 (18%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXP-------PXXPPPP 941 ++P PPP P PPP P P P PPPP Sbjct: 602 MMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPPP 638 Score = 30.7 bits (66), Expect = 8.0 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 4/41 (9%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPP----PXPPPXPPPXPPXXPPPP 941 P S P PPP PP PP PPP PP P Sbjct: 88 PPPSPGASYPPPQPPPPPPLYQRVSPPQPPPPQPPRKDQQP 128 >BC020238-1|AAH20238.1| 596|Homo sapiens SRP68 protein protein. Length = 596 Score = 44.4 bits (100), Expect = 6e-04 Identities = 19/37 (51%), Positives = 20/37 (54%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GGGG GG GG GGG GGG G G + ER G Sbjct: 11 GGGGGSGGGGGSGGGGSGGGRGAGGEENKENERPSAG 47 Score = 37.5 bits (83), Expect = 0.070 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG G G GGG GGG G Sbjct: 9 GGGGGGGSGGGGGSG-GGGSGGGRGAG 34 >AK097947-1|BAC05201.1| 209|Homo sapiens protein ( Homo sapiens cDNA FLJ40628 fis, clone THYMU2014204, weakly similar to WISKOTT-ALDRICH SYNDROME PROTEIN. ). Length = 209 Score = 44.4 bits (100), Expect = 6e-04 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP PP PPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPP 84 Score = 42.3 bits (95), Expect = 0.002 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPP 935 PPP PPP PPP PPP PP PP Sbjct: 65 PPPPPPPPPPPPPPPPPP--PP 84 Score = 39.5 bits (88), Expect = 0.017 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPP 914 LP PPP PPP PPP PPP Sbjct: 64 LPPPPPPPPPPPPPPPPPPP 83 Score = 37.9 bits (84), Expect = 0.053 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPP 914 P PPP PPP PPP PPP Sbjct: 66 PPPPPPPPPPPPPPPPPPP 84 Score = 35.9 bits (79), Expect = 0.21 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPP 911 LS P PPP PPP PPP PP Sbjct: 62 LSLPPPPPPPPPPPPPPPPPPPP 84 >AK074698-1|BAC11145.1| 627|Homo sapiens protein ( Homo sapiens cDNA FLJ90217 fis, clone MAMMA1002234, highly similar to SIGNAL RECOGNITION PARTICLE 68 KD PROTEIN. ). Length = 627 Score = 44.4 bits (100), Expect = 6e-04 Identities = 19/37 (51%), Positives = 20/37 (54%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GGGG GG GG GGG GGG G G + ER G Sbjct: 11 GGGGGSGGGGGSGGGGSGGGRGAGGEENKENERPSAG 47 Score = 37.5 bits (83), Expect = 0.070 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG G G GGG GGG G Sbjct: 9 GGGGGGGSGGGGGSG-GGGSGGGRGAG 34 >AF065164-1|AAC28444.2| 889|Homo sapiens hyperpolarization-activated, cyclic nucleotide-gated channel 2 protein. Length = 889 Score = 44.4 bits (100), Expect = 6e-04 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P PPP PPP PPP P P PP PP Sbjct: 31 PKQQPPPPPPPAPPPGPGPAPPQHPP 56 Score = 44.0 bits (99), Expect = 8e-04 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG P PPP PPP PP P PPPP Sbjct: 14 PGASPTTGPPPPPPPRPPKQQPPPPPPP 41 Score = 44.0 bits (99), Expect = 8e-04 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PP PP PP PPP Sbjct: 18 PTTGPPPPPPPRPPKQQPPPPPPPAPPP 45 Score = 40.3 bits (90), Expect = 0.010 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG P P PPP PPP PP PPP Sbjct: 10 PGESPGASPTTGPPPPPPPRPPKQQPPP 37 Score = 39.5 bits (88), Expect = 0.017 Identities = 16/28 (57%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPP-PXPPPXPPPXPPXXPPP 938 P PPP PP PPP PPP PP P P Sbjct: 22 PPPPPPPRPPKQQPPPPPPPAPPPGPGP 49 Score = 38.3 bits (85), Expect = 0.040 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP--PP 941 P P PPP PPP PPP P PP PP Sbjct: 27 PPRPPKQQPPPPPPPAPPPGPGPAPPQHPP 56 Score = 34.3 bits (75), Expect = 0.65 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PP PP PPP PP P PP Sbjct: 26 PPPRPPKQQPPPPPPPAPPPGPGPAPP 52 Score = 32.3 bits (70), Expect = 2.6 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPP 933 PP PP P PP P P P P P P P PP Sbjct: 22 PPPPPPPRPPKQQPPPPP----PPAPPPGPGPAPPQHPPRAEALPP 63 Score = 29.9 bits (64), Expect(2) = 1.2 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%) Frame = +3 Query: 870 PPPXPPP---XPPPXPPPXPPXXPPPP 941 PPP P P P P PP PP P P Sbjct: 761 PPPGPAPAAASPGPPPPASPPGAPASP 787 Score = 22.2 bits (45), Expect(2) = 1.2 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 861 GXXPPPXPPP 890 G PPP PPP Sbjct: 712 GLFPPPPPPP 721 >AB075851-1|BAB85557.1| 830|Homo sapiens KIAA1971 protein protein. Length = 830 Score = 44.4 bits (100), Expect = 6e-04 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP PP PPPP Sbjct: 660 PPPPPPPPPPPPPPPPPPPP 679 Score = 42.3 bits (95), Expect = 0.002 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPP 935 PPP PPP PPP PPP PP PP Sbjct: 660 PPPPPPPPPPPPPPPPPP--PP 679 Score = 39.5 bits (88), Expect = 0.017 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPP 914 LP PPP PPP PPP PPP Sbjct: 659 LPPPPPPPPPPPPPPPPPPP 678 Score = 37.9 bits (84), Expect = 0.053 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPP 914 P PPP PPP PPP PPP Sbjct: 661 PPPPPPPPPPPPPPPPPPP 679 Score = 35.9 bits (79), Expect = 0.21 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPP 911 LS P PPP PPP PPP PP Sbjct: 657 LSLPPPPPPPPPPPPPPPPPPPP 679 >BC064998-1|AAH64998.1| 268|Homo sapiens CAPNS1 protein protein. Length = 268 Score = 44.0 bits (99), Expect = 8e-04 Identities = 20/35 (57%), Positives = 20/35 (57%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GG GG GGG GGG GGG GGG G T R G Sbjct: 30 GGLIGGAGGGGGGGGGGGGGGGGGGGGTAMRILGG 64 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GG G GG GGG GGG GGG GG Sbjct: 34 GGAGGGGGGGGGGGGGGGGGGGG 56 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 GG GG GGG GGG GGG GGG Sbjct: 34 GGAGGGGGGGGGGGGGGGGGGGG 56 Score = 37.9 bits (84), Expect = 0.053 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GG GG GGG GGG GGG G Sbjct: 24 GLGGVLGGLIGGAGGGGGGGGGGGGGGG 51 Score = 37.1 bits (82), Expect = 0.093 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GGG GGG GGG GGG G Sbjct: 30 GGLIGGAGGGGGGGGGGGGGGGGGGGG 56 Score = 36.7 bits (81), Expect = 0.12 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GGG GGG GG GG Sbjct: 10 GGGGGGGGGGGLGGGLGGVLGG 31 Score = 36.7 bits (81), Expect = 0.12 Identities = 19/35 (54%), Positives = 19/35 (54%), Gaps = 7/35 (20%) Frame = -2 Query: 940 GGGGXXGGXGGGXG-------GGXGGGXGGGXXPG 857 GGGG GG GGG G GG GGG GGG G Sbjct: 13 GGGGGGGGLGGGLGGVLGGLIGGAGGGGGGGGGGG 47 Score = 35.1 bits (77), Expect = 0.37 Identities = 18/34 (52%), Positives = 18/34 (52%), Gaps = 6/34 (17%) Frame = -2 Query: 940 GGGGXXGGXGG------GXGGGXGGGXGGGXXPG 857 GGGG GG GG G GG GGG GGG G Sbjct: 17 GGGGLGGGLGGVLGGLIGGAGGGGGGGGGGGGGG 50 Score = 31.9 bits (69), Expect = 3.5 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 913 GGGXGGGXGGGXGGG 869 GGG GGG GGG GGG Sbjct: 10 GGGGGGGGGGGLGGG 24 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG GG Sbjct: 41 GGGGGGGGGGGGGGGGTAMRILGG 64 >BC023532-1|AAH23532.1| 641|Homo sapiens WW domain binding protein 11 protein. Length = 641 Score = 44.0 bits (99), Expect = 8e-04 Identities = 18/30 (60%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXP--PPXPPPXPPPXPPPXPPXXPPPP 941 PG P PP PPP PPP PP PP PPP Sbjct: 460 PGPPPGRPPGPPPGPPPGLPPGPPPRGPPP 489 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/25 (64%), Positives = 16/25 (64%), Gaps = 2/25 (8%) Frame = +3 Query: 870 PPPXPPPXPPPXPPP--XPPXXPPP 938 PPP PPP PP PPP PP PPP Sbjct: 470 PPPGPPPGLPPGPPPRGPPPRLPPP 494 Score = 39.9 bits (89), Expect = 0.013 Identities = 18/31 (58%), Positives = 18/31 (58%), Gaps = 4/31 (12%) Frame = +3 Query: 858 PGXXP--PPXPPPXPPPX--PPPXPPXXPPP 938 PG P PP PPP PP PPP PP PPP Sbjct: 472 PGPPPGLPPGPPPRGPPPRLPPPAPPGIPPP 502 Score = 39.5 bits (88), Expect = 0.017 Identities = 20/36 (55%), Positives = 21/36 (58%), Gaps = 3/36 (8%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPX-PPXXPP--PP 941 L +LP PPP PP PPP PPP PP PP PP Sbjct: 454 LPRLLP-PGPPPGRPPGPPPGPPPGLPPGPPPRGPP 488 Score = 36.3 bits (80), Expect = 0.16 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P + + +PG PPP PP PP PP PP PP Sbjct: 399 PSQIQAPPMPG--PPPLGPPPAPPLRPPGPPTGLPP 432 Score = 36.3 bits (80), Expect = 0.16 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PP PPP PP PPP P PP Sbjct: 484 PRGPPPRLPPPAPPGIPPPRPGMMRPP 510 Score = 35.5 bits (78), Expect = 0.28 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 5/33 (15%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXP----PP-XPPXXPPPP 941 P PPP PP PPP P PP PP P PP Sbjct: 488 PPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAPP 520 Score = 35.1 bits (77), Expect = 0.37 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PP PP PP PP PPP Sbjct: 467 PPGPPPGPPPGLPPGPPPRGPPPRLPPP 494 Score = 35.1 bits (77), Expect = 0.37 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +3 Query: 855 LPGXXPPPXPPPX-PPPXPPPXPPXXP 932 LP PP PPP PPP PP PP P Sbjct: 478 LPPGPPPRGPPPRLPPPAPPGIPPPRP 504 Score = 34.3 bits (75), Expect = 0.65 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP P P PP PPP PP PP P Sbjct: 405 PPMPGP-PPLGPPPAPPLRPPGP 426 Score = 34.3 bits (75), Expect = 0.65 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 3/30 (10%) Frame = +3 Query: 858 PGXXPPPXP---PPXPPPXPPPXPPXXPPP 938 P PPP P PP PP PP PP PP Sbjct: 411 PPLGPPPAPPLRPPGPPTGLPPGPPPGAPP 440 Score = 32.7 bits (71), Expect = 2.0 Identities = 17/36 (47%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +3 Query: 831 PXRSLSXV-LPGXXPPPXPPPXPPPXPPPXPPXXPP 935 P R++S + L G P PP PP PPP PP PP Sbjct: 176 PTRAVSILPLLGHGVPRLPPGRKPPGPPPGPP--PP 209 Score = 31.5 bits (68), Expect = 4.6 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = +3 Query: 873 PPXPPPXPPPXPPP-XPPXXPPP 938 PP PP PP PPP PP PP Sbjct: 423 PPGPPTGLPPGPPPGAPPFLRPP 445 Score = 31.1 bits (67), Expect = 6.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 885 PPXPPPXPPPXPPXXPPPP 941 P PP PP PP PPPP Sbjct: 191 PRLPPGRKPPGPPPGPPPP 209 Score = 31.1 bits (67), Expect = 6.1 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPP--PP 941 L G P PP PP PP PP PP PP Sbjct: 450 LRGPLPRLLPPGPPPGRPPGPPPGPPPGLPP 480 Score = 31.1 bits (67), Expect = 6.1 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP PP P P P P P PP P PP Sbjct: 459 PPGPPPGRPPGPPPGPPPGL----PPGPPPRGPPPRLPPPAPPGIPP 501 >BC016441-1|AAH16441.2| 400|Homo sapiens WBP11 protein protein. Length = 400 Score = 44.0 bits (99), Expect = 8e-04 Identities = 18/30 (60%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXP--PPXPPPXPPPXPPPXPPXXPPPP 941 PG P PP PPP PPP PP PP PPP Sbjct: 219 PGPPPGRPPGPPPGPPPGLPPGPPPRGPPP 248 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/25 (64%), Positives = 16/25 (64%), Gaps = 2/25 (8%) Frame = +3 Query: 870 PPPXPPPXPPPXPPP--XPPXXPPP 938 PPP PPP PP PPP PP PPP Sbjct: 229 PPPGPPPGLPPGPPPRGPPPRLPPP 253 Score = 39.9 bits (89), Expect = 0.013 Identities = 18/31 (58%), Positives = 18/31 (58%), Gaps = 4/31 (12%) Frame = +3 Query: 858 PGXXP--PPXPPP--XPPPXPPPXPPXXPPP 938 PG P PP PPP PP PPP PP PPP Sbjct: 231 PGPPPGLPPGPPPRGPPPRLPPPAPPGIPPP 261 Score = 39.5 bits (88), Expect = 0.017 Identities = 20/36 (55%), Positives = 21/36 (58%), Gaps = 3/36 (8%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPX-PPXXPP--PP 941 L +LP PPP PP PPP PPP PP PP PP Sbjct: 213 LPRLLP-PGPPPGRPPGPPPGPPPGLPPGPPPRGPP 247 Score = 36.3 bits (80), Expect = 0.16 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P + + +PG PPP PP PP PP PP PP Sbjct: 158 PSQIQAPPMPG--PPPLGPPPAPPLRPPGPPTGLPP 191 Score = 36.3 bits (80), Expect = 0.16 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PP PPP PP PPP P PP Sbjct: 243 PRGPPPRLPPPAPPGIPPPRPGMMRPP 269 Score = 35.5 bits (78), Expect = 0.28 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 5/33 (15%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXP----PP-XPPXXPPPP 941 P PPP PP PPP P PP PP P PP Sbjct: 247 PPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAPP 279 Score = 35.1 bits (77), Expect = 0.37 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PP PP PP PP PPP Sbjct: 226 PPGPPPGPPPGLPPGPPPRGPPPRLPPP 253 Score = 35.1 bits (77), Expect = 0.37 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +3 Query: 855 LPGXXPPPXPPPX-PPPXPPPXPPXXP 932 LP PP PPP PPP PP PP P Sbjct: 237 LPPGPPPRGPPPRLPPPAPPGIPPPRP 263 Score = 34.3 bits (75), Expect = 0.65 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP P P PP PPP PP PP P Sbjct: 164 PPMPGP-PPLGPPPAPPLRPPGP 185 Score = 34.3 bits (75), Expect = 0.65 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 3/30 (10%) Frame = +3 Query: 858 PGXXPPPXP---PPXPPPXPPPXPPXXPPP 938 P PPP P PP PP PP PP PP Sbjct: 170 PPLGPPPAPPLRPPGPPTGLPPGPPPGAPP 199 Score = 31.5 bits (68), Expect = 4.6 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = +3 Query: 873 PPXPPPXPPPXPPP-XPPXXPPP 938 PP PP PP PPP PP PP Sbjct: 182 PPGPPTGLPPGPPPGAPPFLRPP 204 Score = 31.1 bits (67), Expect = 6.1 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPP--PP 941 L G P PP PP PP PP PP PP Sbjct: 209 LRGPLPRLLPPGPPPGRPPGPPPGPPPGLPP 239 Score = 31.1 bits (67), Expect = 6.1 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP PP P P P P P PP P PP Sbjct: 218 PPGPPPGRPPGPPPGPPPGL----PPGPPPRGPPPRLPPPAPPGIPP 260 >BC006419-1|AAH06419.1| 39|Homo sapiens Unknown (protein for IMAGE:3946309) protein. Length = 39 Score = 44.0 bits (99), Expect = 8e-04 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PP PPP PPP PP PPPP Sbjct: 13 PPPPPPLRPPPPPPPLPP--PPPP 34 Score = 39.1 bits (87), Expect = 0.023 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPP 923 P PP PPP PPP PPP PP Sbjct: 13 PPPPPPLRPPPPPPPLPPPPPP 34 Score = 33.1 bits (72), Expect = 1.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPP 938 PP PPP PP PP PPP Sbjct: 6 PPAADSYPPPPPPLRPPPPPPP 27 Score = 32.7 bits (71), Expect = 2.0 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 3/27 (11%) Frame = +3 Query: 870 PPPXPPPXPPPXP---PPXPPXXPPPP 941 PP PPP P PP PP PPPP Sbjct: 6 PPAADSYPPPPPPLRPPPPPPPLPPPP 32 >BC001621-1|AAH01621.1| 641|Homo sapiens WW domain binding protein 11 protein. Length = 641 Score = 44.0 bits (99), Expect = 8e-04 Identities = 18/30 (60%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXP--PPXPPPXPPPXPPPXPPXXPPPP 941 PG P PP PPP PPP PP PP PPP Sbjct: 460 PGPPPGRPPGPPPGPPPGLPPGPPPRGPPP 489 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/25 (64%), Positives = 16/25 (64%), Gaps = 2/25 (8%) Frame = +3 Query: 870 PPPXPPPXPPPXPPP--XPPXXPPP 938 PPP PPP PP PPP PP PPP Sbjct: 470 PPPGPPPGLPPGPPPRGPPPRLPPP 494 Score = 39.9 bits (89), Expect = 0.013 Identities = 18/31 (58%), Positives = 18/31 (58%), Gaps = 4/31 (12%) Frame = +3 Query: 858 PGXXP--PPXPPPXPPPX--PPPXPPXXPPP 938 PG P PP PPP PP PPP PP PPP Sbjct: 472 PGPPPGLPPGPPPRGPPPRLPPPAPPGIPPP 502 Score = 39.5 bits (88), Expect = 0.017 Identities = 20/36 (55%), Positives = 21/36 (58%), Gaps = 3/36 (8%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPX-PPXXPP--PP 941 L +LP PPP PP PPP PPP PP PP PP Sbjct: 454 LPRLLP-PGPPPGRPPGPPPGPPPGLPPGPPPRGPP 488 Score = 36.3 bits (80), Expect = 0.16 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P + + +PG PPP PP PP PP PP PP Sbjct: 399 PSQIQAPPMPG--PPPLGPPPAPPLRPPGPPTGLPP 432 Score = 36.3 bits (80), Expect = 0.16 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PP PPP PP PPP P PP Sbjct: 484 PRGPPPRLPPPAPPGIPPPRPGMMRPP 510 Score = 35.5 bits (78), Expect = 0.28 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 5/33 (15%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXP----PP-XPPXXPPPP 941 P PPP PP PPP P PP PP P PP Sbjct: 488 PPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAPP 520 Score = 35.1 bits (77), Expect = 0.37 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PP PP PP PP PPP Sbjct: 467 PPGPPPGPPPGLPPGPPPRGPPPRLPPP 494 Score = 35.1 bits (77), Expect = 0.37 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +3 Query: 855 LPGXXPPPXPPPX-PPPXPPPXPPXXP 932 LP PP PPP PPP PP PP P Sbjct: 478 LPPGPPPRGPPPRLPPPAPPGIPPPRP 504 Score = 34.3 bits (75), Expect = 0.65 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP P P PP PPP PP PP P Sbjct: 405 PPMPGP-PPLGPPPAPPLRPPGP 426 Score = 34.3 bits (75), Expect = 0.65 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 3/30 (10%) Frame = +3 Query: 858 PGXXPPPXP---PPXPPPXPPPXPPXXPPP 938 P PPP P PP PP PP PP PP Sbjct: 411 PPLGPPPAPPLRPPGPPTGLPPGPPPGAPP 440 Score = 32.7 bits (71), Expect = 2.0 Identities = 17/36 (47%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +3 Query: 831 PXRSLSXV-LPGXXPPPXPPPXPPPXPPPXPPXXPP 935 P R++S + L G P PP PP PPP PP PP Sbjct: 176 PTRAVSILPLLGHGVPRLPPGRKPPGPPPGPP--PP 209 Score = 31.5 bits (68), Expect = 4.6 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = +3 Query: 873 PPXPPPXPPPXPPP-XPPXXPPP 938 PP PP PP PPP PP PP Sbjct: 423 PPGPPTGLPPGPPPGAPPFLRPP 445 Score = 31.1 bits (67), Expect = 6.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 885 PPXPPPXPPPXPPXXPPPP 941 P PP PP PP PPPP Sbjct: 191 PRLPPGRKPPGPPPGPPPP 209 Score = 31.1 bits (67), Expect = 6.1 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPP--PP 941 L G P PP PP PP PP PP PP Sbjct: 450 LRGPLPRLLPPGPPPGRPPGPPPGPPPGLPP 480 Score = 31.1 bits (67), Expect = 6.1 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP PP P P P P P PP P PP Sbjct: 459 PPGPPPGRPPGPPPGPPPGL----PPGPPPRGPPPRLPPPAPPGIPP 501 >AF118023-1|AAD30425.1| 641|Homo sapiens SH3 domain-binding protein SNP70 protein. Length = 641 Score = 44.0 bits (99), Expect = 8e-04 Identities = 18/30 (60%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXP--PPXPPPXPPPXPPPXPPXXPPPP 941 PG P PP PPP PPP PP PP PPP Sbjct: 460 PGPPPGRPPGPPPGPPPGLPPGPPPRGPPP 489 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/25 (64%), Positives = 16/25 (64%), Gaps = 2/25 (8%) Frame = +3 Query: 870 PPPXPPPXPPPXPPP--XPPXXPPP 938 PPP PPP PP PPP PP PPP Sbjct: 470 PPPGPPPGLPPGPPPRGPPPRLPPP 494 Score = 39.9 bits (89), Expect = 0.013 Identities = 18/31 (58%), Positives = 18/31 (58%), Gaps = 4/31 (12%) Frame = +3 Query: 858 PGXXP--PPXPPPXPPPX--PPPXPPXXPPP 938 PG P PP PPP PP PPP PP PPP Sbjct: 472 PGPPPGLPPGPPPRGPPPRLPPPAPPGIPPP 502 Score = 39.5 bits (88), Expect = 0.017 Identities = 20/36 (55%), Positives = 21/36 (58%), Gaps = 3/36 (8%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPX-PPXXPP--PP 941 L +LP PPP PP PPP PPP PP PP PP Sbjct: 454 LPRLLP-PGPPPGRPPGPPPGPPPGLPPGPPPRGPP 488 Score = 36.3 bits (80), Expect = 0.16 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P + + +PG PPP PP PP PP PP PP Sbjct: 399 PSQIQAPPMPG--PPPLGPPPAPPLRPPGPPTGLPP 432 Score = 36.3 bits (80), Expect = 0.16 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PP PPP PP PPP P PP Sbjct: 484 PRGPPPRLPPPAPPGIPPPRPGMMRPP 510 Score = 35.5 bits (78), Expect = 0.28 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 5/33 (15%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXP----PP-XPPXXPPPP 941 P PPP PP PPP P PP PP P PP Sbjct: 488 PPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAPP 520 Score = 35.1 bits (77), Expect = 0.37 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PP PP PP PP PPP Sbjct: 467 PPGPPPGPPPGLPPGPPPRGPPPRLPPP 494 Score = 35.1 bits (77), Expect = 0.37 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +3 Query: 855 LPGXXPPPXPPPX-PPPXPPPXPPXXP 932 LP PP PPP PPP PP PP P Sbjct: 478 LPPGPPPRGPPPRLPPPAPPGIPPPRP 504 Score = 34.3 bits (75), Expect = 0.65 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP P P PP PPP PP PP P Sbjct: 405 PPMPGP-PPLGPPPAPPLRPPGP 426 Score = 34.3 bits (75), Expect = 0.65 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 3/30 (10%) Frame = +3 Query: 858 PGXXPPPXP---PPXPPPXPPPXPPXXPPP 938 P PPP P PP PP PP PP PP Sbjct: 411 PPLGPPPAPPLRPPGPPTGLPPGPPPGAPP 440 Score = 32.7 bits (71), Expect = 2.0 Identities = 17/36 (47%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +3 Query: 831 PXRSLSXV-LPGXXPPPXPPPXPPPXPPPXPPXXPP 935 P R++S + L G P PP PP PPP PP PP Sbjct: 176 PTRAVSILPLLGHGVPRLPPGRKPPGPPPGPP--PP 209 Score = 31.5 bits (68), Expect = 4.6 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = +3 Query: 873 PPXPPPXPPPXPPP-XPPXXPPP 938 PP PP PP PPP PP PP Sbjct: 423 PPGPPTGLPPGPPPGAPPFLRPP 445 Score = 31.1 bits (67), Expect = 6.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 885 PPXPPPXPPPXPPXXPPPP 941 P PP PP PP PPPP Sbjct: 191 PRLPPGRKPPGPPPGPPPP 209 Score = 31.1 bits (67), Expect = 6.1 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPP--PP 941 L G P PP PP PP PP PP PP Sbjct: 450 LRGPLPRLLPPGPPPGRPPGPPPGPPPGLPP 480 Score = 31.1 bits (67), Expect = 6.1 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP PP P P P P P PP P PP Sbjct: 459 PPGPPPGRPPGPPPGPPPGL----PPGPPPRGPPPRLPPPAPPGIPP 501 >AB029309-1|BAA88410.1| 641|Homo sapiens Npw38-binding protein NpwBP protein. Length = 641 Score = 44.0 bits (99), Expect = 8e-04 Identities = 18/30 (60%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXP--PPXPPPXPPPXPPPXPPXXPPPP 941 PG P PP PPP PPP PP PP PPP Sbjct: 460 PGPPPGRPPGPPPGPPPGLPPGPPPRGPPP 489 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/25 (64%), Positives = 16/25 (64%), Gaps = 2/25 (8%) Frame = +3 Query: 870 PPPXPPPXPPPXPPP--XPPXXPPP 938 PPP PPP PP PPP PP PPP Sbjct: 470 PPPGPPPGLPPGPPPRGPPPRLPPP 494 Score = 39.9 bits (89), Expect = 0.013 Identities = 18/31 (58%), Positives = 18/31 (58%), Gaps = 4/31 (12%) Frame = +3 Query: 858 PGXXP--PPXPPPXPPPX--PPPXPPXXPPP 938 PG P PP PPP PP PPP PP PPP Sbjct: 472 PGPPPGLPPGPPPRGPPPRLPPPAPPGIPPP 502 Score = 39.5 bits (88), Expect = 0.017 Identities = 20/36 (55%), Positives = 21/36 (58%), Gaps = 3/36 (8%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPX-PPXXPP--PP 941 L +LP PPP PP PPP PPP PP PP PP Sbjct: 454 LPRLLP-PGPPPGRPPGPPPGPPPGLPPGPPPRGPP 488 Score = 36.3 bits (80), Expect = 0.16 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P + + +PG PPP PP PP PP PP PP Sbjct: 399 PSQIQAPPMPG--PPPLGPPPAPPLRPPGPPTGLPP 432 Score = 36.3 bits (80), Expect = 0.16 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PP PPP PP PPP P PP Sbjct: 484 PRGPPPRLPPPAPPGIPPPRPGMMRPP 510 Score = 35.5 bits (78), Expect = 0.28 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 5/33 (15%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXP----PP-XPPXXPPPP 941 P PPP PP PPP P PP PP P PP Sbjct: 488 PPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAPP 520 Score = 35.1 bits (77), Expect = 0.37 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PP PP PP PP PPP Sbjct: 467 PPGPPPGPPPGLPPGPPPRGPPPRLPPP 494 Score = 35.1 bits (77), Expect = 0.37 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +3 Query: 855 LPGXXPPPXPPPX-PPPXPPPXPPXXP 932 LP PP PPP PPP PP PP P Sbjct: 478 LPPGPPPRGPPPRLPPPAPPGIPPPRP 504 Score = 34.3 bits (75), Expect = 0.65 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP P P PP PPP PP PP P Sbjct: 405 PPMPGP-PPLGPPPAPPLRPPGP 426 Score = 34.3 bits (75), Expect = 0.65 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 3/30 (10%) Frame = +3 Query: 858 PGXXPPPXP---PPXPPPXPPPXPPXXPPP 938 P PPP P PP PP PP PP PP Sbjct: 411 PPLGPPPAPPLRPPGPPTGLPPGPPPGAPP 440 Score = 32.7 bits (71), Expect = 2.0 Identities = 17/36 (47%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +3 Query: 831 PXRSLSXV-LPGXXPPPXPPPXPPPXPPPXPPXXPP 935 P R++S + L G P PP PP PPP PP PP Sbjct: 176 PTRAVSILPLLGHGVPRLPPGRKPPGPPPGPP--PP 209 Score = 31.5 bits (68), Expect = 4.6 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = +3 Query: 873 PPXPPPXPPPXPPP-XPPXXPPP 938 PP PP PP PPP PP PP Sbjct: 423 PPGPPTGLPPGPPPGAPPFLRPP 445 Score = 31.1 bits (67), Expect = 6.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 885 PPXPPPXPPPXPPXXPPPP 941 P PP PP PP PPPP Sbjct: 191 PRLPPGRKPPGPPPGPPPP 209 Score = 31.1 bits (67), Expect = 6.1 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPP--PP 941 L G P PP PP PP PP PP PP Sbjct: 450 LRGPLPRLLPPGPPPGRPPGPPPGPPPGLPP 480 Score = 31.1 bits (67), Expect = 6.1 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP PP P P P P P PP P PP Sbjct: 459 PPGPPPGRPPGPPPGPPPGL----PPGPPPRGPPPRLPPPAPPGIPP 501 >AB005297-1|BAA23647.1| 1584|Homo sapiens BAI 1 protein. Length = 1584 Score = 44.0 bits (99), Expect = 8e-04 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PPP PPP PPP PPPP Sbjct: 1403 PPEAPPAQPPPPPPPPPPPPQQPLPPPP 1430 Score = 41.9 bits (94), Expect = 0.003 Identities = 17/30 (56%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPP--PXPPPXPPPXPPXXPPPP 941 P PP PP P PPP PPP PP P PP Sbjct: 1399 PSGGPPEAPPAQPPPPPPPPPPPPQQPLPP 1428 Score = 41.1 bits (92), Expect = 0.006 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PP PP PP PP PPPP Sbjct: 1394 PSRQPPSGGPPEAPPAQPPPPPPPPPPP 1421 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPP-PXPPXXPPPP 941 P PPP PPP PPP P P PP P P Sbjct: 1408 PAQPPPPPPPPPPPPQQPLPPPPNLEPAP 1436 Score = 39.1 bits (87), Expect = 0.023 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P RS P PP PP PP PPP PP P P Sbjct: 1389 PARSPPSRQPPSGGPPEAPPAQPPPPPPPPPPPPQQP 1425 Score = 37.9 bits (84), Expect = 0.053 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +3 Query: 855 LPGXXPPPXPPP--XPPPXPPPXPPXXPPPP 941 LP PP PP PP PP PP PPPP Sbjct: 1388 LPARSPPSRQPPSGGPPEAPPAQPPPPPPPP 1418 Score = 36.3 bits (80), Expect = 0.16 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP P PPP P P PP Sbjct: 1411 PPPPPPPPPPPPQQPLPPP-PNLEPAPP 1437 >X86019-1|CAA60014.1| 494|Homo sapiens SH3-domain interacting protein protein. Length = 494 Score = 43.6 bits (98), Expect = 0.001 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG GGG GGG GG GGG PG Sbjct: 72 GGFGGGGGFGGGGGGGGGGSFGGGGPPG 99 Score = 39.9 bits (89), Expect = 0.013 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GGG GGG GGG GG G Sbjct: 68 GGGGGGFGGGGGFGGGGGGGGGGSFGGG 95 Score = 39.1 bits (87), Expect = 0.023 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 G GG GG GGG G G GGG GGG Sbjct: 66 GAGGGGGGFGGGGGFGGGGGGGGG 89 Score = 36.7 bits (81), Expect = 0.12 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 G G GG G G GGG GGG GGG Sbjct: 64 GAGAGGGGGGFGGGGGFGGGGGGG 87 Score = 35.1 bits (77), Expect = 0.37 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GGG G G GGG G Sbjct: 64 GAGAGGGGGGFGGGGGFGGGGGGGGG 89 Score = 34.7 bits (76), Expect = 0.49 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P R+LS L PP P P PPP P PPPP Sbjct: 335 PQRNLS--LSSSTPPLPSPGRSGPLPPPVPSERPPPP 369 Score = 31.5 bits (68), Expect = 4.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GG GGG G GG Sbjct: 81 GGGGGGGGGGSFGGGGPPGLGG 102 >X52426-1|CAA36673.1| 420|Homo sapiens cytokeratin 13 protein. Length = 420 Score = 43.6 bits (98), Expect = 0.001 Identities = 18/27 (66%), Positives = 18/27 (66%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GGG GGG G Sbjct: 62 GGGYGGGLGGGYGGGLGGGFGGGFAGG 88 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG G GGG GGG GGG GGG G Sbjct: 54 GGGAGSGFGGGYGGGLGGGYGGGLGGG 80 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG GGG GGG GGG GGG G Sbjct: 58 GSGFGGGYGGGLGGGYGGGLGGGFGGG 84 Score = 37.5 bits (83), Expect = 0.070 Identities = 18/31 (58%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = -2 Query: 940 GGG---GXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG G GG G G GGG GGG GGG G Sbjct: 46 GGGVSCGFGGGAGSGFGGGYGGGLGGGYGGG 76 Score = 32.7 bits (71), Expect = 2.0 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG GG GGG G GGG G G G Sbjct: 39 GGSAGGYGGGVSCGFGGGAGSGFGGG 64 Score = 32.7 bits (71), Expect = 2.0 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG GG G GGG G G GGG G Sbjct: 43 GGYGGGVSCGFGGGAGSGFGGGYGGG 68 >X14640-1|CAA32786.1| 458|Homo sapiens keratin 13 protein. Length = 458 Score = 43.6 bits (98), Expect = 0.001 Identities = 18/27 (66%), Positives = 18/27 (66%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GGG GGG G Sbjct: 62 GGGYGGGLGGGYGGGLGGGFGGGFAGG 88 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG G GGG GGG GGG GGG G Sbjct: 54 GGGADSGFGGGYGGGLGGGYGGGLGGG 80 Score = 39.9 bits (89), Expect = 0.013 Identities = 19/31 (61%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Frame = -2 Query: 940 GGG---GXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG G GG GGG GGG GGG GGG G Sbjct: 54 GGGADSGFGGGYGGGLGGGYGGGLGGGFGGG 84 Score = 34.7 bits (76), Expect = 0.49 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 3/31 (9%) Frame = -2 Query: 940 GGG---GXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG G GG G GGG GGG GGG G Sbjct: 46 GGGVSCGFGGGADSGFGGGYGGGLGGGYGGG 76 >BX640870-1|CAE45928.1| 510|Homo sapiens hypothetical protein protein. Length = 510 Score = 43.6 bits (98), Expect = 0.001 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG GGG GGG GG GGG PG Sbjct: 72 GGFGGGGGFGGGGGGGGGGSFGGGGPPG 99 Score = 39.9 bits (89), Expect = 0.013 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GGG GGG GGG GG G Sbjct: 68 GGGGGGFGGGGGFGGGGGGGGGGSFGGG 95 Score = 39.1 bits (87), Expect = 0.023 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 G GG GG GGG G G GGG GGG Sbjct: 66 GAGGGGGGFGGGGGFGGGGGGGGG 89 Score = 36.7 bits (81), Expect = 0.12 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 G G GG G G GGG GGG GGG Sbjct: 64 GAGAGGGGGGFGGGGGFGGGGGGG 87 Score = 35.1 bits (77), Expect = 0.37 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GGG G G GGG G Sbjct: 64 GAGAGGGGGGFGGGGGFGGGGGGGGG 89 Score = 32.3 bits (70), Expect = 2.6 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPP 923 PP PPP P PPP PP Sbjct: 307 PPPPPPPSRPGPPPLPP 323 Score = 31.5 bits (68), Expect = 4.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GG GGG G GG Sbjct: 81 GGGGGGGGGGSFGGGGPPGLGG 102 Score = 31.5 bits (68), Expect = 4.6 Identities = 13/37 (35%), Positives = 16/37 (43%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P ++ +P P PPP PPP P PP P Sbjct: 286 PPQNNKPPVPSTPRPSASSQAPPPPPPPSRPGPPPLP 322 Score = 30.7 bits (66), Expect = 8.0 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P R+LS L PP P P PPP P PPPP Sbjct: 335 PQRNLS--LSSSTPPLPSPGRSGPLPPP-PSERPPPP 368 >BC126184-1|AAI26185.1| 458|Homo sapiens keratin 13 protein. Length = 458 Score = 43.6 bits (98), Expect = 0.001 Identities = 18/27 (66%), Positives = 18/27 (66%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GGG GGG G Sbjct: 62 GGGYGGGLGGGYGGGLGGGFGGGFAGG 88 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG G GGG GGG GGG GGG G Sbjct: 54 GGGAGSGFGGGYGGGLGGGYGGGLGGG 80 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG GGG GGG GGG GGG G Sbjct: 58 GSGFGGGYGGGLGGGYGGGLGGGFGGG 84 Score = 37.5 bits (83), Expect = 0.070 Identities = 18/31 (58%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = -2 Query: 940 GGG---GXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG G GG G G GGG GGG GGG G Sbjct: 46 GGGVSCGFGGGAGSGFGGGYGGGLGGGYGGG 76 Score = 32.7 bits (71), Expect = 2.0 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG GG GGG G GGG G G G Sbjct: 39 GGSAGGYGGGVSCGFGGGAGSGFGGG 64 Score = 32.7 bits (71), Expect = 2.0 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG GG G GGG G G GGG G Sbjct: 43 GGYGGGVSCGFGGGAGSGFGGGYGGG 68 >BC110288-1|AAI10289.1| 403|Homo sapiens WIPF1 protein protein. Length = 403 Score = 43.6 bits (98), Expect = 0.001 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG GGG GGG GG GGG PG Sbjct: 72 GGFGGGGGFGGGGGGGGGGSFGGGGPPG 99 Score = 39.9 bits (89), Expect = 0.013 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GGG GGG GGG GG G Sbjct: 68 GGGGGGFGGGGGFGGGGGGGGGGSFGGG 95 Score = 39.1 bits (87), Expect = 0.023 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 G GG GG GGG G G GGG GGG Sbjct: 66 GAGGGGGGFGGGGGFGGGGGGGGG 89 Score = 36.7 bits (81), Expect = 0.12 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 G G GG G G GGG GGG GGG Sbjct: 64 GAGAGGGGGGFGGGGGFGGGGGGG 87 Score = 35.1 bits (77), Expect = 0.37 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GGG G G GGG G Sbjct: 64 GAGAGGGGGGFGGGGGFGGGGGGGGG 89 Score = 32.3 bits (70), Expect = 2.6 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPP 923 PP PPP P PPP PP Sbjct: 307 PPPPPPPSRPGPPPLPP 323 Score = 31.5 bits (68), Expect = 4.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GG GGG G GG Sbjct: 81 GGGGGGGGGGSFGGGGPPGLGG 102 Score = 31.5 bits (68), Expect = 4.6 Identities = 13/37 (35%), Positives = 16/37 (43%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P ++ +P P PPP PPP P PP P Sbjct: 286 PPQNNKPPVPSTPRPSASSQAPPPPPPPSRPGPPPLP 322 Score = 30.7 bits (66), Expect = 8.0 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P R+LS L PP P P PPP P PPPP Sbjct: 335 PQRNLS--LSSSTPPLPSPGRSGPLPPP-PSERPPPP 368 >BC087835-1|AAH87835.1| 338|Homo sapiens FAM44A protein protein. Length = 338 Score = 43.6 bits (98), Expect = 0.001 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PP PPP P P PP PP P Sbjct: 5 PQPQPPPPAPPPPPPQPQPQPPPPPPGP 32 Score = 34.3 bits (75), Expect = 0.65 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P PPP P P P P PPP P P Sbjct: 11 PPAPPPPPPQPQPQPPPPPPGPGAGP 36 >BC077718-1|AAH77718.2| 458|Homo sapiens keratin 13 protein. Length = 458 Score = 43.6 bits (98), Expect = 0.001 Identities = 18/27 (66%), Positives = 18/27 (66%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GGG GGG G Sbjct: 62 GGGYGGGLGGGYGGGLGGGFGGGFAGG 88 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG G GGG GGG GGG GGG G Sbjct: 54 GGGAGSGFGGGYGGGLGGGYGGGLGGG 80 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG GGG GGG GGG GGG G Sbjct: 58 GSGFGGGYGGGLGGGYGGGLGGGFGGG 84 Score = 37.5 bits (83), Expect = 0.070 Identities = 18/31 (58%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = -2 Query: 940 GGG---GXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG G GG G G GGG GGG GGG G Sbjct: 46 GGGVSCGFGGGAGSGFGGGYGGGLGGGYGGG 76 Score = 32.7 bits (71), Expect = 2.0 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG GG GGG G GGG G G G Sbjct: 39 GGSAGGYGGGVSCGFGGGAGSGFGGG 64 Score = 32.7 bits (71), Expect = 2.0 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG GG G GGG G G GGG G Sbjct: 43 GGYGGGVSCGFGGGAGSGFGGGYGGG 68 >BC065546-1|AAH65546.1| 338|Homo sapiens FAM44A protein protein. Length = 338 Score = 43.6 bits (98), Expect = 0.001 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PP PPP P P PP PP P Sbjct: 5 PQPQPPPPAPPPPPPQPQPQPPPPPPGP 32 Score = 34.3 bits (75), Expect = 0.65 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P PPP P P P P PPP P P Sbjct: 11 PPAPPPPPPQPQPQPPPPPPGPGAGP 36 >BC002914-1|AAH02914.1| 358|Homo sapiens WIPF1 protein protein. Length = 358 Score = 43.6 bits (98), Expect = 0.001 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG GGG GGG GG GGG PG Sbjct: 72 GGFGGGGGFGGGGGGGGGGSFGGGGPPG 99 Score = 39.9 bits (89), Expect = 0.013 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GGG GGG GGG GG G Sbjct: 68 GGGGGGFGGGGGFGGGGGGGGGGSFGGG 95 Score = 39.1 bits (87), Expect = 0.023 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 G GG GG GGG G G GGG GGG Sbjct: 66 GAGGGGGGFGGGGGFGGGGGGGGG 89 Score = 36.7 bits (81), Expect = 0.12 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 G G GG G G GGG GGG GGG Sbjct: 64 GAGAGGGGGGFGGGGGFGGGGGGG 87 Score = 35.1 bits (77), Expect = 0.37 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GGG G G GGG G Sbjct: 64 GAGAGGGGGGFGGGGGFGGGGGGGGG 89 Score = 33.1 bits (72), Expect = 1.5 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 4/36 (11%) Frame = +3 Query: 846 SXVLPGXXPPPXPPPXPPPXPPPXPP----XXPPPP 941 S +PG P P P PPP P PP PPPP Sbjct: 203 SPPVPGGPRQPSPGPTPPPPPVRDPPGRSGPLPPPP 238 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 PG PPP P PP P PP PPP Sbjct: 215 PGPTPPPPPVRDPPGRSGPLPP--PPP 239 Score = 31.5 bits (68), Expect = 4.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GG GGG G GG Sbjct: 81 GGGGGGGGGGSFGGGGPPGLGG 102 >BC002661-1|AAH02661.3| 458|Homo sapiens keratin 13 protein. Length = 458 Score = 43.6 bits (98), Expect = 0.001 Identities = 18/27 (66%), Positives = 18/27 (66%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GGG GGG G Sbjct: 62 GGGYGGGLGGGYGGGLGGGFGGGFAGG 88 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG G GGG GGG GGG GGG G Sbjct: 54 GGGAGSGFGGGYGGGLGGGYGGGLGGG 80 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG GGG GGG GGG GGG G Sbjct: 58 GSGFGGGYGGGLGGGYGGGLGGGFGGG 84 Score = 37.5 bits (83), Expect = 0.070 Identities = 18/31 (58%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = -2 Query: 940 GGG---GXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG G GG G G GGG GGG GGG G Sbjct: 46 GGGVSCGFGGGAGSGFGGGYGGGLGGGYGGG 76 Score = 32.7 bits (71), Expect = 2.0 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG GG GGG G GGG G G G Sbjct: 39 GGSAGGYGGGVSCGFGGGAGSGFGGG 64 Score = 32.7 bits (71), Expect = 2.0 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG GG G GGG G G GGG G Sbjct: 43 GGYGGGVSCGFGGGAGSGFGGGYGGG 68 >AK223077-1|BAD96797.1| 458|Homo sapiens keratin 13 isoform a variant protein. Length = 458 Score = 43.6 bits (98), Expect = 0.001 Identities = 18/27 (66%), Positives = 18/27 (66%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GGG GGG G Sbjct: 62 GGGYGGGLGGGYGGGLGGGFGGGFAGG 88 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG G GGG GGG GGG GGG G Sbjct: 54 GGGAGSGFGGGYGGGLGGGYGGGLGGG 80 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG GGG GGG GGG GGG G Sbjct: 58 GSGFGGGYGGGLGGGYGGGLGGGFGGG 84 Score = 36.3 bits (80), Expect = 0.16 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG G G GGG GGG GGG G Sbjct: 52 GFGGGAGSGFGGGYGGGLGGGYGGG 76 Score = 35.1 bits (77), Expect = 0.37 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GGG G G GGG GGG G Sbjct: 47 GGVSCGFGGGAGSGFGGGYGGGLGGG 72 Score = 32.7 bits (71), Expect = 2.0 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG GG G GGG G G GGG G Sbjct: 43 GGYRGGVSCGFGGGAGSGFGGGYGGG 68 >AK223051-1|BAD96771.1| 458|Homo sapiens keratin 13 isoform a variant protein. Length = 458 Score = 43.6 bits (98), Expect = 0.001 Identities = 18/27 (66%), Positives = 18/27 (66%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GGG GGG G Sbjct: 62 GGGYGGGLGGGYGGGLGGGFGGGFAGG 88 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG G GGG GGG GGG GGG G Sbjct: 54 GGGAGSGFGGGYGGGLGGGYGGGLGGG 80 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG GGG GGG GGG GGG G Sbjct: 58 GSGFGGGYGGGLGGGYGGGLGGGFGGG 84 Score = 36.3 bits (80), Expect = 0.16 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG G G GGG GGG GGG G Sbjct: 52 GFGGGAGSGFGGGYGGGLGGGYGGG 76 Score = 35.1 bits (77), Expect = 0.37 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GGG G G GGG GGG G Sbjct: 47 GGVSCGFGGGAGSGFGGGYGGGLGGG 72 Score = 32.7 bits (71), Expect = 2.0 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG GG G GGG G G GGG G Sbjct: 43 GGYRGGVSCGFGGGAGSGFGGGYGGG 68 >AK128867-1|BAC87651.1| 121|Homo sapiens protein ( Homo sapiens cDNA FLJ46838 fis, clone UTERU2035926. ). Length = 121 Score = 43.6 bits (98), Expect = 0.001 Identities = 16/28 (57%), Positives = 17/28 (60%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPP 914 P +L PG PPP PPP PPP PPP Sbjct: 76 PLPALHSAAPGLPPPPPPPPPPPPLPPP 103 Score = 36.7 bits (81), Expect = 0.12 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PP PPPP Sbjct: 85 PGLPPPPPPPPPPPPLPPPP 104 Score = 35.5 bits (78), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPP 938 P PPP PP PPP PP PPP Sbjct: 85 PGLPPPPPP--PPPPPPLPPPP 104 Score = 31.1 bits (67), Expect = 6.1 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +3 Query: 873 PPXPP--PXPPPXPPPXPPXXPPPP 941 PP P P PPP PP PPPP Sbjct: 75 PPLPALHSAAPGLPPPPPPPPPPPP 99 >AK091683-1|BAC03720.1| 749|Homo sapiens protein ( Homo sapiens cDNA FLJ34364 fis, clone FEBRA2015175, weakly similar to Mus musculus (clone E5.53) Huntington disease (hdh) gene. ). Length = 749 Score = 43.6 bits (98), Expect = 0.001 Identities = 18/37 (48%), Positives = 20/37 (54%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P ++L P PPP PP PP PPP PP PP P Sbjct: 648 PNKALVHPPPPPPPPPPPPLALPPPPPPPPPLPPPLP 684 Score = 34.7 bits (76), Expect = 0.49 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = +3 Query: 858 PGXXPP---PXPPPXPPPXPPPXPPXXPP 935 P PP P PPP PPP PPP P P Sbjct: 661 PPPPPPLALPPPPPPPPPLPPPLPNAEVP 689 Score = 32.3 bits (70), Expect = 2.6 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXP--XXPXTXXXPP 933 PP PP P PP P P P P P PP P P PP Sbjct: 655 PPPPPPPPPPPPLALPPP------PPPPPPLPPPLPNAEVPSDQKQPP 696 Score = 32.3 bits (70), Expect = 2.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP P P P Sbjct: 672 PPPPPPPLPPPLPNAEVPSDQKQP 695 >AK056450-1|BAB71186.1| 568|Homo sapiens protein ( Homo sapiens cDNA FLJ31888 fis, clone NT2RP7003055. ). Length = 568 Score = 43.6 bits (98), Expect = 0.001 Identities = 18/37 (48%), Positives = 20/37 (54%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P ++L P PPP PP PP PPP PP PP P Sbjct: 330 PNKALVHPPPPPPPPPPPPLALPPPPPPPPPLPPPLP 366 Score = 34.7 bits (76), Expect = 0.49 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = +3 Query: 858 PGXXPP---PXPPPXPPPXPPPXPPXXPP 935 P PP P PPP PPP PPP P P Sbjct: 343 PPPPPPLALPPPPPPPPPLPPPLPNAEVP 371 Score = 32.3 bits (70), Expect = 2.6 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXP--XXPXTXXXPP 933 PP PP P PP P P P P P PP P P PP Sbjct: 337 PPPPPPPPPPPPLALPPP------PPPPPPLPPPLPNAEVPSDQKQPP 378 Score = 32.3 bits (70), Expect = 2.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP P P P Sbjct: 354 PPPPPPPLPPPLPNAEVPSDQKQP 377 >AF528529-1|AAM94279.1| 502|Homo sapiens hypothetical protein protein. Length = 502 Score = 43.6 bits (98), Expect = 0.001 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PP PPP P P PP PP P Sbjct: 5 PQPQPPPPAPPPPPPQPQPQPPPPPPGP 32 Score = 34.3 bits (75), Expect = 0.65 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P PPP P P P P PPP P P Sbjct: 11 PPAPPPPPPQPQPQPPPPPPGPGAGP 36 >AF049259-1|AAC35754.1| 420|Homo sapiens keratin 13 protein. Length = 420 Score = 43.6 bits (98), Expect = 0.001 Identities = 18/27 (66%), Positives = 18/27 (66%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GGG GGG G Sbjct: 62 GGGYGGGLGGGYGGGLGGGFGGGFAGG 88 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG G GGG GGG GGG GGG G Sbjct: 54 GGGAGSGFGGGYGGGLGGGYGGGLGGG 80 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG GGG GGG GGG GGG G Sbjct: 58 GSGFGGGYGGGLGGGYGGGLGGGFGGG 84 Score = 37.5 bits (83), Expect = 0.070 Identities = 18/31 (58%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = -2 Query: 940 GGG---GXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG G GG G G GGG GGG GGG G Sbjct: 46 GGGVSCGFGGGAGSGFGGGYGGGLGGGYGGG 76 Score = 32.7 bits (71), Expect = 2.0 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG GG GGG G GGG G G G Sbjct: 39 GGSAGGYGGGVSCGFGGGAGSGFGGG 64 Score = 32.7 bits (71), Expect = 2.0 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG GG G GGG G G GGG G Sbjct: 43 GGYGGGVSCGFGGGAGSGFGGGYGGG 68 >AF031588-1|AAC03767.1| 503|Homo sapiens WASP interacting protein protein. Length = 503 Score = 43.6 bits (98), Expect = 0.001 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG GGG GGG GG GGG PG Sbjct: 72 GGFGGGGGFGGGGGGGGGGSFGGGGPPG 99 Score = 39.9 bits (89), Expect = 0.013 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GGG GGG GGG GG G Sbjct: 68 GGGGGGFGGGGGFGGGGGGGGGGSFGGG 95 Score = 39.1 bits (87), Expect = 0.023 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 G GG GG GGG G G GGG GGG Sbjct: 66 GAGGGGGGFGGGGGFGGGGGGGGG 89 Score = 36.7 bits (81), Expect = 0.12 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 G G GG G G GGG GGG GGG Sbjct: 64 GAGAGGGGGGFGGGGGFGGGGGGG 87 Score = 35.1 bits (77), Expect = 0.37 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GGG G G GGG G Sbjct: 64 GAGAGGGGGGFGGGGGFGGGGGGGGG 89 Score = 31.5 bits (68), Expect = 4.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GG GGG G GG Sbjct: 81 GGGGGGGGGGSFGGGGPPGLGG 102 Score = 30.7 bits (66), Expect = 8.0 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P R+LS L PP P P PPP P PPPP Sbjct: 335 PQRNLS--LSSSTPPLPSPGRSGPLPPP-PSERPPPP 368 >AC010894-2|AAY14708.1| 503|Homo sapiens unknown protein. Length = 503 Score = 43.6 bits (98), Expect = 0.001 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG GGG GGG GG GGG PG Sbjct: 72 GGFGGGGGFGGGGGGGGGGSFGGGGPPG 99 Score = 39.9 bits (89), Expect = 0.013 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GGG GGG GGG GG G Sbjct: 68 GGGGGGFGGGGGFGGGGGGGGGGSFGGG 95 Score = 39.1 bits (87), Expect = 0.023 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 G GG GG GGG G G GGG GGG Sbjct: 66 GAGGGGGGFGGGGGFGGGGGGGGG 89 Score = 36.7 bits (81), Expect = 0.12 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 G G GG G G GGG GGG GGG Sbjct: 64 GAGAGGGGGGFGGGGGFGGGGGGG 87 Score = 35.1 bits (77), Expect = 0.37 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GGG G G GGG G Sbjct: 64 GAGAGGGGGGFGGGGGFGGGGGGGGG 89 Score = 32.3 bits (70), Expect = 2.6 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPP 923 PP PPP P PPP PP Sbjct: 307 PPPPPPPSRPGPPPLPP 323 Score = 31.5 bits (68), Expect = 4.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GG GGG G GG Sbjct: 81 GGGGGGGGGGSFGGGGPPGLGG 102 Score = 31.5 bits (68), Expect = 4.6 Identities = 13/37 (35%), Positives = 16/37 (43%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P ++ +P P PPP PPP P PP P Sbjct: 286 PPQNNKPPVPSTPRPSASSQAPPPPPPPSRPGPPPLP 322 Score = 30.7 bits (66), Expect = 8.0 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P R+LS L PP P P PPP P PPPP Sbjct: 335 PQRNLS--LSSSTPPLPSPGRSGPLPPP-PSERPPPP 368 >AB051500-1|BAB21804.2| 1652|Homo sapiens KIAA1713 protein protein. Length = 1652 Score = 43.6 bits (98), Expect = 0.001 Identities = 18/37 (48%), Positives = 20/37 (54%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P ++L P PPP PP PP PPP PP PP P Sbjct: 1414 PNKALVHPPPPPPPPPPPPLALPPPPPPPPPLPPPLP 1450 Score = 34.7 bits (76), Expect = 0.49 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = +3 Query: 858 PGXXPP---PXPPPXPPPXPPPXPPXXPP 935 P PP P PPP PPP PPP P P Sbjct: 1427 PPPPPPLALPPPPPPPPPLPPPLPNAEVP 1455 Score = 32.3 bits (70), Expect = 2.6 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXP--XXPXTXXXPP 933 PP PP P PP P P P P P PP P P PP Sbjct: 1421 PPPPPPPPPPPPLALPPP------PPPPPPLPPPLPNAEVPSDQKQPP 1462 Score = 32.3 bits (70), Expect = 2.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP P P P Sbjct: 1438 PPPPPPPLPPPLPNAEVPSDQKQP 1461 >U19927-1|AAC50140.1| 502|Homo sapiens WAS protein. Length = 502 Score = 43.2 bits (97), Expect = 0.001 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PP PPP PPP PPP P PP Sbjct: 386 PGAGGPPMPPPPPPPPPPPSSGNGPAPP 413 Score = 40.7 bits (91), Expect = 0.008 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPP 938 G PPP P PP PPP PP PPP Sbjct: 379 GPLPPPPPGAGGPPMPPPPPPPPPPP 404 Score = 38.7 bits (86), Expect = 0.030 Identities = 19/37 (51%), Positives = 19/37 (51%), Gaps = 10/37 (27%) Frame = +3 Query: 861 GXXPPPXPP------PXPPPXP----PPXPPXXPPPP 941 G PPP PP P PPP P PP PP PPPP Sbjct: 365 GGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPP 401 Score = 36.7 bits (81), Expect = 0.12 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 5/31 (16%) Frame = +3 Query: 858 PGXXPPPXPPPXPP-----PXPPPXPPXXPP 935 P PPP PPP PP P PPP PP P Sbjct: 391 PPMPPPPPPPPPPPSSGNGPAPPPLPPALVP 421 Score = 35.9 bits (79), Expect = 0.21 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP+P P PP P P P P PP P PPP Sbjct: 353 PPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPP 399 Score = 35.1 bits (77), Expect = 0.37 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = +3 Query: 753 PXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXP 932 P PP P R L V G PPP P PPP PP P Sbjct: 312 PLPPPPPPSRGGNQLPRPPIVGGNKGRSGPLPPVPLGIAPPPPTPRGPPPPGRGGPPPPP 371 Query: 933 PP 938 PP Sbjct: 372 PP 373 Score = 32.7 bits (71), Expect = 2.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PP PPP PPP P PP P Sbjct: 390 GPPMPPPPPPPPPPPSSGNGPAPPPLP 416 Score = 32.3 bits (70), Expect = 2.6 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P P P P P P PP P P + P P Sbjct: 367 PPPPPPPATGRSGPLPPPPPGAGGPPMPPPP-PPPPPPPSSGNGPAP 412 >U12707-1|AAA62663.1| 502|Homo sapiens Wiskott-Aldrich syndrome protein protein. Length = 502 Score = 43.2 bits (97), Expect = 0.001 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PP PPP PPP PPP P PP Sbjct: 386 PGAGGPPMPPPPPPPPPPPSSGNGPAPP 413 Score = 40.7 bits (91), Expect = 0.008 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPP 938 G PPP P PP PPP PP PPP Sbjct: 379 GPLPPPPPGAGGPPMPPPPPPPPPPP 404 Score = 38.7 bits (86), Expect = 0.030 Identities = 19/37 (51%), Positives = 19/37 (51%), Gaps = 10/37 (27%) Frame = +3 Query: 861 GXXPPPXPP------PXPPPXP----PPXPPXXPPPP 941 G PPP PP P PPP P PP PP PPPP Sbjct: 365 GGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPP 401 Score = 36.7 bits (81), Expect = 0.12 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 5/31 (16%) Frame = +3 Query: 858 PGXXPPPXPPPXPP-----PXPPPXPPXXPP 935 P PPP PPP PP P PPP PP P Sbjct: 391 PPMPPPPPPPPPPPSSGNGPAPPPLPPALVP 421 Score = 35.9 bits (79), Expect = 0.21 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP+P P PP P P P P PP P PPP Sbjct: 353 PPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPP 399 Score = 35.1 bits (77), Expect = 0.37 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = +3 Query: 753 PXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXP 932 P PP P R L V G PPP P PPP PP P Sbjct: 312 PLPPPPPPSRGGNQLPRPPIVGGNKGRSGPLPPVPLGIAPPPPTPRGPPPPGRGGPPPPP 371 Query: 933 PP 938 PP Sbjct: 372 PP 373 Score = 32.7 bits (71), Expect = 2.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PP PPP PPP P PP P Sbjct: 390 GPPMPPPPPPPPPPPSSGNGPAPPPLP 416 Score = 32.3 bits (70), Expect = 2.6 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P P P P P P PP P P + P P Sbjct: 367 PPPPPPPATGRSGPLPPPPPGAGGPPMPPPP-PPPPPPPSSGNGPAP 412 >BC095481-1|AAH95481.1| 591|Homo sapiens enabled homolog (Drosophila) protein. Length = 591 Score = 43.2 bits (97), Expect = 0.001 Identities = 18/31 (58%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPP---PXPPPXPPPXPPXXPPPP 941 PG PPP P P PPP PPP P PPPP Sbjct: 334 PGPPPPPPLPSTGPPPPPPPPPLPNQVPPPP 364 Score = 42.3 bits (95), Expect = 0.002 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PP PPP P PP PPPP Sbjct: 331 PPPPGPPPPPPLPSTGPPPPPPPP 354 Score = 41.9 bits (94), Expect = 0.003 Identities = 18/32 (56%), Positives = 18/32 (56%), Gaps = 3/32 (9%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPX---PPPXPPXXPPPP 941 LP PPP PPP P P PPP PP PP P Sbjct: 342 LPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 373 Score = 39.5 bits (88), Expect = 0.017 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +3 Query: 846 SXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 S LP PP PPP P PPP PP P P Sbjct: 327 SVALPPPPGPPPPPPLPSTGPPPPPPPPPLP 357 Score = 33.9 bits (74), Expect = 0.86 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 8/42 (19%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPPPXPPPX--------PPPXPPXXPPPP 941 S ++ G PP PPP PP PPP PP PP P Sbjct: 302 SQQGIVLGPLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLP 343 Score = 33.5 bits (73), Expect = 1.1 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P P P PP P P + P P P PP P P T PPP Sbjct: 310 PLAPPPPPP---LPPGPAQASVALP-PPPGPPPPPPLPSTGPPPPP 351 Score = 31.1 bits (67), Expect = 6.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXP 912 PP PP P PP P P P P PP P P Sbjct: 333 PPGPP-PPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAP 370 Score = 31.1 bits (67), Expect = 6.1 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXP 912 P PP P P P P L P P PP P P Sbjct: 336 PPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 373 >BC065238-1|AAH65238.1| 527|Homo sapiens ENAH protein protein. Length = 527 Score = 43.2 bits (97), Expect = 0.001 Identities = 18/31 (58%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPP---PXPPPXPPPXPPXXPPPP 941 PG PPP P P PPP PPP P PPPP Sbjct: 291 PGPPPPPPLPSTGPPPPPPPPPLPNQVPPPP 321 Score = 42.3 bits (95), Expect = 0.002 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PP PPP P PP PPPP Sbjct: 288 PPPPGPPPPPPLPSTGPPPPPPPP 311 Score = 41.9 bits (94), Expect = 0.003 Identities = 18/32 (56%), Positives = 18/32 (56%), Gaps = 3/32 (9%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPX---PPPXPPXXPPPP 941 LP PPP PPP P P PPP PP PP P Sbjct: 299 LPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 330 Score = 39.5 bits (88), Expect = 0.017 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +3 Query: 846 SXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 S LP PP PPP P PPP PP P P Sbjct: 284 SVALPPPPGPPPPPPLPSTGPPPPPPPPPLP 314 Score = 33.9 bits (74), Expect = 0.86 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 8/42 (19%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPPPXPPPX--------PPPXPPXXPPPP 941 S ++ G PP PPP PP PPP PP PP P Sbjct: 259 SQQGIVLGPLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLP 300 Score = 33.5 bits (73), Expect = 1.1 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P P P PP P P + P P P PP P P T PPP Sbjct: 267 PLAPPPPPP---LPPGPAQASVALP-PPPGPPPPPPLPSTGPPPPP 308 Score = 31.1 bits (67), Expect = 6.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXP 912 PP PP P PP P P P P PP P P Sbjct: 290 PPGPP-PPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAP 327 Score = 31.1 bits (67), Expect = 6.1 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXP 912 P PP P P P P L P P PP P P Sbjct: 293 PPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 330 >BC012738-1|AAH12738.1| 502|Homo sapiens Wiskott-Aldrich syndrome (eczema-thrombocytopenia) protein. Length = 502 Score = 43.2 bits (97), Expect = 0.001 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PP PPP PPP PPP P PP Sbjct: 386 PGAGGPPMPPPPPPPPPPPSSGNGPAPP 413 Score = 40.7 bits (91), Expect = 0.008 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPP 938 G PPP P PP PPP PP PPP Sbjct: 379 GPLPPPPPGAGGPPMPPPPPPPPPPP 404 Score = 38.7 bits (86), Expect = 0.030 Identities = 19/37 (51%), Positives = 19/37 (51%), Gaps = 10/37 (27%) Frame = +3 Query: 861 GXXPPPXPP------PXPPPXP----PPXPPXXPPPP 941 G PPP PP P PPP P PP PP PPPP Sbjct: 365 GGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPP 401 Score = 36.7 bits (81), Expect = 0.12 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 5/31 (16%) Frame = +3 Query: 858 PGXXPPPXPPPXPP-----PXPPPXPPXXPP 935 P PPP PPP PP P PPP PP P Sbjct: 391 PPMPPPPPPPPPPPSSGNGPAPPPLPPALVP 421 Score = 35.9 bits (79), Expect = 0.21 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP+P P PP P P P P PP P PPP Sbjct: 353 PPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPP 399 Score = 35.1 bits (77), Expect = 0.37 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = +3 Query: 753 PXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXP 932 P PP P R L V G PPP P PPP PP P Sbjct: 312 PLPPPPPPSRGGNQLPRPPIVGGNKGRSGPLPPVPLGIAPPPPTPRGPPPPGRGGPPPPP 371 Query: 933 PP 938 PP Sbjct: 372 PP 373 Score = 32.7 bits (71), Expect = 2.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PP PPP PPP P PP P Sbjct: 390 GPPMPPPPPPPPPPPSSGNGPAPPPLP 416 Score = 32.3 bits (70), Expect = 2.6 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P P P P P P PP P P + P P Sbjct: 367 PPPPPPPATGRSGPLPPPPPGAGGPPMPPPP-PPPPPPPSSGNGPAP 412 >BC002961-1|AAH02961.1| 514|Homo sapiens WAS protein protein. Length = 514 Score = 43.2 bits (97), Expect = 0.001 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PP PPP PPP PPP P PP Sbjct: 398 PGAGGPPMPPPPPPPPPPPSSGNGPAPP 425 Score = 40.7 bits (91), Expect = 0.008 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPP 938 G PPP P PP PPP PP PPP Sbjct: 391 GPLPPPPPGAGGPPMPPPPPPPPPPP 416 Score = 38.7 bits (86), Expect = 0.030 Identities = 19/37 (51%), Positives = 19/37 (51%), Gaps = 10/37 (27%) Frame = +3 Query: 861 GXXPPPXPP------PXPPPXP----PPXPPXXPPPP 941 G PPP PP P PPP P PP PP PPPP Sbjct: 377 GGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPP 413 Score = 36.7 bits (81), Expect = 0.12 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 5/31 (16%) Frame = +3 Query: 858 PGXXPPPXPPPXPP-----PXPPPXPPXXPP 935 P PPP PPP PP P PPP PP P Sbjct: 403 PPMPPPPPPPPPPPSSGNGPAPPPLPPALVP 433 Score = 35.9 bits (79), Expect = 0.21 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP+P P PP P P P P PP P PPP Sbjct: 365 PPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPP 411 Score = 35.1 bits (77), Expect = 0.37 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = +3 Query: 753 PXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXP 932 P PP P R L V G PPP P PPP PP P Sbjct: 324 PLPPPPPPSRGGNQLPRPPIVGGNKGRSGPLPPVPLGIAPPPPTPRGPPPPGRGGPPPPP 383 Query: 933 PP 938 PP Sbjct: 384 PP 385 Score = 32.7 bits (71), Expect = 2.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PP PPP PPP P PP P Sbjct: 402 GPPMPPPPPPPPPPPSSGNGPAPPPLP 428 Score = 32.3 bits (70), Expect = 2.6 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P P P P P P PP P P + P P Sbjct: 379 PPPPPPPATGRSGPLPPPPPGAGGPPMPPPP-PPPPPPPSSGNGPAP 424 >AY345143-1|AAR04685.1| 570|Homo sapiens MENA protein. Length = 570 Score = 43.2 bits (97), Expect = 0.001 Identities = 18/31 (58%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPP---PXPPPXPPPXPPXXPPPP 941 PG PPP P P PPP PPP P PPPP Sbjct: 334 PGPPPPPPLPSTGPPPPPPPPPLPNQVPPPP 364 Score = 42.3 bits (95), Expect = 0.002 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PP PPP P PP PPPP Sbjct: 331 PPPPGPPPPPPLPSTGPPPPPPPP 354 Score = 41.9 bits (94), Expect = 0.003 Identities = 18/32 (56%), Positives = 18/32 (56%), Gaps = 3/32 (9%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPX---PPPXPPXXPPPP 941 LP PPP PPP P P PPP PP PP P Sbjct: 342 LPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 373 Score = 39.5 bits (88), Expect = 0.017 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +3 Query: 846 SXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 S LP PP PPP P PPP PP P P Sbjct: 327 SVALPPPPGPPPPPPLPSTGPPPPPPPPPLP 357 Score = 33.9 bits (74), Expect = 0.86 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 8/42 (19%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPPPXPPPX--------PPPXPPXXPPPP 941 S ++ G PP PPP PP PPP PP PP P Sbjct: 302 SQQGIVLGPLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLP 343 Score = 33.5 bits (73), Expect = 1.1 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P P P PP P P + P P P PP P P T PPP Sbjct: 310 PLAPPPPPP---LPPGPAQASVALP-PPPGPPPPPPLPSTGPPPPP 351 Score = 31.1 bits (67), Expect = 6.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXP 912 PP PP P PP P P P P PP P P Sbjct: 333 PPGPP-PPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAP 370 Score = 31.1 bits (67), Expect = 6.1 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXP 912 P PP P P P P L P P PP P P Sbjct: 336 PPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 373 >AL591380-2|CAH71476.1| 570|Homo sapiens enabled homolog (Drosophila) protein. Length = 570 Score = 43.2 bits (97), Expect = 0.001 Identities = 18/31 (58%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPP---PXPPPXPPPXPPXXPPPP 941 PG PPP P P PPP PPP P PPPP Sbjct: 334 PGPPPPPPLPSTGPPPPPPPPPLPNQVPPPP 364 Score = 42.3 bits (95), Expect = 0.002 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PP PPP P PP PPPP Sbjct: 331 PPPPGPPPPPPLPSTGPPPPPPPP 354 Score = 41.9 bits (94), Expect = 0.003 Identities = 18/32 (56%), Positives = 18/32 (56%), Gaps = 3/32 (9%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPX---PPPXPPXXPPPP 941 LP PPP PPP P P PPP PP PP P Sbjct: 342 LPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 373 Score = 39.5 bits (88), Expect = 0.017 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +3 Query: 846 SXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 S LP PP PPP P PPP PP P P Sbjct: 327 SVALPPPPGPPPPPPLPSTGPPPPPPPPPLP 357 Score = 33.9 bits (74), Expect = 0.86 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 8/42 (19%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPPPXPPPX--------PPPXPPXXPPPP 941 S ++ G PP PPP PP PPP PP PP P Sbjct: 302 SQQGIVLGPLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLP 343 Score = 33.5 bits (73), Expect = 1.1 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P P P PP P P + P P P PP P P T PPP Sbjct: 310 PLAPPPPPP---LPPGPAQASVALP-PPPGPPPPPPLPSTGPPPPP 351 Score = 31.1 bits (67), Expect = 6.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXP 912 PP PP P PP P P P P PP P P Sbjct: 333 PPGPP-PPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAP 370 Score = 31.1 bits (67), Expect = 6.1 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXP 912 P PP P P P P L P P PP P P Sbjct: 336 PPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 373 >AL591380-1|CAH71475.1| 817|Homo sapiens enabled homolog (Drosophila) protein. Length = 817 Score = 43.2 bits (97), Expect = 0.001 Identities = 18/31 (58%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPP---PXPPPXPPPXPPXXPPPP 941 PG PPP P P PPP PPP P PPPP Sbjct: 581 PGPPPPPPLPSTGPPPPPPPPPLPNQVPPPP 611 Score = 42.3 bits (95), Expect = 0.002 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PP PPP P PP PPPP Sbjct: 578 PPPPGPPPPPPLPSTGPPPPPPPP 601 Score = 41.9 bits (94), Expect = 0.003 Identities = 18/32 (56%), Positives = 18/32 (56%), Gaps = 3/32 (9%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPX---PPPXPPXXPPPP 941 LP PPP PPP P P PPP PP PP P Sbjct: 589 LPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 620 Score = 39.5 bits (88), Expect = 0.017 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +3 Query: 846 SXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 S LP PP PPP P PPP PP P P Sbjct: 574 SVALPPPPGPPPPPPLPSTGPPPPPPPPPLP 604 Score = 33.9 bits (74), Expect = 0.86 Identities = 16/39 (41%), Positives = 18/39 (46%), Gaps = 5/39 (12%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPPPXPPPXPP-----PXPPXXPPPP 941 S ++ G PP PPP PP P PP PPPP Sbjct: 549 SQQGIVLGPLAPPPPPPLPPGPAQASVALPPPPGPPPPP 587 Score = 33.5 bits (73), Expect = 1.1 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P P P PP P P + P P P PP P P T PPP Sbjct: 557 PLAPPPPPP---LPPGPAQASVALP-PPPGPPPPPPLPSTGPPPPP 598 Score = 31.1 bits (67), Expect = 6.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXP 912 PP PP P PP P P P P PP P P Sbjct: 580 PPGPP-PPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAP 617 Score = 31.1 bits (67), Expect = 6.1 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXP 912 P PP P P P P L P P PP P P Sbjct: 583 PPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 620 >AL356216-3|CAI22019.1| 570|Homo sapiens enabled homolog (Drosophila) protein. Length = 570 Score = 43.2 bits (97), Expect = 0.001 Identities = 18/31 (58%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPP---PXPPPXPPPXPPXXPPPP 941 PG PPP P P PPP PPP P PPPP Sbjct: 334 PGPPPPPPLPSTGPPPPPPPPPLPNQVPPPP 364 Score = 42.3 bits (95), Expect = 0.002 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PP PPP P PP PPPP Sbjct: 331 PPPPGPPPPPPLPSTGPPPPPPPP 354 Score = 41.9 bits (94), Expect = 0.003 Identities = 18/32 (56%), Positives = 18/32 (56%), Gaps = 3/32 (9%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPX---PPPXPPXXPPPP 941 LP PPP PPP P P PPP PP PP P Sbjct: 342 LPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 373 Score = 39.5 bits (88), Expect = 0.017 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +3 Query: 846 SXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 S LP PP PPP P PPP PP P P Sbjct: 327 SVALPPPPGPPPPPPLPSTGPPPPPPPPPLP 357 Score = 33.9 bits (74), Expect = 0.86 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 8/42 (19%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPPPXPPPX--------PPPXPPXXPPPP 941 S ++ G PP PPP PP PPP PP PP P Sbjct: 302 SQQGIVLGPLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLP 343 Score = 33.5 bits (73), Expect = 1.1 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P P P PP P P + P P P PP P P T PPP Sbjct: 310 PLAPPPPPP---LPPGPAQASVALP-PPPGPPPPPPLPSTGPPPPP 351 Score = 31.1 bits (67), Expect = 6.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXP 912 PP PP P PP P P P P PP P P Sbjct: 333 PPGPP-PPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAP 370 Score = 31.1 bits (67), Expect = 6.1 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXP 912 P PP P P P P L P P PP P P Sbjct: 336 PPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 373 >AL356216-2|CAI22020.1| 817|Homo sapiens enabled homolog (Drosophila) protein. Length = 817 Score = 43.2 bits (97), Expect = 0.001 Identities = 18/31 (58%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPP---PXPPPXPPPXPPXXPPPP 941 PG PPP P P PPP PPP P PPPP Sbjct: 581 PGPPPPPPLPSTGPPPPPPPPPLPNQVPPPP 611 Score = 42.3 bits (95), Expect = 0.002 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PP PPP P PP PPPP Sbjct: 578 PPPPGPPPPPPLPSTGPPPPPPPP 601 Score = 41.9 bits (94), Expect = 0.003 Identities = 18/32 (56%), Positives = 18/32 (56%), Gaps = 3/32 (9%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPX---PPPXPPXXPPPP 941 LP PPP PPP P P PPP PP PP P Sbjct: 589 LPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 620 Score = 39.5 bits (88), Expect = 0.017 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +3 Query: 846 SXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 S LP PP PPP P PPP PP P P Sbjct: 574 SVALPPPPGPPPPPPLPSTGPPPPPPPPPLP 604 Score = 33.9 bits (74), Expect = 0.86 Identities = 16/39 (41%), Positives = 18/39 (46%), Gaps = 5/39 (12%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPPPXPPPXPP-----PXPPXXPPPP 941 S ++ G PP PPP PP P PP PPPP Sbjct: 549 SQQGIVLGPLAPPPPPPLPPGPAQASVALPPPPGPPPPP 587 Score = 33.5 bits (73), Expect = 1.1 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P P P PP P P + P P P PP P P T PPP Sbjct: 557 PLAPPPPPP---LPPGPAQASVALP-PPPGPPPPPPLPSTGPPPPP 598 Score = 31.1 bits (67), Expect = 6.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXP 912 PP PP P PP P P P P PP P P Sbjct: 580 PPGPP-PPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAP 617 Score = 31.1 bits (67), Expect = 6.1 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXP 912 P PP P P P P L P P PP P P Sbjct: 583 PPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 620 >AK127078-1|BAC86815.1| 844|Homo sapiens protein ( Homo sapiens cDNA FLJ45135 fis, clone BRAWH3038252, highly similar to Formin 1 isoform IV. ). Length = 844 Score = 43.2 bits (97), Expect = 0.001 Identities = 18/37 (48%), Positives = 19/37 (51%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P +S P PPP PPP PPP PP PPPP Sbjct: 318 PMPPVSAGPPLPPPPPPPPPLPPPSSAGPPPPPPPPP 354 Score = 41.5 bits (93), Expect = 0.004 Identities = 20/40 (50%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPP---XPPXXPPPP 941 P + V G PP PPP PPP PPP PP PPPP Sbjct: 315 PAPPMPPVSAGPPLPPPPPP-PPPLPPPSSAGPPPPPPPP 353 Score = 39.5 bits (88), Expect = 0.017 Identities = 17/32 (53%), Positives = 17/32 (53%), Gaps = 4/32 (12%) Frame = +3 Query: 858 PGXXPPPXPPPX----PPPXPPPXPPXXPPPP 941 P PPP PPP PPP PPP P P PP Sbjct: 331 PPPPPPPLPPPSSAGPPPPPPPPPLPNSPAPP 362 Score = 37.9 bits (84), Expect = 0.053 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 3/30 (10%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPP---XPPXXPPPP 941 G PPP PPP P PP PP PPPP Sbjct: 345 GPPPPPPPPPLPNSPAPPNPGGPPPAPPPP 374 Score = 35.1 bits (77), Expect = 0.37 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P PP PS S P P P P P PPP Sbjct: 326 PPLPPPPPPPPPLPPPS---SAGPPPPPPPPPLPNSPAPPNPGGPPP 369 Score = 35.1 bits (77), Expect = 0.37 Identities = 19/43 (44%), Positives = 20/43 (46%), Gaps = 6/43 (13%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXP----PPXP--PPXPPPXPPXXPPPP 941 P S + P PPP P PP P PP PP P PPPP Sbjct: 339 PPPSSAGPPPPPPPPPLPNSPAPPNPGGPPPAPPPPGLAPPPP 381 Score = 34.7 bits (76), Expect = 0.49 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 L + P PP P P PPP PP PPP Sbjct: 310 LGSLSPAPPMPPVSAGPPLPPPPPPPPPLPPP 341 Score = 34.7 bits (76), Expect = 0.49 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPX-PXPXXP--PXPXXPXTXXXPPP 936 PP PP P PP P P P P P P P P P PPP Sbjct: 331 PPPPPPPLPPPSSAGPPPPPPPPPLPNSPAPPNPGGPPPAPPPPGLAPPP 380 Score = 32.7 bits (71), Expect = 2.0 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 8/44 (18%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXP--------PPXPPPXPPPXPPXXPPP 938 P S LP PPP P PP PPP PPP P PP Sbjct: 320 PPVSAGPPLPPPPPPPPPLPPPSSAGPPPPPP-PPPLPNSPAPP 362 Score = 32.3 bits (70), Expect = 2.6 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 LP PP P PP PPP PPP Sbjct: 355 LPNSPAPPNPGGPPPAPPPPGLAPPPPP 382 Score = 31.5 bits (68), Expect = 4.6 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPP 933 PP PP P P P P P PP P P PP Sbjct: 329 PPPPPPPPPLPPPSSAGPPPPPPPPPLPNSPAPPNPGGPPPAPPPP 374 Score = 30.7 bits (66), Expect = 8.0 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 802 SPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 SP P PP P P P P P PP P PPP Sbjct: 314 SPAPPMPPVSAGPPLP----PPPPPPPPLPPPSSAGPPPPPPPPP 354 >AK096246-1|BAC04736.1| 467|Homo sapiens protein ( Homo sapiens cDNA FLJ38927 fis, clone NT2NE2012505, highly similar to Gallus gallus mRNA for avena. ). Length = 467 Score = 43.2 bits (97), Expect = 0.001 Identities = 18/31 (58%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPP---PXPPPXPPPXPPXXPPPP 941 PG PPP P P PPP PPP P PPPP Sbjct: 231 PGPPPPPPLPSTGPPPPPPPPPLPNQVPPPP 261 Score = 42.3 bits (95), Expect = 0.002 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PP PPP P PP PPPP Sbjct: 228 PPPPGPPPPPPLPSTGPPPPPPPP 251 Score = 41.9 bits (94), Expect = 0.003 Identities = 18/32 (56%), Positives = 18/32 (56%), Gaps = 3/32 (9%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPX---PPPXPPXXPPPP 941 LP PPP PPP P P PPP PP PP P Sbjct: 239 LPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 270 Score = 39.5 bits (88), Expect = 0.017 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +3 Query: 846 SXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 S LP PP PPP P PPP PP P P Sbjct: 224 SVALPPPPGPPPPPPLPSTGPPPPPPPPPLP 254 Score = 33.9 bits (74), Expect = 0.86 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 8/42 (19%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPPPXPPPX--------PPPXPPXXPPPP 941 S ++ G PP PPP PP PPP PP PP P Sbjct: 199 SQQGIVLGPLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLP 240 Score = 33.5 bits (73), Expect = 1.1 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P P P PP P P + P P P PP P P T PPP Sbjct: 207 PLAPPPPPP---LPPGPAQASVALP-PPPGPPPPPPLPSTGPPPPP 248 Score = 31.1 bits (67), Expect = 6.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXP 912 PP PP P PP P P P P PP P P Sbjct: 230 PPGPP-PPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAP 267 Score = 31.1 bits (67), Expect = 6.1 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXP 912 P PP P P P P L P P PP P P Sbjct: 233 PPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 270 >AF519769-1|AAQ08487.1| 591|Homo sapiens mena protein protein. Length = 591 Score = 43.2 bits (97), Expect = 0.001 Identities = 18/31 (58%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPP---PXPPPXPPPXPPXXPPPP 941 PG PPP P P PPP PPP P PPPP Sbjct: 334 PGPPPPPPLPSTGPPPPPPPPPLPNQVPPPP 364 Score = 42.3 bits (95), Expect = 0.002 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PP PPP P PP PPPP Sbjct: 331 PPPPGPPPPPPLPSTGPPPPPPPP 354 Score = 41.9 bits (94), Expect = 0.003 Identities = 18/32 (56%), Positives = 18/32 (56%), Gaps = 3/32 (9%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPX---PPPXPPXXPPPP 941 LP PPP PPP P P PPP PP PP P Sbjct: 342 LPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 373 Score = 39.5 bits (88), Expect = 0.017 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +3 Query: 846 SXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 S LP PP PPP P PPP PP P P Sbjct: 327 SVALPPPPGPPPPPPLPSTGPPPPPPPPPLP 357 Score = 33.9 bits (74), Expect = 0.86 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 8/42 (19%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPPPXPPPX--------PPPXPPXXPPPP 941 S ++ G PP PPP PP PPP PP PP P Sbjct: 302 SQQGIVLGPLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLP 343 Score = 33.5 bits (73), Expect = 1.1 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P P P PP P P + P P P PP P P T PPP Sbjct: 310 PLAPPPPPP---LPPGPAQASVALP-PPPGPPPPPPLPSTGPPPPP 351 Score = 31.1 bits (67), Expect = 6.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXP 912 PP PP P PP P P P P PP P P Sbjct: 333 PPGPP-PPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAP 370 Score = 31.1 bits (67), Expect = 6.1 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXP 912 P PP P P P P L P P PP P P Sbjct: 336 PPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 373 >AF115549-1|AAD26691.1| 502|Homo sapiens Wiskott-Aldrich Syndrome protein protein. Length = 502 Score = 43.2 bits (97), Expect = 0.001 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PP PPP PPP PPP P PP Sbjct: 386 PGAGGPPMPPPPPPPPPPPSSGNGPAPP 413 Score = 40.7 bits (91), Expect = 0.008 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPP 938 G PPP P PP PPP PP PPP Sbjct: 379 GPLPPPPPGAGGPPMPPPPPPPPPPP 404 Score = 38.7 bits (86), Expect = 0.030 Identities = 19/37 (51%), Positives = 19/37 (51%), Gaps = 10/37 (27%) Frame = +3 Query: 861 GXXPPPXPP------PXPPPXP----PPXPPXXPPPP 941 G PPP PP P PPP P PP PP PPPP Sbjct: 365 GGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPP 401 Score = 36.7 bits (81), Expect = 0.12 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 5/31 (16%) Frame = +3 Query: 858 PGXXPPPXPPPXPP-----PXPPPXPPXXPP 935 P PPP PPP PP P PPP PP P Sbjct: 391 PPMPPPPPPPPPPPSSGNGPAPPPLPPALVP 421 Score = 35.9 bits (79), Expect = 0.21 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP+P P PP P P P P PP P PPP Sbjct: 353 PPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPP 399 Score = 35.1 bits (77), Expect = 0.37 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = +3 Query: 753 PXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXP 932 P PP P R L V G PPP P PPP PP P Sbjct: 312 PLPPPPPPSRGGNQLPRPPIAGGNKGRSGPLPPVPLGIAPPPPTPRGPPPPGRGGPPPPP 371 Query: 933 PP 938 PP Sbjct: 372 PP 373 Score = 32.7 bits (71), Expect = 2.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PP PPP PPP P PP P Sbjct: 390 GPPMPPPPPPPPPPPSSGNGPAPPPLP 416 Score = 32.3 bits (70), Expect = 2.6 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P P P P P P PP P P + P P Sbjct: 367 PPPPPPPATGRSGPLPPPPPGAGGPPMPPPP-PPPPPPPSSGNGPAP 412 >AF110377-1|AAD04629.1| 3859|Homo sapiens PCAF-associated factor 400 protein. Length = 3859 Score = 43.2 bits (97), Expect = 0.001 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG P P P P PPP PPP PP P P Sbjct: 494 PGPAPSPAPVPAPPPPPPPPPPATPVTP 521 Score = 37.9 bits (84), Expect = 0.053 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 +P P P P P P P P PP PPPP Sbjct: 487 VPTAPAAPGPAPSPAPVPAPPPPPPPPPP 515 Score = 37.5 bits (83), Expect = 0.070 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P PPP PPP PPP P P P Sbjct: 498 PSPAPVPAPPPPPPP-PPPATPVTPAP 523 Score = 35.1 bits (77), Expect = 0.37 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P P P P PPP PPP P P Sbjct: 496 PAPSPAPVPAPPPPPPPPPPATPVTPAP 523 Score = 35.1 bits (77), Expect = 0.37 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P PPP PPP P P PP Sbjct: 500 PAPVPAPPPPPPPPPPATPVTPAPVPP 526 Score = 33.9 bits (74), Expect = 0.86 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPP-PXPPPXPPPXPPXXPPPP 941 ++ LPG P P P P P P P PP PPPP Sbjct: 479 AVEAALPGVPTAPAAPGPAPSPAPVPAPP-PPPPP 512 Score = 32.3 bits (70), Expect = 2.6 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPP 923 P S + V PPP PPP P P P PP Sbjct: 496 PAPSPAPVPAPPPPPPPPPPATPVTPAPVPP 526 >AF076974-1|AAD09420.1| 3830|Homo sapiens TRRAP protein protein. Length = 3830 Score = 43.2 bits (97), Expect = 0.001 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG P P P P PPP PPP PP P P Sbjct: 494 PGPAPSPAPVPAPPPPPPPPPPATPVTP 521 Score = 37.9 bits (84), Expect = 0.053 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 +P P P P P P P P PP PPPP Sbjct: 487 VPTAPAAPGPAPSPAPVPAPPPPPPPPPP 515 Score = 37.5 bits (83), Expect = 0.070 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P PPP PPP PPP P P P Sbjct: 498 PSPAPVPAPPPPPPP-PPPATPVTPAP 523 Score = 35.1 bits (77), Expect = 0.37 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P P P P PPP PPP P P Sbjct: 496 PAPSPAPVPAPPPPPPPPPPATPVTPAP 523 Score = 35.1 bits (77), Expect = 0.37 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P PPP PPP P P PP Sbjct: 500 PAPVPAPPPPPPPPPPATPVTPAPVPP 526 Score = 33.9 bits (74), Expect = 0.86 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPP-PXPPPXPPPXPPXXPPPP 941 ++ LPG P P P P P P P PP PPPP Sbjct: 479 AVEAALPGVPTAPAAPGPAPSPAPVPAPP-PPPPP 512 Score = 32.3 bits (70), Expect = 2.6 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPP 923 P S + V PPP PPP P P P PP Sbjct: 496 PAPSPAPVPAPPPPPPPPPPATPVTPAPVPP 526 >AC018730-1|AAX88973.1| 500|Homo sapiens unknown protein. Length = 500 Score = 43.2 bits (97), Expect = 0.001 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GG GGG GGG GGG GGG PG Sbjct: 28 GAGGGGGGGGGGGGGGAGGG-GGGMQPG 54 >AC004991-1|AAC27675.2| 2089|Homo sapiens unknown protein. Length = 2089 Score = 43.2 bits (97), Expect = 0.001 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG P P P P PPP PPP PP P P Sbjct: 494 PGPAPSPAPVPAPPPPPPPPPPATPVTP 521 Score = 37.9 bits (84), Expect = 0.053 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 +P P P P P P P P PP PPPP Sbjct: 487 VPTAPAAPGPAPSPAPVPAPPPPPPPPPP 515 Score = 37.5 bits (83), Expect = 0.070 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P PPP PPP PPP P P P Sbjct: 498 PSPAPVPAPPPPPPP-PPPATPVTPAP 523 Score = 35.1 bits (77), Expect = 0.37 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P P P P PPP PPP P P Sbjct: 496 PAPSPAPVPAPPPPPPPPPPATPVTPAP 523 Score = 35.1 bits (77), Expect = 0.37 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P PPP PPP P P PP Sbjct: 500 PAPVPAPPPPPPPPPPATPVTPAPVPP 526 Score = 33.9 bits (74), Expect = 0.86 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPP-PXPPPXPPPXPPXXPPPP 941 ++ LPG P P P P P P P PP PPPP Sbjct: 479 AVEAALPGVPTAPAAPGPAPSPAPVPAPP-PPPPP 512 Score = 32.3 bits (70), Expect = 2.6 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPP 923 P S + V PPP PPP P P P PP Sbjct: 496 PAPSPAPVPAPPPPPPPPPPATPVTPAPVPP 526 >AB209489-1|BAD92726.1| 3587|Homo sapiens Transformation/transcription domain-associated protein variant protein. Length = 3587 Score = 43.2 bits (97), Expect = 0.001 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG P P P P PPP PPP PP P P Sbjct: 208 PGPAPSPAPVPAPPPPPPPPPPATPVTP 235 Score = 37.9 bits (84), Expect = 0.053 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 +P P P P P P P P PP PPPP Sbjct: 201 VPTAPAAPGPAPSPAPVPAPPPPPPPPPP 229 Score = 37.5 bits (83), Expect = 0.070 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P PPP PPP PPP P P P Sbjct: 212 PSPAPVPAPPPPPPP-PPPATPVTPAP 237 Score = 35.1 bits (77), Expect = 0.37 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P P P P PPP PPP P P Sbjct: 210 PAPSPAPVPAPPPPPPPPPPATPVTPAP 237 Score = 35.1 bits (77), Expect = 0.37 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P PPP PPP P P PP Sbjct: 214 PAPVPAPPPPPPPPPPATPVTPAPVPP 240 Score = 33.9 bits (74), Expect = 0.86 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPP-PXPPPXPPPXPPXXPPPP 941 ++ LPG P P P P P P P PP PPPP Sbjct: 193 AVEAALPGVPTAPAAPGPAPSPAPVPAPP-PPPPP 226 Score = 32.3 bits (70), Expect = 2.6 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPP 923 P S + V PPP PPP P P P PP Sbjct: 210 PAPSPAPVPAPPPPPPPPPPATPVTPAPVPP 240 >AB001835-1|BAA19459.1| 500|Homo sapiens Brain-1 protein. Length = 500 Score = 43.2 bits (97), Expect = 0.001 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GG GGG GGG GGG GGG PG Sbjct: 28 GAGGGGGGGGGGGGGGAGGG-GGGMQPG 54 >U10063-1|AAA57161.1| 423|Homo sapiens POU domain factor protein. Length = 423 Score = 42.7 bits (96), Expect = 0.002 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GG GGG GGG GGG G Sbjct: 151 GGGGGPGGGGGPGGGGPGGGGGGGPGGG 178 Score = 40.3 bits (90), Expect = 0.010 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GG GGG GGG G Sbjct: 163 GGGGPGGGGGGGPGGGGGGPGGGLLGG 189 Score = 39.9 bits (89), Expect = 0.013 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GGG G G GGG GGG G Sbjct: 142 GGGGAHDGPGGGGGPGGGGGPGGGGPGG 169 Score = 39.5 bits (88), Expect = 0.017 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG G G GGG G G GGG G Sbjct: 157 GGGGGPGGGGPGGGGGGGPGGGGGGPGG 184 Score = 39.5 bits (88), Expect = 0.017 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GG GGG GG GGG G Sbjct: 158 GGGGPGGGGPGGGGGGGPGGGGGGPGGG 185 Score = 37.9 bits (84), Expect = 0.053 Identities = 18/30 (60%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGG--XGGGXXPG 857 GG G GG GGG GG GGG GGG PG Sbjct: 154 GGPGGGGGPGGGGPGGGGGGGPGGGGGGPG 183 Score = 37.5 bits (83), Expect = 0.070 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGGX*XXNLPTXPGGG 721 G GGGG GGGG P GGGG PGGG Sbjct: 149 GPGGGGGPGGGGGPGGGGPGGGGGGGPGGGGGGPGGG 185 Score = 36.3 bits (80), Expect = 0.16 Identities = 17/28 (60%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -2 Query: 937 GGGXXGGXGGGXG-GGXGGGXGGGXXPG 857 G G GG GGG G GG G G GGG PG Sbjct: 149 GPGGGGGPGGGGGPGGGGPGGGGGGGPG 176 Score = 35.9 bits (79), Expect = 0.21 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG G G G GGG GGG PG Sbjct: 136 GAGAAAGGGGAHDGPGGGGGPGGGGGPG 163 Score = 35.1 bits (77), Expect = 0.37 Identities = 17/27 (62%), Positives = 17/27 (62%), Gaps = 3/27 (11%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGG---XGGGXGGG 869 GGGG GG GGG GGG GGG GG Sbjct: 163 GGGGPGGGGGGGPGGGGGGPGGGLLGG 189 Score = 35.1 bits (77), Expect = 0.37 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXP 860 GGG GG GGG GG GG GG P Sbjct: 168 GGGGGGGPGGGGGGPGGGLLGGSAHP 193 Score = 33.9 bits (74), Expect = 0.86 Identities = 17/30 (56%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXGGXGGGXGG--GXGGGXGGGXXPG 857 GGG GG GGG GG G GGG GG G Sbjct: 159 GGGPGGGGPGGGGGGGPGGGGGGPGGGLLG 188 Score = 31.9 bits (69), Expect = 3.5 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 3/31 (9%) Frame = -2 Query: 940 GGGGXXGGXGG---GXGGGXGGGXGGGXXPG 857 GG G G GG G GGG G G GGG G Sbjct: 135 GGAGAAAGGGGAHDGPGGGGGPGGGGGPGGG 165 Score = 31.5 bits (68), Expect = 4.6 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG G GGG G GGG PG Sbjct: 130 GAGGAGGAGAAAGGGGAHDGPGGGGGPG 157 >M35851-1|AAA51772.1| 917|Homo sapiens androgen receptor protein. Length = 917 Score = 42.7 bits (96), Expect = 0.002 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGGG GG GGG GGG GGG GG Sbjct: 448 GGGGGGGGGGGGGGGGGGGGGGG 470 Score = 42.7 bits (96), Expect = 0.002 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 GGG GG GGG GGG GGG GGG Sbjct: 448 GGGGGGGGGGGGGGGGGGGGGGG 470 Score = 42.3 bits (95), Expect = 0.002 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXP 860 GGGG GG GGG GGG GGG G P Sbjct: 451 GGGGGGGGGGGGGGGGGGGGEAGAVAP 477 Score = 38.7 bits (86), Expect = 0.030 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GGG GGG GGG G Sbjct: 445 GPCGGGGGGGGGGGGGGGGGGGGGG 469 Score = 37.9 bits (84), Expect = 0.053 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GGG GGG GGG G Sbjct: 445 GPCGGGGGGGGGGGGGGGGGGGGGGG 470 Score = 34.7 bits (76), Expect = 0.49 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GGG GGG GGG GGG G Sbjct: 441 GQLYGPCGGGGGGGGGGGGGGGGGGG 466 >M21748-1|AAA51771.1| 917|Homo sapiens androgen receptor protein. Length = 917 Score = 42.7 bits (96), Expect = 0.002 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGGG GG GGG GGG GGG GG Sbjct: 448 GGGGGGGGGGGGGGGGGGGGGGG 470 Score = 42.7 bits (96), Expect = 0.002 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 GGG GG GGG GGG GGG GGG Sbjct: 448 GGGGGGGGGGGGGGGGGGGGGGG 470 Score = 42.3 bits (95), Expect = 0.002 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXP 860 GGGG GG GGG GGG GGG G P Sbjct: 451 GGGGGGGGGGGGGGGGGGGGEAGAVAP 477 Score = 38.7 bits (86), Expect = 0.030 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GGG GGG GGG G Sbjct: 445 GPCGGGGGGGGGGGGGGGGGGGGGG 469 Score = 37.9 bits (84), Expect = 0.053 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GGG GGG GGG G Sbjct: 445 GPCGGGGGGGGGGGGGGGGGGGGGGG 470 Score = 34.7 bits (76), Expect = 0.49 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GGG GGG GGG GGG G Sbjct: 441 GQLYGPCGGGGGGGGGGGGGGGGGGG 466 >L20433-1|AAA65605.1| 420|Homo sapiens octamer binding transcription factor 1 protein. Length = 420 Score = 42.7 bits (96), Expect = 0.002 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GG GGG GGG GGG G Sbjct: 148 GGGGGPGGGGGPGGGGPGGGGGGGPGGG 175 Score = 40.3 bits (90), Expect = 0.010 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GG GGG GGG G Sbjct: 160 GGGGPGGGGGGGPGGGGGGPGGGLLGG 186 Score = 39.9 bits (89), Expect = 0.013 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GGG G G GGG GGG G Sbjct: 139 GGGGAHDGPGGGGGPGGGGGPGGGGPGG 166 Score = 39.5 bits (88), Expect = 0.017 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG G G GGG G G GGG G Sbjct: 154 GGGGGPGGGGPGGGGGGGPGGGGGGPGG 181 Score = 39.5 bits (88), Expect = 0.017 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GG GGG GG GGG G Sbjct: 155 GGGGPGGGGPGGGGGGGPGGGGGGPGGG 182 Score = 37.9 bits (84), Expect = 0.053 Identities = 18/30 (60%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGG--XGGGXXPG 857 GG G GG GGG GG GGG GGG PG Sbjct: 151 GGPGGGGGPGGGGPGGGGGGGPGGGGGGPG 180 Score = 37.5 bits (83), Expect = 0.070 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGGX*XXNLPTXPGGG 721 G GGGG GGGG P GGGG PGGG Sbjct: 146 GPGGGGGPGGGGGPGGGGPGGGGGGGPGGGGGGPGGG 182 Score = 36.3 bits (80), Expect = 0.16 Identities = 17/28 (60%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -2 Query: 937 GGGXXGGXGGGXG-GGXGGGXGGGXXPG 857 G G GG GGG G GG G G GGG PG Sbjct: 146 GPGGGGGPGGGGGPGGGGPGGGGGGGPG 173 Score = 35.9 bits (79), Expect = 0.21 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG G G G GGG GGG PG Sbjct: 133 GAGAAAGGGGAHDGPGGGGGPGGGGGPG 160 Score = 35.1 bits (77), Expect = 0.37 Identities = 17/27 (62%), Positives = 17/27 (62%), Gaps = 3/27 (11%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGG---XGGGXGGG 869 GGGG GG GGG GGG GGG GG Sbjct: 160 GGGGPGGGGGGGPGGGGGGPGGGLLGG 186 Score = 35.1 bits (77), Expect = 0.37 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXP 860 GGG GG GGG GG GG GG P Sbjct: 165 GGGGGGGPGGGGGGPGGGLLGGSAHP 190 Score = 33.9 bits (74), Expect = 0.86 Identities = 17/30 (56%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXGGXGGGXGG--GXGGGXGGGXXPG 857 GGG GG GGG GG G GGG GG G Sbjct: 156 GGGPGGGGPGGGGGGGPGGGGGGPGGGLLG 185 Score = 31.9 bits (69), Expect = 3.5 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 3/31 (9%) Frame = -2 Query: 940 GGGGXXGGXGG---GXGGGXGGGXGGGXXPG 857 GG G G GG G GGG G G GGG G Sbjct: 132 GGAGAAAGGGGAHDGPGGGGGPGGGGGPGGG 162 >D21852-1|BAA04878.2| 974|Homo sapiens KIAA0029 protein. Length = 974 Score = 42.7 bits (96), Expect = 0.002 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P +S + P P PPP PPP PPP PP P P Sbjct: 453 PQQSGYIMTAAPPPHPPPPPPPPPPPPPLPPGQPVP 488 Score = 41.5 bits (93), Expect = 0.004 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP PPP PP P P Sbjct: 464 PPPHPPP-PPPPPPPPPPLPPGQP 486 >BC049204-1|AAH49204.1| 251|Homo sapiens homeobox B4 protein. Length = 251 Score = 42.7 bits (96), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PPP PPP PPP PP P P PP Sbjct: 71 PGPPPPPPPPP-PPPPPPGLSPRAPAPP 97 Score = 37.5 bits (83), Expect = 0.070 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P PPP PPP PPP P P PP Sbjct: 73 PPPPPPPPPPPPPPPGLSPRAPAPPP 98 >BC041093-1|AAH41093.1| 1099|Homo sapiens R3H domain containing 1 protein. Length = 1099 Score = 42.7 bits (96), Expect = 0.002 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P +S + P P PPP PPP PPP PP P P Sbjct: 578 PQQSGYIMTAAPPPHPPPPPPPPPPPPPLPPGQPVP 613 Score = 41.5 bits (93), Expect = 0.004 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP PPP PP P P Sbjct: 589 PPPHPPP-PPPPPPPPPPLPPGQP 611 >BC034003-1|AAH34003.1| 600|Homo sapiens PRR12 protein protein. Length = 600 Score = 42.7 bits (96), Expect = 0.002 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP P P P P PP PP P Sbjct: 93 PPPTPPPAPTPQPQPPPPPPPPQP 116 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 V P PP PPP PPP PP P PPPP Sbjct: 125 VAPTPSSPP-PPPLPPPPPPAMPSPPPPPP 153 Score = 40.7 bits (91), Expect = 0.008 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P P P P PPP PPP P P PP Sbjct: 95 PTPPPAPTPQPQPPPPPPPPQPALPSPP 122 Score = 39.9 bits (89), Expect = 0.013 Identities = 18/37 (48%), Positives = 19/37 (51%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P +L P P P PP PPP PPP PP P PP Sbjct: 114 PQPALPSPPPLVAPTPSSPP-PPPLPPPPPPAMPSPP 149 Score = 39.1 bits (87), Expect = 0.023 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PP PPP P PP PPPP Sbjct: 129 PSSPPPPPLPPPPPPAMPSPPP--PPPP 154 Score = 38.3 bits (85), Expect = 0.040 Identities = 20/64 (31%), Positives = 23/64 (35%), Gaps = 2/64 (3%) Frame = +3 Query: 753 PXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPP--PXPPPXPPX 926 P PP P + P ++ PPP PPP PP P PPP PP Sbjct: 95 PTPPPAPTPQPQPPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPPPPPPAMPSPPPPPPP 154 Query: 927 XPPP 938 P Sbjct: 155 AAAP 158 Score = 38.3 bits (85), Expect = 0.040 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P PP P PP PSP + P P P P P PPP Sbjct: 105 PQPPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPPPPPPAMPSPPP 150 Score = 36.7 bits (81), Expect = 0.12 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 4/32 (12%) Frame = +3 Query: 858 PGXXPPPXPP----PXPPPXPPPXPPXXPPPP 941 P PPP PP P PPP P P PPPP Sbjct: 105 PQPPPPPPPPQPALPSPPPLVAPTPSSPPPPP 136 Score = 35.9 bits (79), Expect = 0.21 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP+PP P P P P P P P P P PPP Sbjct: 94 PPTPPPAPTPQPQPPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPPP 140 Score = 35.9 bits (79), Expect = 0.21 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P P P P P P PP P + PPP Sbjct: 107 PPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPPPPPPAMPSPPPPPP 153 Score = 34.3 bits (75), Expect = 0.65 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 3/30 (10%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXP---PXXPPPP 941 G PP PPP PPP P P PPPP Sbjct: 82 GTPEPPLLEEKPPPTPPPAPTPQPQPPPPP 111 Score = 33.9 bits (74), Expect = 0.86 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = +3 Query: 753 PXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXP 932 P PP P Q P L P P P PPP P P PP P Sbjct: 107 PPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPPPPPPAMPSPPPPPPPAAAPLAAPPEEP 166 Query: 933 PPP 941 P Sbjct: 167 AAP 169 Score = 31.1 bits (67), Expect = 6.1 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 814 PXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPP 933 P PP P P P P P PP P P PP Sbjct: 84 PEPPLLEEKPPPTPPPAPTPQPQPPPPPPPPQPALPSPPP 123 >AL445209-3|CAI15184.1| 419|Homo sapiens POU domain, class 4, transcription factor 1 protein. Length = 419 Score = 42.7 bits (96), Expect = 0.002 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGGG GG GGG GGG GGG GG Sbjct: 155 GGGGPGGGPGGGGGGGPGGGGGG 177 Score = 41.9 bits (94), Expect = 0.003 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG GGG G Sbjct: 148 GGGGGPGG-GGGPGGGPGGGGGGGPGGG 174 Score = 39.9 bits (89), Expect = 0.013 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GGG G G GGG GGG G Sbjct: 139 GGGGAHDGPGGGGGPGGGGGPGGGPGGG 166 Score = 39.5 bits (88), Expect = 0.017 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GG GGG GG GGG G Sbjct: 154 GGGGGPGGGPGGGGGGGPGGGGGGPGGG 181 Score = 37.5 bits (83), Expect = 0.070 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG GGG G G G G GGG PG Sbjct: 146 GPGGGGGPGGGGGPGGGPGGGGGGGPG 172 Score = 35.9 bits (79), Expect = 0.21 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG G G G GGG GGG PG Sbjct: 133 GAGAAAGGGGAHDGPGGGGGPGGGGGPG 160 Score = 35.1 bits (77), Expect = 0.37 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXP 860 GGG GG GGG GG GG GG P Sbjct: 164 GGGGGGGPGGGGGGPGGGLLGGSAHP 189 Score = 34.3 bits (75), Expect = 0.65 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGGX*XXNLPTXPGGG 721 G GGGG GGGG P GGGG PGGG Sbjct: 146 GPGGGGGPGGGGGPGGGPGGGGGGG-PGGGGGGPGGG 181 Score = 33.9 bits (74), Expect = 0.86 Identities = 18/31 (58%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = -2 Query: 940 GGGGXXG-GXGGGX--GGGXGGGXGGGXXPG 857 GGG G G GGG GGG GGG GGG G Sbjct: 140 GGGAHDGPGGGGGPGGGGGPGGGPGGGGGGG 170 Score = 31.9 bits (69), Expect = 3.5 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 3/31 (9%) Frame = -2 Query: 940 GGGGXXGGXGG---GXGGGXGGGXGGGXXPG 857 GG G G GG G GGG G G GGG G Sbjct: 132 GGAGAAAGGGGAHDGPGGGGGPGGGGGPGGG 162 >AL356358-1|CAI40496.1| 920|Homo sapiens androgen receptor (dihydrotestosterone receptor; testicular feminization; spina protein. Length = 920 Score = 42.7 bits (96), Expect = 0.002 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGGG GG GGG GGG GGG GG Sbjct: 451 GGGGGGGGGGGGGGGGGGGGGGG 473 Score = 42.7 bits (96), Expect = 0.002 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 GGG GG GGG GGG GGG GGG Sbjct: 451 GGGGGGGGGGGGGGGGGGGGGGG 473 Score = 42.3 bits (95), Expect = 0.002 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXP 860 GGGG GG GGG GGG GGG G P Sbjct: 454 GGGGGGGGGGGGGGGGGGGGEAGAVAP 480 Score = 38.7 bits (86), Expect = 0.030 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GGG GGG GGG G Sbjct: 448 GPCGGGGGGGGGGGGGGGGGGGGGG 472 Score = 37.9 bits (84), Expect = 0.053 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GGG GGG GGG G Sbjct: 448 GPCGGGGGGGGGGGGGGGGGGGGGGG 473 Score = 34.7 bits (76), Expect = 0.49 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GGG GGG GGG GGG G Sbjct: 444 GQLYGPCGGGGGGGGGGGGGGGGGGG 469 >AL158217-11|CAI22163.1| 854|Homo sapiens espin protein. Length = 854 Score = 42.7 bits (96), Expect = 0.002 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PP PPP PPP PPPP Sbjct: 430 PPPPPPSFPPPPPPPGTQLPPPPP 453 Score = 39.5 bits (88), Expect = 0.017 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PP PPP PP PPP PPPP Sbjct: 426 GKPTPPPPPPSFPPPPPPPGTQLPPPP 452 Score = 37.1 bits (82), Expect = 0.093 Identities = 16/38 (42%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXP--PPXPPXXPPP 938 P ++ P PP PPP PPP PP PP P P Sbjct: 421 PRGTIGKPTPPPPPPSFPPPPPPPGTQLPPPPPGYPAP 458 Score = 34.7 bits (76), Expect = 0.49 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP P P PP PP P Sbjct: 597 PPPPPPPPPLPEAASSPPPAPPLP 620 Score = 33.5 bits (73), Expect = 1.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP PP P PPP P PP Sbjct: 435 PSFPPPPPPPGTQLPPPPPGYPAPKPP 461 Score = 32.7 bits (71), Expect = 2.0 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 2/28 (7%) Frame = +3 Query: 858 PGXXPPPXPPPXP--PPXPPPXPPXXPP 935 P PPP PPP PP PP P PP Sbjct: 434 PPSFPPPPPPPGTQLPPPPPGYPAPKPP 461 Score = 31.1 bits (67), Expect = 6.1 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +3 Query: 846 SXVLPGXXPPPXPP-PXPPPXPPPXPP 923 S LP PPP PP P PPP PP Sbjct: 592 SRELPPPPPPPPPPLPEAASSPPPAPP 618 >AL158016-1|CAI40853.1| 920|Homo sapiens androgen receptor (dihydrotestosterone receptor; testicular feminization; spina protein. Length = 920 Score = 42.7 bits (96), Expect = 0.002 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGGG GG GGG GGG GGG GG Sbjct: 451 GGGGGGGGGGGGGGGGGGGGGGG 473 Score = 42.7 bits (96), Expect = 0.002 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 GGG GG GGG GGG GGG GGG Sbjct: 451 GGGGGGGGGGGGGGGGGGGGGGG 473 Score = 42.3 bits (95), Expect = 0.002 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXP 860 GGGG GG GGG GGG GGG G P Sbjct: 454 GGGGGGGGGGGGGGGGGGGGEAGAVAP 480 Score = 38.7 bits (86), Expect = 0.030 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GGG GGG GGG G Sbjct: 448 GPCGGGGGGGGGGGGGGGGGGGGGG 472 Score = 37.9 bits (84), Expect = 0.053 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GGG GGG GGG G Sbjct: 448 GPCGGGGGGGGGGGGGGGGGGGGGGG 473 Score = 34.7 bits (76), Expect = 0.49 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GGG GGG GGG GGG G Sbjct: 444 GQLYGPCGGGGGGGGGGGGGGGGGGG 469 >AL137449-1|CAB70742.1| 246|Homo sapiens hypothetical protein protein. Length = 246 Score = 42.7 bits (96), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PPP PPP PPP PP P P PP Sbjct: 66 PGPPPPPPPPP-PPPPPPGLSPRAPAPP 92 Score = 37.5 bits (83), Expect = 0.070 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P PPP PPP PPP P P PP Sbjct: 68 PPPPPPPPPPPPPPPGLSPRAPAPPP 93 >AL049564-2|CAI43080.1| 920|Homo sapiens androgen receptor (dihydrotestosterone receptor; testicular feminization; spina protein. Length = 920 Score = 42.7 bits (96), Expect = 0.002 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGGG GG GGG GGG GGG GG Sbjct: 451 GGGGGGGGGGGGGGGGGGGGGGG 473 Score = 42.7 bits (96), Expect = 0.002 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 GGG GG GGG GGG GGG GGG Sbjct: 451 GGGGGGGGGGGGGGGGGGGGGGG 473 Score = 42.3 bits (95), Expect = 0.002 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXP 860 GGGG GG GGG GGG GGG G P Sbjct: 454 GGGGGGGGGGGGGGGGGGGGEAGAVAP 480 Score = 38.7 bits (86), Expect = 0.030 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GGG GGG GGG G Sbjct: 448 GPCGGGGGGGGGGGGGGGGGGGGGG 472 Score = 37.9 bits (84), Expect = 0.053 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GGG GGG GGG G Sbjct: 448 GPCGGGGGGGGGGGGGGGGGGGGGGG 473 Score = 34.7 bits (76), Expect = 0.49 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GGG GGG GGG GGG G Sbjct: 444 GQLYGPCGGGGGGGGGGGGGGGGGGG 469 >AL035288-1|CAA22892.1| 671|Homo sapiens hypothetical protein protein. Length = 671 Score = 42.7 bits (96), Expect = 0.002 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PP PPP PPP PPPP Sbjct: 332 PPPPPPSFPPPPPPPGTQLPPPPP 355 Score = 38.7 bits (86), Expect = 0.030 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PP PPP PP PPP PPPP Sbjct: 328 GKPIPPPPPPSFPPPPPPPGTQLPPPP 354 Score = 38.3 bits (85), Expect = 0.040 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXP--PPXPPXXPPP 938 P ++ +P PP PPP PPP PP PP P P Sbjct: 323 PWGTIGKPIPPPPPPSFPPPPPPPGTQLPPPPPSYPSP 360 Score = 33.5 bits (73), Expect = 1.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP PP P PPP P PP Sbjct: 337 PSFPPPPPPPGTQLPPPPPSYPSPKPP 363 Score = 33.1 bits (72), Expect = 1.5 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 2/28 (7%) Frame = +3 Query: 858 PGXXPPPXPPPXP--PPXPPPXPPXXPP 935 P PPP PPP PP PP P PP Sbjct: 336 PPSFPPPPPPPGTQLPPPPPSYPSPKPP 363 Score = 31.9 bits (69), Expect = 3.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP PPP P P PP PP P Sbjct: 469 PPPPPPPPLPEAASSPPPVPPLP 491 >AL031848-3|CAI19773.1| 854|Homo sapiens espin protein. Length = 854 Score = 42.7 bits (96), Expect = 0.002 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PP PPP PPP PPPP Sbjct: 430 PPPPPPSFPPPPPPPGTQLPPPPP 453 Score = 39.5 bits (88), Expect = 0.017 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PP PPP PP PPP PPPP Sbjct: 426 GKPTPPPPPPSFPPPPPPPGTQLPPPP 452 Score = 37.1 bits (82), Expect = 0.093 Identities = 16/38 (42%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXP--PPXPPXXPPP 938 P ++ P PP PPP PPP PP PP P P Sbjct: 421 PRGTIGKPTPPPPPPSFPPPPPPPGTQLPPPPPGYPAP 458 Score = 34.7 bits (76), Expect = 0.49 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP P P PP PP P Sbjct: 597 PPPPPPPPPLPEAASSPPPAPPLP 620 Score = 33.5 bits (73), Expect = 1.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP PP P PPP P PP Sbjct: 435 PSFPPPPPPPGTQLPPPPPGYPAPKPP 461 Score = 32.7 bits (71), Expect = 2.0 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 2/28 (7%) Frame = +3 Query: 858 PGXXPPPXPPPXP--PPXPPPXPPXXPP 935 P PPP PPP PP PP P PP Sbjct: 434 PPSFPPPPPPPGTQLPPPPPGYPAPKPP 461 Score = 31.1 bits (67), Expect = 6.1 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +3 Query: 846 SXVLPGXXPPPXPP-PXPPPXPPPXPP 923 S LP PPP PP P PPP PP Sbjct: 592 SRELPPPPPPPPPPLPEAASSPPPAPP 618 >AL021920-3|CAI19632.1| 671|Homo sapiens espin pseudogene protein. Length = 671 Score = 42.7 bits (96), Expect = 0.002 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PP PPP PPP PPPP Sbjct: 332 PPPPPPSFPPPPPPPGTQLPPPPP 355 Score = 38.7 bits (86), Expect = 0.030 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PP PPP PP PPP PPPP Sbjct: 328 GKPIPPPPPPSFPPPPPPPGTQLPPPP 354 Score = 38.3 bits (85), Expect = 0.040 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXP--PPXPPXXPPP 938 P ++ +P PP PPP PPP PP PP P P Sbjct: 323 PWGTIGKPIPPPPPPSFPPPPPPPGTQLPPPPPSYPSP 360 Score = 33.5 bits (73), Expect = 1.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP PP P PPP P PP Sbjct: 337 PSFPPPPPPPGTQLPPPPPSYPSPKPP 363 Score = 33.1 bits (72), Expect = 1.5 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 2/28 (7%) Frame = +3 Query: 858 PGXXPPPXPPPXP--PPXPPPXPPXXPP 935 P PPP PPP PP PP P PP Sbjct: 336 PPSFPPPPPPPGTQLPPPPPSYPSPKPP 363 Score = 31.9 bits (69), Expect = 3.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP PPP P P PP PP P Sbjct: 469 PPPPPPPPLPEAASSPPPVPPLP 491 >AF321917-1|AAK09426.1| 531|Homo sapiens androgen receptor protein. Length = 531 Score = 42.7 bits (96), Expect = 0.002 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGGG GG GGG GGG GGG GG Sbjct: 443 GGGGGGGGGGGGGGGGGGGGGGG 465 Score = 42.7 bits (96), Expect = 0.002 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 GGG GG GGG GGG GGG GGG Sbjct: 443 GGGGGGGGGGGGGGGGGGGGGGG 465 Score = 42.3 bits (95), Expect = 0.002 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXP 860 GGGG GG GGG GGG GGG G P Sbjct: 446 GGGGGGGGGGGGGGGGGGGGEAGAVAP 472 Score = 38.7 bits (86), Expect = 0.030 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GGG GGG GGG G Sbjct: 440 GPCGGGGGGGGGGGGGGGGGGGGGG 464 Score = 37.9 bits (84), Expect = 0.053 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GGG GGG GGG G Sbjct: 440 GPCGGGGGGGGGGGGGGGGGGGGGGG 465 Score = 34.7 bits (76), Expect = 0.49 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GGG GGG GGG GGG G Sbjct: 436 GQLYGPCGGGGGGGGGGGGGGGGGGG 461 >AF321916-1|AAK09425.1| 542|Homo sapiens androgen receptor protein. Length = 542 Score = 42.7 bits (96), Expect = 0.002 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGGG GG GGG GGG GGG GG Sbjct: 454 GGGGGGGGGGGGGGGGGGGGGGG 476 Score = 42.7 bits (96), Expect = 0.002 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 GGG GG GGG GGG GGG GGG Sbjct: 454 GGGGGGGGGGGGGGGGGGGGGGG 476 Score = 42.3 bits (95), Expect = 0.002 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXP 860 GGGG GG GGG GGG GGG G P Sbjct: 457 GGGGGGGGGGGGGGGGGGGGEAGAVAP 483 Score = 38.7 bits (86), Expect = 0.030 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GGG GGG GGG G Sbjct: 451 GPCGGGGGGGGGGGGGGGGGGGGGG 475 Score = 37.9 bits (84), Expect = 0.053 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GGG GGG GGG G Sbjct: 451 GPCGGGGGGGGGGGGGGGGGGGGGGG 476 Score = 34.7 bits (76), Expect = 0.49 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GGG GGG GGG GGG G Sbjct: 447 GQLYGPCGGGGGGGGGGGGGGGGGGG 472 >AF321915-1|AAK09424.1| 539|Homo sapiens androgen receptor protein. Length = 539 Score = 42.7 bits (96), Expect = 0.002 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGGG GG GGG GGG GGG GG Sbjct: 451 GGGGGGGGGGGGGGGGGGGGGGG 473 Score = 42.7 bits (96), Expect = 0.002 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 GGG GG GGG GGG GGG GGG Sbjct: 451 GGGGGGGGGGGGGGGGGGGGGGG 473 Score = 42.3 bits (95), Expect = 0.002 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXP 860 GGGG GG GGG GGG GGG G P Sbjct: 454 GGGGGGGGGGGGGGGGGGGGEAGAVAP 480 Score = 38.7 bits (86), Expect = 0.030 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GGG GGG GGG G Sbjct: 448 GPCGGGGGGGGGGGGGGGGGGGGGG 472 Score = 37.9 bits (84), Expect = 0.053 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GGG GGG GGG G Sbjct: 448 GPCGGGGGGGGGGGGGGGGGGGGGGG 473 Score = 34.7 bits (76), Expect = 0.49 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GGG GGG GGG GGG G Sbjct: 444 GQLYGPCGGGGGGGGGGGGGGGGGGG 469 >AF307160-1|AAG45052.1| 251|Homo sapiens HOXB4 protein. Length = 251 Score = 42.7 bits (96), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PPP PPP PPP PP P P PP Sbjct: 71 PGPPPPPPPPP-PPPPPPGLSPRAPAPP 97 Score = 37.5 bits (83), Expect = 0.070 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P PPP PPP PPP P P PP Sbjct: 73 PPPPPPPPPPPPPPPGLSPRAPAPPP 98 >AF287967-4|AAG31554.1| 251|Homo sapiens homeobox B4 protein. Length = 251 Score = 42.7 bits (96), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PPP PPP PPP PP P P PP Sbjct: 71 PGPPPPPPPPP-PPPPPPGLSPRAPAPP 97 Score = 37.5 bits (83), Expect = 0.070 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P PPP PPP PPP P P PP Sbjct: 73 PPPPPPPPPPPPPPPGLSPRAPAPPP 98 >AC016742-1|AAY14728.1| 784|Homo sapiens unknown protein. Length = 784 Score = 42.7 bits (96), Expect = 0.002 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P +S + P P PPP PPP PPP PP P P Sbjct: 578 PQQSGYIMTAAPPPHPPPPPPPPPPPPPLPPGQPVP 613 Score = 41.5 bits (93), Expect = 0.004 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP PPP PP P P Sbjct: 589 PPPHPPP-PPPPPPPPPPLPPGQP 611 >AB033031-1|BAA86519.1| 1217|Homo sapiens KIAA1205 protein protein. Length = 1217 Score = 42.7 bits (96), Expect = 0.002 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP P P P P PP PP P Sbjct: 638 PPPTPPPAPTPQPQPPPPPPPPQP 661 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 V P PP PPP PPP PP P PPPP Sbjct: 670 VAPTPSSPP-PPPLPPPPPPAMPSPPPPPP 698 Score = 40.7 bits (91), Expect = 0.008 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P P P P PPP PPP P P PP Sbjct: 640 PTPPPAPTPQPQPPPPPPPPQPALPSPP 667 Score = 39.9 bits (89), Expect = 0.013 Identities = 18/37 (48%), Positives = 19/37 (51%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P +L P P P PP PPP PPP PP P PP Sbjct: 659 PQPALPSPPPLVAPTPSSPP-PPPLPPPPPPAMPSPP 694 Score = 39.1 bits (87), Expect = 0.023 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PP PPP P PP PPPP Sbjct: 674 PSSPPPPPLPPPPPPAMPSPPP--PPPP 699 Score = 38.3 bits (85), Expect = 0.040 Identities = 20/64 (31%), Positives = 23/64 (35%), Gaps = 2/64 (3%) Frame = +3 Query: 753 PXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPP--PXPPPXPPX 926 P PP P + P ++ PPP PPP PP P PPP PP Sbjct: 640 PTPPPAPTPQPQPPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPPPPPPAMPSPPPPPPP 699 Query: 927 XPPP 938 P Sbjct: 700 AAAP 703 Score = 38.3 bits (85), Expect = 0.040 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P PP P PP PSP + P P P P P PPP Sbjct: 650 PQPPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPPPPPPAMPSPPP 695 Score = 36.7 bits (81), Expect = 0.12 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 4/32 (12%) Frame = +3 Query: 858 PGXXPPPXPP----PXPPPXPPPXPPXXPPPP 941 P PPP PP P PPP P P PPPP Sbjct: 650 PQPPPPPPPPQPALPSPPPLVAPTPSSPPPPP 681 Score = 35.9 bits (79), Expect = 0.21 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP+PP P P P P P P P P P PPP Sbjct: 639 PPTPPPAPTPQPQPPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPPP 685 Score = 35.9 bits (79), Expect = 0.21 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P P P P P P PP P + PPP Sbjct: 652 PPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPPPPPPAMPSPPPPPP 698 Score = 34.3 bits (75), Expect = 0.65 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 3/30 (10%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXP---PXXPPPP 941 G PP PPP PPP P P PPPP Sbjct: 627 GTPEPPLLEEKPPPTPPPAPTPQPQPPPPP 656 Score = 33.9 bits (74), Expect = 0.86 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = +3 Query: 753 PXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXP 932 P PP P Q P L P P P PPP P P PP P Sbjct: 652 PPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPPPPPPAMPSPPPPPPPAAAPLAAPPEEP 711 Query: 933 PPP 941 P Sbjct: 712 AAP 714 Score = 33.5 bits (73), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPP 923 LPG P P P PPP PPP P Sbjct: 6 LPGVPPGPPHPVRPPPPPPPPMP 28 Score = 32.7 bits (71), Expect = 2.0 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXP 920 PPP PPP PPP P P Sbjct: 220 PPPPPPPPPPPAPASEP 236 Score = 32.7 bits (71), Expect = 2.0 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXP 932 PPP PPP PPP P P Sbjct: 220 PPPPPPPPPPPAPASEP 236 Score = 31.1 bits (67), Expect = 6.1 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 814 PXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPP 933 P PP P P P P P PP P P PP Sbjct: 629 PEPPLLEEKPPPTPPPAPTPQPQPPPPPPPPQPALPSPPP 668 >M96684-1|AAA60229.1| 322|Homo sapiens Pur protein. Length = 322 Score = 42.3 bits (95), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG GGG GGG G G GGG PG Sbjct: 25 GSGSGSGGGGGGGGGGGGSGGGGGGAPG 52 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGGG GG GGG GGG GG GG Sbjct: 31 GGGGGGGGGGGGSGGGGGGAPGG 53 Score = 39.1 bits (87), Expect = 0.023 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRTXE 845 G G GG GGG GGG GG GGG G E Sbjct: 27 GSGSGGGGGGGGGGGGSGGGGGGAPGGLQHE 57 Score = 36.3 bits (80), Expect = 0.16 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXE 845 G GG GG GGG G G GGG G T E Sbjct: 29 GSGGGGGGGGGGGGSGGGGGGAPGGLQHETQE 60 Score = 35.9 bits (79), Expect = 0.21 Identities = 17/30 (56%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXG--GXGGGXGGGXGGGXGGGXXPG 857 G GG G G G G GGG GGG GGG G Sbjct: 16 GSGGSLGHPGSGSGSGGGGGGGGGGGGSGG 45 Score = 34.7 bits (76), Expect = 0.49 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G GGG GGG GGG GG G Sbjct: 22 GHPGSGSGSGGGGGGGGGGGGSGGGGGG 49 Score = 32.3 bits (70), Expect = 2.6 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G G GGG GGG GGG G Sbjct: 19 GSLGHPGSGSGSGGGGGGGGGGGGSGGG 46 >BT019388-1|AAV38195.1| 322|Homo sapiens purine-rich element binding protein A protein. Length = 322 Score = 42.3 bits (95), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG GGG GGG G G GGG PG Sbjct: 25 GSGSGSGGGGGGGGGGGGSGGGGGGAPG 52 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGGG GG GGG GGG GG GG Sbjct: 31 GGGGGGGGGGGGSGGGGGGAPGG 53 Score = 39.1 bits (87), Expect = 0.023 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRTXE 845 G G GG GGG GGG GG GGG G E Sbjct: 27 GSGSGGGGGGGGGGGGSGGGGGGAPGGLQHE 57 Score = 36.3 bits (80), Expect = 0.16 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXE 845 G GG GG GGG G G GGG G T E Sbjct: 29 GSGGGGGGGGGGGGSGGGGGGAPGGLQHETQE 60 Score = 35.9 bits (79), Expect = 0.21 Identities = 17/30 (56%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXG--GXGGGXGGGXGGGXGGGXXPG 857 G GG G G G G GGG GGG GGG G Sbjct: 16 GSGGSLGHPGSGSGSGGGGGGGGGGGGSGG 45 Score = 34.7 bits (76), Expect = 0.49 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G GGG GGG GGG GG G Sbjct: 22 GHPGSGSGSGGGGGGGGGGGGSGGGGGG 49 Score = 32.3 bits (70), Expect = 2.6 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G G GGG GGG GGG G Sbjct: 19 GSLGHPGSGSGSGGGGGGGGGGGGSGGG 46 >BC040943-1|AAH40943.1| 498|Homo sapiens WAS protein family, member 2 protein. Length = 498 Score = 42.3 bits (95), Expect = 0.002 Identities = 20/37 (54%), Positives = 20/37 (54%), Gaps = 9/37 (24%) Frame = +3 Query: 858 PGXXPPPXPPPXPPP---XPPPXP------PXXPPPP 941 PG PPP PPP PPP PPP P P PPPP Sbjct: 314 PGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPP 350 Score = 41.1 bits (92), Expect = 0.006 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG P PPP PPP PPP PPPP Sbjct: 310 PGPKPGFAPPPAPPPPPPPMIGIPPPPP 337 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPPPX---PPPXPPPXPPXXPPPP 941 P PPP P PPP PPP PP PPPP Sbjct: 376 PTLPPPPLSQPTGGAPPPPPPPPPPGPPPPP 406 Score = 39.1 bits (87), Expect = 0.023 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PPP PP PP PP PPPP Sbjct: 344 PGTPPPPSPPSFPPHPDFAAPPPPPPPP 371 Score = 38.7 bits (86), Expect = 0.030 Identities = 25/71 (35%), Positives = 25/71 (35%), Gaps = 7/71 (9%) Frame = +3 Query: 747 SXPXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPPXP-- 920 S P PP P P LS P PP PPP PPP PPP P Sbjct: 351 SPPSFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQ--PTGGAPPPPPPPPPPGPPPPPFT 408 Query: 921 -----PXXPPP 938 P PPP Sbjct: 409 GADGQPAIPPP 419 Score = 38.3 bits (85), Expect = 0.040 Identities = 21/39 (53%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPP--XPPXXPPPP 941 P RS S V P PPP PP PP P P PP PPPP Sbjct: 289 PKRS-SVVSPSH-PPPAPPLGSPPGPKPGFAPPPAPPPP 325 Score = 36.3 bits (80), Expect = 0.16 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSP---XFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP+PP P PP P P F P P P P P P PPP Sbjct: 319 PPAPPPPPPPMIGIPPPPPPVGFGSPGTP-PPPSPPSFPPHPDFAAPPPP 367 Score = 34.3 bits (75), Expect = 0.65 Identities = 19/52 (36%), Positives = 21/52 (40%), Gaps = 5/52 (9%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXP-----XPXXPPXPXXPXTXXXPPP 936 P +PP P PP P P F+ P P P PP P T PPP Sbjct: 344 PGTPPPPSPP--SFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPP 393 Score = 33.1 bits (72), Expect = 1.5 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G P PPP PP PP P PPP Sbjct: 340 GFGSPGTPPPPSPPSFPPHPDFAAPPP 366 Score = 30.7 bits (66), Expect = 8.0 Identities = 17/46 (36%), Positives = 19/46 (41%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPP 933 PP+PP PP P P F+ P P P PP P PP Sbjct: 301 PPAPPLGSPPG----PKPGFA----PPPAPPPPPPPMIGIPPPPPP 338 Score = 30.7 bits (66), Expect = 8.0 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 10/34 (29%) Frame = +3 Query: 870 PPPXPPPXP--PPXPPPX--------PPXXPPPP 941 PPP PPP P PPP PP PPPP Sbjct: 365 PPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPPP 398 >BC036087-1|AAH36087.1| 322|Homo sapiens purine-rich element binding protein A protein. Length = 322 Score = 42.3 bits (95), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG GGG GGG G G GGG PG Sbjct: 25 GSGSGSGGGGGGGGGGGGSGGGGGGAPG 52 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGGG GG GGG GGG GG GG Sbjct: 31 GGGGGGGGGGGGSGGGGGGAPGG 53 Score = 39.1 bits (87), Expect = 0.023 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRTXE 845 G G GG GGG GGG GG GGG G E Sbjct: 27 GSGSGGGGGGGGGGGGSGGGGGGAPGGLQHE 57 Score = 36.3 bits (80), Expect = 0.16 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXE 845 G GG GG GGG G G GGG G T E Sbjct: 29 GSGGGGGGGGGGGGSGGGGGGAPGGLQHETQE 60 Score = 35.9 bits (79), Expect = 0.21 Identities = 17/30 (56%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXG--GXGGGXGGGXGGGXGGGXXPG 857 G GG G G G G GGG GGG GGG G Sbjct: 16 GSGGSLGHPGSGSGSGGGGGGGGGGGGSGG 45 Score = 34.7 bits (76), Expect = 0.49 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G GGG GGG GGG GG G Sbjct: 22 GHPGSGSGSGGGGGGGGGGGGSGGGGGG 49 Score = 32.3 bits (70), Expect = 2.6 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G G GGG GGG GGG G Sbjct: 19 GSLGHPGSGSGSGGGGGGGGGGGGSGGG 46 >AL121749-3|CAC10185.1| 694|Homo sapiens frizzled homolog 8 (Drosophila) protein. Length = 694 Score = 42.3 bits (95), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G GGG GGG GGG GGG PG Sbjct: 632 GAGATAAGGGGGPGGGGGGGPGGGGGPG 659 Score = 41.9 bits (94), Expect = 0.003 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG G G GGG Sbjct: 640 GGGGPGGGGGGGPGGGGGPGGGGG 663 Score = 38.7 bits (86), Expect = 0.030 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GG GG GGG Sbjct: 639 GGGGGPGGGGGGGPGGGGGPGGGG 662 Score = 35.9 bits (79), Expect = 0.21 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GGG G G G Sbjct: 639 GGG--GGPGGGGGGGPGGGGGPGGGGG 663 Score = 33.9 bits (74), Expect = 0.86 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G G GGG GGG GGG G Sbjct: 630 GGGAGATAAGGGGGPGGGGGGGPGGG 655 Score = 30.7 bits (66), Expect = 8.0 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GG G GGGG P GGGG Sbjct: 639 GGGGGPGGGGGGGPGGGGGPGGGG 662 >AL096774-6|CAC18518.1| 498|Homo sapiens WAS protein family, member 2 protein. Length = 498 Score = 42.3 bits (95), Expect = 0.002 Identities = 20/37 (54%), Positives = 20/37 (54%), Gaps = 9/37 (24%) Frame = +3 Query: 858 PGXXPPPXPPPXPPP---XPPPXP------PXXPPPP 941 PG PPP PPP PPP PPP P P PPPP Sbjct: 314 PGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPP 350 Score = 41.1 bits (92), Expect = 0.006 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG P PPP PPP PPP PPPP Sbjct: 310 PGPKPGFAPPPAPPPPPPPMIGIPPPPP 337 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPPPX---PPPXPPPXPPXXPPPP 941 P PPP P PPP PPP PP PPPP Sbjct: 376 PTLPPPPLSQPTGGAPPPPPPPPPPGPPPPP 406 Score = 39.1 bits (87), Expect = 0.023 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PPP PP PP PP PPPP Sbjct: 344 PGTPPPPSPPSFPPHPDFAAPPPPPPPP 371 Score = 38.7 bits (86), Expect = 0.030 Identities = 25/71 (35%), Positives = 25/71 (35%), Gaps = 7/71 (9%) Frame = +3 Query: 747 SXPXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPPXP-- 920 S P PP P P LS P PP PPP PPP PPP P Sbjct: 351 SPPSFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQ--PTGGAPPPPPPPPPPGPPPPPFT 408 Query: 921 -----PXXPPP 938 P PPP Sbjct: 409 GADGQPAIPPP 419 Score = 38.3 bits (85), Expect = 0.040 Identities = 21/39 (53%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPP--XPPXXPPPP 941 P RS S V P PPP PP PP P P PP PPPP Sbjct: 289 PKRS-SVVSPSH-PPPAPPLGSPPGPKPGFAPPPAPPPP 325 Score = 36.3 bits (80), Expect = 0.16 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSP---XFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP+PP P PP P P F P P P P P P PPP Sbjct: 319 PPAPPPPPPPMIGIPPPPPPVGFGSPGTP-PPPSPPSFPPHPDFAAPPPP 367 Score = 34.3 bits (75), Expect = 0.65 Identities = 19/52 (36%), Positives = 21/52 (40%), Gaps = 5/52 (9%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXP-----XPXXPPXPXXPXTXXXPPP 936 P +PP P PP P P F+ P P P PP P T PPP Sbjct: 344 PGTPPPPSPP--SFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPP 393 Score = 33.1 bits (72), Expect = 1.5 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G P PPP PP PP P PPP Sbjct: 340 GFGSPGTPPPPSPPSFPPHPDFAAPPP 366 Score = 30.7 bits (66), Expect = 8.0 Identities = 17/46 (36%), Positives = 19/46 (41%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPP 933 PP+PP PP P P F+ P P P PP P PP Sbjct: 301 PPAPPLGSPPG----PKPGFA----PPPAPPPPPPPMIGIPPPPPP 338 Score = 30.7 bits (66), Expect = 8.0 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 10/34 (29%) Frame = +3 Query: 870 PPPXPPPXP--PPXPPPX--------PPXXPPPP 941 PPP PPP P PPP PP PPPP Sbjct: 365 PPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPPP 398 >AK095189-1|BAC04495.1| 634|Homo sapiens protein ( Homo sapiens cDNA FLJ37870 fis, clone BRSSN2017682, highly similar to Mus musculus p300 transcriptional cofactor JMY mRNA. ). Length = 634 Score = 42.3 bits (95), Expect = 0.002 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPP 923 LP PP PPP PPP PPP PP Sbjct: 449 LPSPLPPTPPPPPPPPPPPPPPP 471 Score = 41.9 bits (94), Expect = 0.003 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 P P PP PPP PPP PP PP P Sbjct: 450 PSPLPPTPPPPPPPPPPPPPPPLP 473 Score = 41.1 bits (92), Expect = 0.006 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 P P P P PP PPP PP PPPP Sbjct: 448 PLPSPLPPTPPPPPPPPPPPPPPP 471 Score = 34.3 bits (75), Expect = 0.65 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +3 Query: 846 SXVLPGXXPPPXPPPXPPPXPPP 914 S + P PPP PPP PPP P P Sbjct: 451 SPLPPTPPPPPPPPPPPPPPPLP 473 >AJ509090-1|CAD48858.1| 625|Homo sapiens Wiskott-Aldrich syndrome protein family member 4 protein. Length = 625 Score = 42.3 bits (95), Expect = 0.002 Identities = 20/37 (54%), Positives = 20/37 (54%), Gaps = 9/37 (24%) Frame = +3 Query: 858 PGXXPPPXPPPXPPP---XPPPXP------PXXPPPP 941 PG PPP PPP PPP PPP P P PPPP Sbjct: 442 PGFAPPPAPPPPPPPMIGIPPPPPPIGFGSPGTPPPP 478 Score = 38.7 bits (86), Expect = 0.030 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P PPP PPP PPP PPPP Sbjct: 438 PSSKPGFAPPPAPPPPPPPMIGIPPPPP 465 Score = 38.7 bits (86), Expect = 0.030 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPPX--PPPXPPPXPPXXPPPP 941 P PPP P PP PPP PP PPPP Sbjct: 504 PTLPPPPLSQPTRGAPPPPPPPPPGPPPPP 533 Score = 37.9 bits (84), Expect = 0.053 Identities = 23/68 (33%), Positives = 23/68 (33%), Gaps = 4/68 (5%) Frame = +3 Query: 747 SXPXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPP----P 914 S P PP P P LS G PPP PPP PP PP Sbjct: 479 SSPSFPPHPDFAAPPPLPPPPAADYPTLPPPPLSQPTRGAPPPPPPPPPGPPPPPFTGAD 538 Query: 915 XPPXXPPP 938 P PPP Sbjct: 539 GQPAVPPP 546 Score = 36.7 bits (81), Expect = 0.12 Identities = 21/67 (31%), Positives = 22/67 (32%) Frame = +3 Query: 741 GGSXPXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPPXP 920 G P PP P P + LP PP P P PPP P Sbjct: 468 GFGSPGTPPPPSSPSFPPHPDFAAPPPLPPPPAADYPTLP--PPPLSQPTRGAPPPPPPP 525 Query: 921 PXXPPPP 941 P PPPP Sbjct: 526 PPGPPPP 532 Score = 34.3 bits (75), Expect = 0.65 Identities = 22/43 (51%), Positives = 22/43 (51%), Gaps = 6/43 (13%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPX------PPPXPPXXPPPP 941 P RS S V P PPP PP PP PPP PP PPPP Sbjct: 417 PKRS-SVVSPSH-PPPAPPLGSPPSSKPGFAPPPAPP-PPPPP 456 Score = 32.7 bits (71), Expect = 2.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P PP PP PPP PPPP Sbjct: 437 PPSSKPGFAPPPAPPPPPPPMIGIPPPP 464 Score = 32.3 bits (70), Expect = 2.6 Identities = 20/61 (32%), Positives = 21/61 (34%), Gaps = 6/61 (9%) Frame = +1 Query: 772 PXSXFXWXPPSPPXPXPPXXXXXPSP----XFSLXXXPXP--XPXXPPXPXXPXTXXXPP 933 P S + PP P P PP P P F P P P PP P PP Sbjct: 438 PSSKPGFAPPPAPPPPPPPMIGIPPPPPPIGFGSPGTPPPPSSPSFPPHPDFAAPPPLPP 497 Query: 934 P 936 P Sbjct: 498 P 498 >AF134304-1|AAD33053.2| 496|Homo sapiens Scar2 protein. Length = 496 Score = 42.3 bits (95), Expect = 0.002 Identities = 20/37 (54%), Positives = 20/37 (54%), Gaps = 9/37 (24%) Frame = +3 Query: 858 PGXXPPPXPPPXPPP---XPPPXP------PXXPPPP 941 PG PPP PPP PPP PPP P P PPPP Sbjct: 313 PGFAPPPAPPPPPPPMIGIPPPPPPIGFGSPGTPPPP 349 Score = 38.7 bits (86), Expect = 0.030 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P PPP PPP PPP PPPP Sbjct: 309 PSSKPGFAPPPAPPPPPPPMIGIPPPPP 336 Score = 38.7 bits (86), Expect = 0.030 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPPX--PPPXPPPXPPXXPPPP 941 P PPP P PP PPP PP PPPP Sbjct: 375 PTLPPPPLSQPTRGAPPPPPPPPPGPPPPP 404 Score = 37.9 bits (84), Expect = 0.053 Identities = 23/68 (33%), Positives = 23/68 (33%), Gaps = 4/68 (5%) Frame = +3 Query: 747 SXPXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPP----P 914 S P PP P P LS G PPP PPP PP PP Sbjct: 350 SSPSFPPHPDFAAPPPLPPPPAADYPTLPPPPLSQPTRGAPPPPPPPPPGPPPPPFTGAD 409 Query: 915 XPPXXPPP 938 P PPP Sbjct: 410 GQPAVPPP 417 Score = 36.7 bits (81), Expect = 0.12 Identities = 21/67 (31%), Positives = 22/67 (32%) Frame = +3 Query: 741 GGSXPXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPPXP 920 G P PP P P + LP PP P P PPP P Sbjct: 339 GFGSPGTPPPPSSPSFPPHPDFAAPPPLPPPPAADYPTLP--PPPLSQPTRGAPPPPPPP 396 Query: 921 PXXPPPP 941 P PPPP Sbjct: 397 PPGPPPP 403 Score = 34.3 bits (75), Expect = 0.65 Identities = 22/43 (51%), Positives = 22/43 (51%), Gaps = 6/43 (13%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPX------PPPXPPXXPPPP 941 P RS S V P PPP PP PP PPP PP PPPP Sbjct: 288 PKRS-SVVSPSH-PPPAPPLGSPPSSKPGFAPPPAPP-PPPPP 327 Score = 32.7 bits (71), Expect = 2.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P PP PP PPP PPPP Sbjct: 308 PPSSKPGFAPPPAPPPPPPPMIGIPPPP 335 Score = 32.3 bits (70), Expect = 2.6 Identities = 20/61 (32%), Positives = 21/61 (34%), Gaps = 6/61 (9%) Frame = +1 Query: 772 PXSXFXWXPPSPPXPXPPXXXXXPSP----XFSLXXXPXP--XPXXPPXPXXPXTXXXPP 933 P S + PP P P PP P P F P P P PP P PP Sbjct: 309 PSSKPGFAPPPAPPPPPPPMIGIPPPPPPIGFGSPGTPPPPSSPSFPPHPDFAAPPPLPP 368 Query: 934 P 936 P Sbjct: 369 P 369 >AB043703-1|BAB41064.1| 694|Homo sapiens seven-transmembrane receptor Frizzled-8 protein. Length = 694 Score = 42.3 bits (95), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G GGG GGG GGG GGG PG Sbjct: 632 GAGATAAGGGGGPGGGGGGGPGGGGGPG 659 Score = 41.9 bits (94), Expect = 0.003 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG G G GGG Sbjct: 640 GGGGPGGGGGGGPGGGGGPGGGGG 663 Score = 38.7 bits (86), Expect = 0.030 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GG GG GGG Sbjct: 639 GGGGGPGGGGGGGPGGGGGPGGGG 662 Score = 35.9 bits (79), Expect = 0.21 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GGG G G G Sbjct: 639 GGG--GGPGGGGGGGPGGGGGPGGGGG 663 Score = 33.9 bits (74), Expect = 0.86 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G G GGG GGG GGG G Sbjct: 630 GGGAGATAAGGGGGPGGGGGGGPGGG 655 Score = 30.7 bits (66), Expect = 8.0 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GG G GGGG P GGGG Sbjct: 639 GGGGGPGGGGGGGPGGGGGPGGGG 662 >AB026542-1|BAA81795.1| 498|Homo sapiens WASP-family protein protein. Length = 498 Score = 42.3 bits (95), Expect = 0.002 Identities = 20/37 (54%), Positives = 20/37 (54%), Gaps = 9/37 (24%) Frame = +3 Query: 858 PGXXPPPXPPPXPPP---XPPPXP------PXXPPPP 941 PG PPP PPP PPP PPP P P PPPP Sbjct: 314 PGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPP 350 Score = 41.1 bits (92), Expect = 0.006 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG P PPP PPP PPP PPPP Sbjct: 310 PGPKPGFAPPPAPPPPPPPMIGIPPPPP 337 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPPPX---PPPXPPPXPPXXPPPP 941 P PPP P PPP PPP PP PPPP Sbjct: 376 PTLPPPPLSQPTGGAPPPPPPPPPPGPPPPP 406 Score = 39.1 bits (87), Expect = 0.023 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PPP PP PP PP PPPP Sbjct: 344 PGTPPPPSPPSFPPHPDFAAPPPPPPPP 371 Score = 38.7 bits (86), Expect = 0.030 Identities = 25/71 (35%), Positives = 25/71 (35%), Gaps = 7/71 (9%) Frame = +3 Query: 747 SXPXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPPXP-- 920 S P PP P P LS P PP PPP PPP PPP P Sbjct: 351 SPPSFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQ--PTGGAPPPPPPPPPPGPPPPPFT 408 Query: 921 -----PXXPPP 938 P PPP Sbjct: 409 GADGQPAIPPP 419 Score = 38.3 bits (85), Expect = 0.040 Identities = 21/39 (53%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPP--XPPXXPPPP 941 P RS S V P PPP PP PP P P PP PPPP Sbjct: 289 PKRS-SVVSPSH-PPPAPPLGSPPGPKPGFAPPPAPPPP 325 Score = 36.3 bits (80), Expect = 0.16 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSP---XFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP+PP P PP P P F P P P P P P PPP Sbjct: 319 PPAPPPPPPPMIGIPPPPPPVGFGSPGTP-PPPSPPSFPPHPDFAAPPPP 367 Score = 34.3 bits (75), Expect = 0.65 Identities = 19/52 (36%), Positives = 21/52 (40%), Gaps = 5/52 (9%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXP-----XPXXPPXPXXPXTXXXPPP 936 P +PP P PP P P F+ P P P PP P T PPP Sbjct: 344 PGTPPPPSPP--SFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPP 393 Score = 33.1 bits (72), Expect = 1.5 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G P PPP PP PP P PPP Sbjct: 340 GFGSPGTPPPPSPPSFPPHPDFAAPPP 366 Score = 30.7 bits (66), Expect = 8.0 Identities = 17/46 (36%), Positives = 19/46 (41%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPP 933 PP+PP PP P P F+ P P P PP P PP Sbjct: 301 PPAPPLGSPPG----PKPGFA----PPPAPPPPPPPMIGIPPPPPP 338 Score = 30.7 bits (66), Expect = 8.0 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 10/34 (29%) Frame = +3 Query: 870 PPPXPPPXP--PPXPPPX--------PPXXPPPP 941 PPP PPP P PPP PP PPPP Sbjct: 365 PPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPPP 398 >X16667-1|CAA34657.1| 431|Homo sapiens protein ( Human HOX2G mRNA from the Hox2 locus. ). Length = 431 Score = 41.9 bits (94), Expect = 0.003 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXP 860 GGGG GG GG GGG GGG GG P Sbjct: 156 GGGGGGGGGSGGSGGGGGGGGGGDKSP 182 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GG GGG GGG G PG Sbjct: 157 GGGGGGGGSGGSGGGGGGGGGGDKSPPG 184 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GG G G GGG GGG Sbjct: 154 GGGGGGGGGGGSGGSGGGGGGGGG 177 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG G G GG GGG GGG Sbjct: 155 GGGGGGGGGGSGGSGGGGGGGGGG 178 Score = 39.1 bits (87), Expect = 0.023 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 G GG GG GGG GG GGG GGG Sbjct: 152 GCGGGGGGGGGGGSGGSGGGGGGG 175 Score = 36.3 bits (80), Expect = 0.16 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GGG GG GGG G Sbjct: 152 GCGGGGGGGGGGGSGGSGGGGGGGG 176 Score = 35.1 bits (77), Expect = 0.37 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG GGG G G GG GGG G Sbjct: 152 GCGGGGGGGGGGGSGGSGGGGGGGGGG 178 Score = 35.1 bits (77), Expect = 0.37 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = -2 Query: 922 GGXGGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GG GGG GGG GG GGG G ++ G Sbjct: 154 GGGGGGGGGGGSGGSGGGGGGGGGGDKSPPG 184 Score = 33.1 bits (72), Expect = 1.5 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GGG GGG GGG GG G Sbjct: 148 GTAEGCGGGGGGGGGGGSGGSGGGG 172 Score = 30.7 bits (66), Expect = 8.0 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 152 GCGGGGGGGGGGGSGGSGGGGGGG 175 >U59298-1|AAD10852.1| 431|Homo sapiens hox homeobox transcription factor HOXB3 protein. Length = 431 Score = 41.9 bits (94), Expect = 0.003 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXP 860 GGGG GG GG GGG GGG GG P Sbjct: 156 GGGGGGGGGSGGSGGGGGGGGGGDKSP 182 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GG GGG GGG G PG Sbjct: 157 GGGGGGGGSGGSGGGGGGGGGGDKSPPG 184 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GG G G GGG GGG Sbjct: 154 GGGGGGGGGGGSGGSGGGGGGGGG 177 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG G G GG GGG GGG Sbjct: 155 GGGGGGGGGGSGGSGGGGGGGGGG 178 Score = 39.1 bits (87), Expect = 0.023 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 G GG GG GGG GG GGG GGG Sbjct: 152 GCGGGGGGGGGGGSGGSGGGGGGG 175 Score = 36.3 bits (80), Expect = 0.16 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GGG GG GGG G Sbjct: 152 GCGGGGGGGGGGGSGGSGGGGGGGG 176 Score = 35.1 bits (77), Expect = 0.37 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG GGG G G GG GGG G Sbjct: 152 GCGGGGGGGGGGGSGGSGGGGGGGGGG 178 Score = 35.1 bits (77), Expect = 0.37 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = -2 Query: 922 GGXGGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GG GGG GGG GG GGG G ++ G Sbjct: 154 GGGGGGGGGGGSGGSGGGGGGGGGGDKSPPG 184 Score = 33.1 bits (72), Expect = 1.5 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GGG GGG GGG GG G Sbjct: 148 GTAEGCGGGGGGGGGGGSGGSGGGG 172 Score = 30.7 bits (66), Expect = 8.0 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 152 GCGGGGGGGGGGGSGGSGGGGGGG 175 >BC044311-1|AAH44311.2| 399|Homo sapiens hypothetical protein LOC339344 protein. Length = 399 Score = 41.9 bits (94), Expect = 0.003 Identities = 17/34 (50%), Positives = 19/34 (55%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 +L +LPG PPP PPP PPP PP PP Sbjct: 293 ALLPLLPGTPVDSLPPPLPPPPPPPPPPRPVLPP 326 Score = 39.1 bits (87), Expect = 0.023 Identities = 16/28 (57%), Positives = 16/28 (57%), Gaps = 4/28 (14%) Frame = +3 Query: 870 PPPXPPPXPPPXP----PPXPPXXPPPP 941 PPP PP PPP P P PP PPPP Sbjct: 220 PPPPAPPLPPPPPLAQVAPSPPSPPPPP 247 Score = 33.5 bits (73), Expect = 1.1 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 4/32 (12%) Frame = +3 Query: 858 PGXXPPPXPPPXP----PPXPPPXPPXXPPPP 941 P PP PPP P P PP PP PPP Sbjct: 220 PPPPAPPLPPPPPLAQVAPSPPSPPPPPRPPP 251 Score = 33.1 bits (72), Expect(2) = 0.069 Identities = 14/31 (45%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXP-PPXPPPXP 920 P + + P PPP PPP P P PPP P Sbjct: 299 PGTPVDSLPPPLPPPPPPPPPPRPVLPPPAP 329 Score = 31.1 bits (67), Expect = 6.1 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P SL LP PPP PP P P P P P Sbjct: 302 PVDSLPPPLPPPPPPPPPPRPVLPPPAPKVEITPEP 337 Score = 23.4 bits (48), Expect(2) = 0.069 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +3 Query: 894 PPPXPPPXPPXXPPP 938 P P P P PP PP Sbjct: 366 PRPPPAPLPPHDSPP 380 >AF287967-5|AAG31555.1| 431|Homo sapiens homeobox B3 protein. Length = 431 Score = 41.9 bits (94), Expect = 0.003 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXP 860 GGGG GG GG GGG GGG GG P Sbjct: 156 GGGGGGGGGSGGSGGGGGGGGGGDKSP 182 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GG GGG GGG G PG Sbjct: 157 GGGGGGGGSGGSGGGGGGGGGGDKSPPG 184 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GG G G GGG GGG Sbjct: 154 GGGGGGGGGGGSGGSGGGGGGGGG 177 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG G G GG GGG GGG Sbjct: 155 GGGGGGGGGGSGGSGGGGGGGGGG 178 Score = 39.1 bits (87), Expect = 0.023 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 G GG GG GGG GG GGG GGG Sbjct: 152 GCGGGGGGGGGGGSGGSGGGGGGG 175 Score = 36.3 bits (80), Expect = 0.16 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GGG GG GGG G Sbjct: 152 GCGGGGGGGGGGGSGGSGGGGGGGG 176 Score = 35.1 bits (77), Expect = 0.37 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG GGG G G GG GGG G Sbjct: 152 GCGGGGGGGGGGGSGGSGGGGGGGGGG 178 Score = 35.1 bits (77), Expect = 0.37 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = -2 Query: 922 GGXGGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GG GGG GGG GG GGG G ++ G Sbjct: 154 GGGGGGGGGGGSGGSGGGGGGGGGGDKSPPG 184 Score = 33.1 bits (72), Expect = 1.5 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GGG GGG GGG GG G Sbjct: 148 GTAEGCGGGGGGGGGGGSGGSGGGG 172 Score = 30.7 bits (66), Expect = 8.0 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 152 GCGGGGGGGGGGGSGGSGGGGGGG 175 >AB183864-1|BAD86792.1| 1271|Homo sapiens diacylglycerol kinase kappa protein. Length = 1271 Score = 41.9 bits (94), Expect = 0.003 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPP 923 PPP PPP PPP PPP PP Sbjct: 27 PPPWPPPPPPPAPPPAPP 44 Score = 41.5 bits (93), Expect = 0.004 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P P P PPP PPP PPP PP PP Sbjct: 20 PAESPEP-PPPWPPPPPPPAPPPAPP 44 Score = 37.5 bits (83), Expect = 0.070 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPP 938 G P P P PPP PPP PP PPP Sbjct: 17 GEQPAESPEP-PPPWPPPPPPPAPPP 41 Score = 37.1 bits (82), Expect = 0.093 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP PPP PPP PP P P Sbjct: 27 PPPWPPPPPPPAPPPAPPLLSEASPEP 53 Score = 33.1 bits (72), Expect = 1.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPP 938 P PPP PP PPP P PP Sbjct: 24 PEPPPPWPPPPPPPAPPPAPP 44 Score = 30.7 bits (66), Expect = 8.0 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP PPP PP P P P Sbjct: 31 PPPPPPPAPPPAPPLLSEASPEPIPEP 57 >Z29074-1|CAA82315.1| 623|Homo sapiens cytokeratin 9 protein. Length = 623 Score = 41.5 bits (93), Expect = 0.004 Identities = 17/30 (56%), Positives = 18/30 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRT 851 GG G GG GGG GGG GGG GG G + Sbjct: 522 GGSGSGGGSGGGYGGGSGGGHSGGSGGGHS 551 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GG GGG G Sbjct: 527 GGGSGGGYGGGSGGGHSGGSGGGHSGG 553 Score = 40.3 bits (90), Expect = 0.010 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG GG GGG GGG GGG GGG G Sbjct: 103 GGYSSSGGFGGGFGGGSGGGFGGGYGSG 130 Score = 40.3 bits (90), Expect = 0.010 Identities = 34/107 (31%), Positives = 34/107 (31%), Gaps = 2/107 (1%) Frame = -2 Query: 940 GGGGXXGGXGGGXG--GGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGX 767 GGGG GG GGG G GG GG GGG G G G G Sbjct: 498 GGGGSGGGYGGGSGSRGGSGGSYGGGSGSG---GGSGGGYGGGSGGGHSGGSGGGHSGGS 554 Query: 766 GGXLGXEPPHXPRGGXEKGXXCGG*GXLRGXXGPXXGXGGRXXXXXG 626 GG G G G G G G G G GG G Sbjct: 555 GGNYGGGSGSGGGSGGGYGGGSGSRGGSGGSHGGGSGFGGESGGSYG 601 Score = 37.9 bits (84), Expect = 0.053 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GGG GGG G G GG Sbjct: 112 GGGFGGGSGGGFGGGYGSGFGG 133 Score = 36.7 bits (81), Expect = 0.12 Identities = 31/99 (31%), Positives = 32/99 (32%), Gaps = 1/99 (1%) Frame = -2 Query: 940 GGGGXXG-GXGGGXGGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXG 764 G GG G G GG GG GGG GG G + R G G G Sbjct: 480 GSGGSYGRGSRGGSGGSYGGGGSGGGYGGGSGSRGGSGGSYGGG--------SGSGGGSG 531 Query: 763 GXLGXEPPHXPRGGXEKGXXCGG*GXLRGXXGPXXGXGG 647 G G GG G G G G G G GG Sbjct: 532 GGYGGGSGGGHSGGSGGGHSGGSGGNYGGGSGSGGGSGG 570 Score = 35.9 bits (79), Expect = 0.21 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXG--GGXGGGXXPG 857 GGG GG GGG G G G GG GGG G Sbjct: 116 GGGSGGGFGGGYGSGFGGLGGFGGGAGGG 144 Score = 34.3 bits (75), Expect = 0.65 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXG-GGXGGGXXPG 857 GG G GG GG GGG G GG GG G Sbjct: 574 GGSGSRGGSGGSHGGGSGFGGESGGSYGG 602 Score = 33.9 bits (74), Expect = 0.86 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 3/31 (9%) Frame = -2 Query: 940 GGGGXXGGX---GGGXGGGXGGGXGGGXXPG 857 G GG GG GG GGG GGG GGG G Sbjct: 96 GFGGASGGGYSSSGGFGGGFGGGSGGGFGGG 126 Score = 32.7 bits (71), Expect = 2.0 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -2 Query: 937 GGGXXGGXGG--GXGGGXGGGXGG 872 GGG G GG G GGG GGG GG Sbjct: 124 GGGYGSGFGGLGGFGGGAGGGDGG 147 Score = 31.5 bits (68), Expect = 4.6 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GG G G G G GG GG GGG Sbjct: 580 GGSGGSHGGGSGFGGESGGSYGGG 603 Score = 30.7 bits (66), Expect = 8.0 Identities = 17/30 (56%), Positives = 17/30 (56%), Gaps = 6/30 (20%) Frame = -2 Query: 940 GGGGXXG-GXGGGXGGG-----XGGGXGGG 869 GGGG G GGG GGG GGG GGG Sbjct: 64 GGGGSFGYSYGGGSGGGFSASSLGGGFGGG 93 >X75015-1|CAA52924.1| 622|Homo sapiens keratin 9 protein. Length = 622 Score = 41.5 bits (93), Expect = 0.004 Identities = 17/30 (56%), Positives = 18/30 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRT 851 GG G GG GGG GGG GGG GG G + Sbjct: 521 GGSGSGGGSGGGYGGGSGGGHSGGSGGGHS 550 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GG GGG G Sbjct: 526 GGGSGGGYGGGSGGGHSGGSGGGHSGG 552 Score = 40.3 bits (90), Expect = 0.010 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG GG GGG GGG GGG GGG G Sbjct: 102 GGYSSSGGFGGGFGGGSGGGFGGGYGSG 129 Score = 40.3 bits (90), Expect = 0.010 Identities = 34/107 (31%), Positives = 34/107 (31%), Gaps = 2/107 (1%) Frame = -2 Query: 940 GGGGXXGGXGGGXG--GGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGX 767 GGGG GG GGG G GG GG GGG G G G G Sbjct: 497 GGGGSGGGYGGGSGSRGGSGGSYGGGSGSG---GGSGGGYGGGSGGGHSGGSGGGHSGGS 553 Query: 766 GGXLGXEPPHXPRGGXEKGXXCGG*GXLRGXXGPXXGXGGRXXXXXG 626 GG G G G G G G G G GG G Sbjct: 554 GGNYGGGSGSGGGSGGGYGGGSGSRGGSGGSHGGGSGFGGESGGSYG 600 Score = 37.9 bits (84), Expect = 0.053 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GGG GGG G G GG Sbjct: 111 GGGFGGGSGGGFGGGYGSGFGG 132 Score = 36.7 bits (81), Expect = 0.12 Identities = 31/99 (31%), Positives = 32/99 (32%), Gaps = 1/99 (1%) Frame = -2 Query: 940 GGGGXXG-GXGGGXGGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXG 764 G GG G G GG GG GGG GG G + R G G G Sbjct: 479 GSGGSYGRGSRGGSGGSYGGGGSGGGYGGGSGSRGGSGGSYGGG--------SGSGGGSG 530 Query: 763 GXLGXEPPHXPRGGXEKGXXCGG*GXLRGXXGPXXGXGG 647 G G GG G G G G G G GG Sbjct: 531 GGYGGGSGGGHSGGSGGGHSGGSGGNYGGGSGSGGGSGG 569 Score = 35.9 bits (79), Expect = 0.21 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXG--GGXGGGXXPG 857 GGG GG GGG G G G GG GGG G Sbjct: 115 GGGSGGGFGGGYGSGFGGLGGFGGGAGGG 143 Score = 34.3 bits (75), Expect = 0.65 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXG-GGXGGGXXPG 857 GG G GG GG GGG G GG GG G Sbjct: 573 GGSGSRGGSGGSHGGGSGFGGESGGSYGG 601 Score = 33.9 bits (74), Expect = 0.86 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 3/31 (9%) Frame = -2 Query: 940 GGGGXXGGX---GGGXGGGXGGGXGGGXXPG 857 G GG GG GG GGG GGG GGG G Sbjct: 95 GFGGASGGGYSSSGGFGGGFGGGSGGGFGGG 125 Score = 32.7 bits (71), Expect = 2.0 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -2 Query: 937 GGGXXGGXGG--GXGGGXGGGXGG 872 GGG G GG G GGG GGG GG Sbjct: 123 GGGYGSGFGGLGGFGGGAGGGDGG 146 Score = 31.5 bits (68), Expect = 4.6 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GG G G G G GG GG GGG Sbjct: 579 GGSGGSHGGGSGFGGESGGSYGGG 602 Score = 30.7 bits (66), Expect = 8.0 Identities = 17/30 (56%), Positives = 17/30 (56%), Gaps = 6/30 (20%) Frame = -2 Query: 940 GGGGXXG-GXGGGXGGG-----XGGGXGGG 869 GGGG G GGG GGG GGG GGG Sbjct: 63 GGGGSFGYSYGGGSGGGFSASSLGGGFGGG 92 >X04106-1|CAA27726.1| 268|Homo sapiens protein ( Human mRNA for calcium dependent protease (small subunit). ). Length = 268 Score = 41.5 bits (93), Expect = 0.004 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GG G GGG GGG GGG GGG G T R G Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGGGGGTAMRILGG 64 Score = 38.3 bits (85), Expect = 0.040 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGG 881 GGGG GG GGG GGG GGG Sbjct: 37 GGGGGGGGGGGGGGGGGGGG 56 Score = 37.9 bits (84), Expect = 0.053 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG 875 G GG GG GGG GGG GGG G Sbjct: 35 GAGGGGGGGGGGGGGGGGGGGG 56 Score = 37.9 bits (84), Expect = 0.053 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 G G GG GGG GGG GGG GG Sbjct: 35 GAGGGGGGGGGGGGGGGGGGGG 56 Score = 37.1 bits (82), Expect = 0.093 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GGG GGG GGG GGG G Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 34.7 bits (76), Expect = 0.49 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GG G GGG GGG GGG GGG Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGG 53 Score = 34.3 bits (75), Expect = 0.65 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GGG GGG G GG Sbjct: 10 GGGGGGGGGGGLGGGLGNVLGG 31 Score = 34.3 bits (75), Expect = 0.65 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 7/35 (20%) Frame = -2 Query: 940 GGGGXXGGXGGGXG-------GGXGGGXGGGXXPG 857 GGGG GG GGG G G GGG GGG G Sbjct: 13 GGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGG 47 Score = 34.3 bits (75), Expect = 0.65 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 7/35 (20%) Frame = -2 Query: 940 GGGGXXGGXGG-------GXGGGXGGGXGGGXXPG 857 GGGG GG G G GGG GGG GGG G Sbjct: 17 GGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGG 51 Score = 31.9 bits (69), Expect = 3.5 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 913 GGGXGGGXGGGXGGG 869 GGG GGG GGG GGG Sbjct: 10 GGGGGGGGGGGLGGG 24 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG GG Sbjct: 41 GGGGGGGGGGGGGGGGTAMRILGG 64 >S69510-1|AAC60619.1| 622|Homo sapiens cytokeratin 9 protein. Length = 622 Score = 41.5 bits (93), Expect = 0.004 Identities = 17/30 (56%), Positives = 18/30 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRT 851 GG G GG GGG GGG GGG GG G + Sbjct: 521 GGSGSGGGSGGGYGGGSGGGHSGGSGGGHS 550 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GG GGG G Sbjct: 526 GGGSGGGYGGGSGGGHSGGSGGGHSGG 552 Score = 40.3 bits (90), Expect = 0.010 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG GG GGG GGG GGG GGG G Sbjct: 102 GGYSSSGGFGGGFGGGSGGGFGGGYGSG 129 Score = 40.3 bits (90), Expect = 0.010 Identities = 34/107 (31%), Positives = 34/107 (31%), Gaps = 2/107 (1%) Frame = -2 Query: 940 GGGGXXGGXGGGXG--GGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGX 767 GGGG GG GGG G GG GG GGG G G G G Sbjct: 497 GGGGSGGGYGGGSGSRGGSGGSYGGGSGSG---GGSGGGYGGGSGGGHSGGSGGGHSGGS 553 Query: 766 GGXLGXEPPHXPRGGXEKGXXCGG*GXLRGXXGPXXGXGGRXXXXXG 626 GG G G G G G G G G GG G Sbjct: 554 GGNYGGGSGSGGGSGGGYGGGSGSRGGSGGSHGGGSGFGGESGGSYG 600 Score = 37.9 bits (84), Expect = 0.053 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GGG GGG G G GG Sbjct: 111 GGGFGGGSGGGFGGGYGSGFGG 132 Score = 36.7 bits (81), Expect = 0.12 Identities = 31/99 (31%), Positives = 32/99 (32%), Gaps = 1/99 (1%) Frame = -2 Query: 940 GGGGXXG-GXGGGXGGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXG 764 G GG G G GG GG GGG GG G + R G G G Sbjct: 479 GSGGSYGRGSRGGSGGSYGGGGSGGGYGGGSGSRGGSGGSYGGG--------SGSGGGSG 530 Query: 763 GXLGXEPPHXPRGGXEKGXXCGG*GXLRGXXGPXXGXGG 647 G G GG G G G G G G GG Sbjct: 531 GGYGGGSGGGHSGGSGGGHSGGSGGNYGGGSGSGGGSGG 569 Score = 35.9 bits (79), Expect = 0.21 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXG--GGXGGGXXPG 857 GGG GG GGG G G G GG GGG G Sbjct: 115 GGGSGGGFGGGYGSGFGGLGGFGGGAGGG 143 Score = 34.3 bits (75), Expect = 0.65 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXG-GGXGGGXXPG 857 GG G GG GG GGG G GG GG G Sbjct: 573 GGSGSRGGSGGSHGGGSGFGGESGGSYGG 601 Score = 33.9 bits (74), Expect = 0.86 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 3/31 (9%) Frame = -2 Query: 940 GGGGXXGGX---GGGXGGGXGGGXGGGXXPG 857 G GG GG GG GGG GGG GGG G Sbjct: 95 GFGGASGGGYSSSGGFGGGFGGGSGGGFGGG 125 Score = 32.7 bits (71), Expect = 2.0 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -2 Query: 937 GGGXXGGXGG--GXGGGXGGGXGG 872 GGG G GG G GGG GGG GG Sbjct: 123 GGGYGSGFGGLGGFGGGAGGGDGG 146 Score = 31.5 bits (68), Expect = 4.6 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GG G G G G GG GG GGG Sbjct: 579 GGSGGSHGGGSGFGGESGGSYGGG 602 Score = 30.7 bits (66), Expect = 8.0 Identities = 17/30 (56%), Positives = 17/30 (56%), Gaps = 6/30 (20%) Frame = -2 Query: 940 GGGGXXG-GXGGGXGGG-----XGGGXGGG 869 GGGG G GGG GGG GGG GGG Sbjct: 63 GGGGSFGYSYGGGSGGGFSASSLGGGFGGG 92 >M31511-1|AAA35646.1| 268|Homo sapiens protein ( Human calcium-activated neutral protease small subunit gene, exon 11. ). Length = 268 Score = 41.5 bits (93), Expect = 0.004 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GG G GGG GGG GGG GGG G T R G Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGGGGGTAMRILGG 64 Score = 38.3 bits (85), Expect = 0.040 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGG 881 GGGG GG GGG GGG GGG Sbjct: 37 GGGGGGGGGGGGGGGGGGGG 56 Score = 37.9 bits (84), Expect = 0.053 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG 875 G GG GG GGG GGG GGG G Sbjct: 35 GAGGGGGGGGGGGGGGGGGGGG 56 Score = 37.9 bits (84), Expect = 0.053 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 G G GG GGG GGG GGG GG Sbjct: 35 GAGGGGGGGGGGGGGGGGGGGG 56 Score = 37.1 bits (82), Expect = 0.093 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GGG GGG GGG GGG G Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 34.7 bits (76), Expect = 0.49 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GG G GGG GGG GGG GGG Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGG 53 Score = 34.3 bits (75), Expect = 0.65 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GGG GGG G GG Sbjct: 10 GGGGGGGGGGGLGGGLGNVLGG 31 Score = 34.3 bits (75), Expect = 0.65 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 7/35 (20%) Frame = -2 Query: 940 GGGGXXGGXGGGXG-------GGXGGGXGGGXXPG 857 GGGG GG GGG G G GGG GGG G Sbjct: 13 GGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGG 47 Score = 34.3 bits (75), Expect = 0.65 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 7/35 (20%) Frame = -2 Query: 940 GGGGXXGGXGG-------GXGGGXGGGXGGGXXPG 857 GGGG GG G G GGG GGG GGG G Sbjct: 17 GGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGG 51 Score = 31.9 bits (69), Expect = 3.5 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 913 GGGXGGGXGGGXGGG 869 GGG GGG GGG GGG Sbjct: 10 GGGGGGGGGGGLGGG 24 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG GG Sbjct: 41 GGGGGGGGGGGGGGGGTAMRILGG 64 >M19156-1|AAA59468.1| 433|Homo sapiens KRT10 protein. Length = 433 Score = 41.5 bits (93), Expect = 0.004 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRT 851 GGG GG GGG GG GGG GGG G T Sbjct: 330 GGGTSGGGYGGGHGGSSGGGYGGGTSGGGT 359 Score = 39.1 bits (87), Expect = 0.023 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GG GGG GGG GG G Sbjct: 335 GGGYGGGHGGSSGGGYGGGTSGGGTSG 361 Score = 35.9 bits (79), Expect = 0.21 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Frame = -2 Query: 937 GGGXXGGX--GGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GG GGG G Sbjct: 325 GGGTSGGGTSGGGYGGGHGGSSGGGYGGG 353 Score = 35.1 bits (77), Expect = 0.37 Identities = 16/26 (61%), Positives = 16/26 (61%), Gaps = 2/26 (7%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGG--XGGGXGGG 869 GGG GG GGG GG GGG GGG Sbjct: 316 GGGSFGGGYGGGTSGGGTSGGGYGGG 341 Score = 34.3 bits (75), Expect = 0.65 Identities = 16/28 (57%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGX-GGGXGGGXXPG 857 GGG G GGG GGG GGG GG G Sbjct: 339 GGGHGGSSGGGYGGGTSGGGTSGGGLRG 366 Score = 33.5 bits (73), Expect = 1.1 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -2 Query: 937 GGGXXGGXGGGX--GGGXGGGXGGGXXPG 857 GGG GG GG GGG GGG GG G Sbjct: 321 GGGYGGGTSGGGTSGGGYGGGHGGSSGGG 349 Score = 32.7 bits (71), Expect = 2.0 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G G G GGG GGG G Sbjct: 386 GGGGGLRGRHSGGGSSSGGGYGGGSSSG 413 Score = 32.3 bits (70), Expect = 2.6 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = -2 Query: 937 GGGXXGGXGGGX-GGGXGGGXGGGXXPG 857 G GG GGG GGG GGG GG G Sbjct: 308 GSSRSGGRGGGSFGGGYGGGTSGGGTSG 335 Score = 31.1 bits (67), Expect = 6.1 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGX-GGGXGGGXXPG 857 GG G GGG GGG GGG GG G Sbjct: 313 GGRGGGSFGGGYGGGTSGGGTSGGGYGG 340 >BT009775-1|AAP88777.1| 268|Homo sapiens calpain, small subunit 1 protein. Length = 268 Score = 41.5 bits (93), Expect = 0.004 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GG G GGG GGG GGG GGG G T R G Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGGGGGTAMRILGG 64 Score = 38.3 bits (85), Expect = 0.040 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGG 881 GGGG GG GGG GGG GGG Sbjct: 37 GGGGGGGGGGGGGGGGGGGG 56 Score = 37.9 bits (84), Expect = 0.053 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG 875 G GG GG GGG GGG GGG G Sbjct: 35 GAGGGGGGGGGGGGGGGGGGGG 56 Score = 37.9 bits (84), Expect = 0.053 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 G G GG GGG GGG GGG GG Sbjct: 35 GAGGGGGGGGGGGGGGGGGGGG 56 Score = 37.1 bits (82), Expect = 0.093 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GGG GGG GGG GGG G Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 34.7 bits (76), Expect = 0.49 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GG G GGG GGG GGG GGG Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGG 53 Score = 34.3 bits (75), Expect = 0.65 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GGG GGG G GG Sbjct: 10 GGGGGGGGGGGLGGGLGNVLGG 31 Score = 34.3 bits (75), Expect = 0.65 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 7/35 (20%) Frame = -2 Query: 940 GGGGXXGGXGGGXG-------GGXGGGXGGGXXPG 857 GGGG GG GGG G G GGG GGG G Sbjct: 13 GGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGG 47 Score = 34.3 bits (75), Expect = 0.65 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 7/35 (20%) Frame = -2 Query: 940 GGGGXXGGXGG-------GXGGGXGGGXGGGXXPG 857 GGGG GG G G GGG GGG GGG G Sbjct: 17 GGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGG 51 Score = 31.9 bits (69), Expect = 3.5 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 913 GGGXGGGXGGGXGGG 869 GGG GGG GGG GGG Sbjct: 10 GGGGGGGGGGGLGGG 24 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG GG Sbjct: 41 GGGGGGGGGGGGGGGGTAMRILGG 64 >BC121170-1|AAI21171.1| 467|Homo sapiens KRT9 protein protein. Length = 467 Score = 41.5 bits (93), Expect = 0.004 Identities = 17/30 (56%), Positives = 18/30 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRT 851 GG G GG GGG GGG GGG GG G + Sbjct: 366 GGSGSGGGSGGGYGGGSGGGHSGGSGGGHS 395 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GG GGG G Sbjct: 371 GGGSGGGYGGGSGGGHSGGSGGGHSGG 397 Score = 40.3 bits (90), Expect = 0.010 Identities = 34/107 (31%), Positives = 34/107 (31%), Gaps = 2/107 (1%) Frame = -2 Query: 940 GGGGXXGGXGGGXG--GGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGX 767 GGGG GG GGG G GG GG GGG G G G G Sbjct: 342 GGGGSGGGYGGGSGSRGGSGGSYGGGSGSG---GGSGGGYGGGSGGGHSGGSGGGHSGGS 398 Query: 766 GGXLGXEPPHXPRGGXEKGXXCGG*GXLRGXXGPXXGXGGRXXXXXG 626 GG G G G G G G G G GG G Sbjct: 399 GGNYGGGSGSGGGSGGGYGGGSGSRGGSGGSHGGGSGFGGESGGSYG 445 Score = 36.7 bits (81), Expect = 0.12 Identities = 31/99 (31%), Positives = 32/99 (32%), Gaps = 1/99 (1%) Frame = -2 Query: 940 GGGGXXG-GXGGGXGGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXG 764 G GG G G GG GG GGG GG G + R G G G Sbjct: 324 GSGGSYGRGSRGGSGGSYGGGGSGGGYGGGSGSRGGSGGSYGGG--------SGSGGGSG 375 Query: 763 GXLGXEPPHXPRGGXEKGXXCGG*GXLRGXXGPXXGXGG 647 G G GG G G G G G G GG Sbjct: 376 GGYGGGSGGGHSGGSGGGHSGGSGGNYGGGSGSGGGSGG 414 Score = 34.3 bits (75), Expect = 0.65 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXG-GGXGGGXXPG 857 GG G GG GG GGG G GG GG G Sbjct: 418 GGSGSRGGSGGSHGGGSGFGGESGGSYGG 446 Score = 31.5 bits (68), Expect = 4.6 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GG G G G G GG GG GGG Sbjct: 424 GGSGGSHGGGSGFGGESGGSYGGG 447 >BC023643-1|AAH23643.1| 268|Homo sapiens calpain, small subunit 1 protein. Length = 268 Score = 41.5 bits (93), Expect = 0.004 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GG G GGG GGG GGG GGG G T R G Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGGGGGTAMRILGG 64 Score = 38.3 bits (85), Expect = 0.040 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGG 881 GGGG GG GGG GGG GGG Sbjct: 37 GGGGGGGGGGGGGGGGGGGG 56 Score = 37.9 bits (84), Expect = 0.053 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG 875 G GG GG GGG GGG GGG G Sbjct: 35 GAGGGGGGGGGGGGGGGGGGGG 56 Score = 37.9 bits (84), Expect = 0.053 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 G G GG GGG GGG GGG GG Sbjct: 35 GAGGGGGGGGGGGGGGGGGGGG 56 Score = 37.1 bits (82), Expect = 0.093 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GGG GGG GGG GGG G Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 34.7 bits (76), Expect = 0.49 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GG G GGG GGG GGG GGG Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGG 53 Score = 34.3 bits (75), Expect = 0.65 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GGG GGG G GG Sbjct: 10 GGGGGGGGGGGLGGGLGNVLGG 31 Score = 34.3 bits (75), Expect = 0.65 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 7/35 (20%) Frame = -2 Query: 940 GGGGXXGGXGGGXG-------GGXGGGXGGGXXPG 857 GGGG GG GGG G G GGG GGG G Sbjct: 13 GGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGG 47 Score = 34.3 bits (75), Expect = 0.65 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 7/35 (20%) Frame = -2 Query: 940 GGGGXXGGXGG-------GXGGGXGGGXGGGXXPG 857 GGGG GG G G GGG GGG GGG G Sbjct: 17 GGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGG 51 Score = 31.9 bits (69), Expect = 3.5 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 913 GGGXGGGXGGGXGGG 869 GGG GGG GGG GGG Sbjct: 10 GGGGGGGGGGGLGGG 24 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG GG Sbjct: 41 GGGGGGGGGGGGGGGGTAMRILGG 64 >BC021933-1|AAH21933.1| 268|Homo sapiens calpain, small subunit 1 protein. Length = 268 Score = 41.5 bits (93), Expect = 0.004 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GG G GGG GGG GGG GGG G T R G Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGGGGGTAMRILGG 64 Score = 38.3 bits (85), Expect = 0.040 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGG 881 GGGG GG GGG GGG GGG Sbjct: 37 GGGGGGGGGGGGGGGGGGGG 56 Score = 37.9 bits (84), Expect = 0.053 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG 875 G GG GG GGG GGG GGG G Sbjct: 35 GAGGGGGGGGGGGGGGGGGGGG 56 Score = 37.9 bits (84), Expect = 0.053 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 G G GG GGG GGG GGG GG Sbjct: 35 GAGGGGGGGGGGGGGGGGGGGG 56 Score = 37.1 bits (82), Expect = 0.093 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GGG GGG GGG GGG G Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 34.7 bits (76), Expect = 0.49 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GG G GGG GGG GGG GGG Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGG 53 Score = 34.3 bits (75), Expect = 0.65 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GGG GGG G GG Sbjct: 10 GGGGGGGGGGGLGGGLGNVLGG 31 Score = 34.3 bits (75), Expect = 0.65 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 7/35 (20%) Frame = -2 Query: 940 GGGGXXGGXGGGXG-------GGXGGGXGGGXXPG 857 GGGG GG GGG G G GGG GGG G Sbjct: 13 GGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGG 47 Score = 34.3 bits (75), Expect = 0.65 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 7/35 (20%) Frame = -2 Query: 940 GGGGXXGGXGG-------GXGGGXGGGXGGGXXPG 857 GGGG GG G G GGG GGG GGG G Sbjct: 17 GGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGG 51 Score = 31.9 bits (69), Expect = 3.5 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 913 GGGXGGGXGGGXGGG 869 GGG GGG GGG GGG Sbjct: 10 GGGGGGGGGGGLGGG 24 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG GG Sbjct: 41 GGGGGGGGGGGGGGGGTAMRILGG 64 >BC018931-1|AAH18931.1| 268|Homo sapiens calpain, small subunit 1 protein. Length = 268 Score = 41.5 bits (93), Expect = 0.004 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GG G GGG GGG GGG GGG G T R G Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGGGGGTAMRILGG 64 Score = 38.3 bits (85), Expect = 0.040 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGG 881 GGGG GG GGG GGG GGG Sbjct: 37 GGGGGGGGGGGGGGGGGGGG 56 Score = 37.9 bits (84), Expect = 0.053 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG 875 G GG GG GGG GGG GGG G Sbjct: 35 GAGGGGGGGGGGGGGGGGGGGG 56 Score = 37.9 bits (84), Expect = 0.053 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 G G GG GGG GGG GGG GG Sbjct: 35 GAGGGGGGGGGGGGGGGGGGGG 56 Score = 37.1 bits (82), Expect = 0.093 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GGG GGG GGG GGG G Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 34.7 bits (76), Expect = 0.49 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GG G GGG GGG GGG GGG Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGG 53 Score = 34.3 bits (75), Expect = 0.65 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GGG GGG G GG Sbjct: 10 GGGGGGGGGGGLGGGLGNVLGG 31 Score = 34.3 bits (75), Expect = 0.65 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 7/35 (20%) Frame = -2 Query: 940 GGGGXXGGXGGGXG-------GGXGGGXGGGXXPG 857 GGGG GG GGG G G GGG GGG G Sbjct: 13 GGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGG 47 Score = 34.3 bits (75), Expect = 0.65 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 7/35 (20%) Frame = -2 Query: 940 GGGGXXGGXGG-------GXGGGXGGGXGGGXXPG 857 GGGG GG G G GGG GGG GGG G Sbjct: 17 GGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGG 51 Score = 31.9 bits (69), Expect = 3.5 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 913 GGGXGGGXGGGXGGG 869 GGG GGG GGG GGG Sbjct: 10 GGGGGGGGGGGLGGG 24 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG GG Sbjct: 41 GGGGGGGGGGGGGGGGTAMRILGG 64 >BC017308-1|AAH17308.1| 268|Homo sapiens calpain, small subunit 1 protein. Length = 268 Score = 41.5 bits (93), Expect = 0.004 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GG G GGG GGG GGG GGG G T R G Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGGGGGTAMRILGG 64 Score = 38.3 bits (85), Expect = 0.040 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGG 881 GGGG GG GGG GGG GGG Sbjct: 37 GGGGGGGGGGGGGGGGGGGG 56 Score = 37.9 bits (84), Expect = 0.053 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG 875 G GG GG GGG GGG GGG G Sbjct: 35 GAGGGGGGGGGGGGGGGGGGGG 56 Score = 37.9 bits (84), Expect = 0.053 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 G G GG GGG GGG GGG GG Sbjct: 35 GAGGGGGGGGGGGGGGGGGGGG 56 Score = 37.1 bits (82), Expect = 0.093 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GGG GGG GGG GGG G Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 34.7 bits (76), Expect = 0.49 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GG G GGG GGG GGG GGG Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGG 53 Score = 34.3 bits (75), Expect = 0.65 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GGG GGG G GG Sbjct: 10 GGGGGGGGGGGLGGGLGNVLGG 31 Score = 34.3 bits (75), Expect = 0.65 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 7/35 (20%) Frame = -2 Query: 940 GGGGXXGGXGGGXG-------GGXGGGXGGGXXPG 857 GGGG GG GGG G G GGG GGG G Sbjct: 13 GGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGG 47 Score = 34.3 bits (75), Expect = 0.65 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 7/35 (20%) Frame = -2 Query: 940 GGGGXXGGXGG-------GXGGGXGGGXGGGXXPG 857 GGGG GG G G GGG GGG GGG G Sbjct: 17 GGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGG 51 Score = 31.9 bits (69), Expect = 3.5 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 913 GGGXGGGXGGGXGGG 869 GGG GGG GGG GGG Sbjct: 10 GGGGGGGGGGGLGGG 24 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG GG Sbjct: 41 GGGGGGGGGGGGGGGGTAMRILGG 64 >BC011903-1|AAH11903.1| 322|Homo sapiens CAPNS1 protein protein. Length = 322 Score = 41.5 bits (93), Expect = 0.004 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GG G GGG GGG GGG GGG G T R G Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGGGGGTAMRILGG 64 Score = 38.3 bits (85), Expect = 0.040 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGG 881 GGGG GG GGG GGG GGG Sbjct: 37 GGGGGGGGGGGGGGGGGGGG 56 Score = 37.9 bits (84), Expect = 0.053 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG 875 G GG GG GGG GGG GGG G Sbjct: 35 GAGGGGGGGGGGGGGGGGGGGG 56 Score = 37.9 bits (84), Expect = 0.053 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 G G GG GGG GGG GGG GG Sbjct: 35 GAGGGGGGGGGGGGGGGGGGGG 56 Score = 37.1 bits (82), Expect = 0.093 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GGG GGG GGG GGG G Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 34.7 bits (76), Expect = 0.49 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GG G GGG GGG GGG GGG Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGG 53 Score = 34.3 bits (75), Expect = 0.65 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GGG GGG G GG Sbjct: 10 GGGGGGGGGGGLGGGLGNVLGG 31 Score = 34.3 bits (75), Expect = 0.65 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 7/35 (20%) Frame = -2 Query: 940 GGGGXXGGXGGGXG-------GGXGGGXGGGXXPG 857 GGGG GG GGG G G GGG GGG G Sbjct: 13 GGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGG 47 Score = 34.3 bits (75), Expect = 0.65 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 7/35 (20%) Frame = -2 Query: 940 GGGGXXGGXGG-------GXGGGXGGGXGGGXXPG 857 GGGG GG G G GGG GGG GGG G Sbjct: 17 GGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGG 51 Score = 31.9 bits (69), Expect = 3.5 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 913 GGGXGGGXGGGXGGG 869 GGG GGG GGG GGG Sbjct: 10 GGGGGGGGGGGLGGG 24 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG GG Sbjct: 41 GGGGGGGGGGGGGGGGTAMRILGG 64 >BC007779-1|AAH07779.1| 268|Homo sapiens calpain, small subunit 1 protein. Length = 268 Score = 41.5 bits (93), Expect = 0.004 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GG G GGG GGG GGG GGG G T R G Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGGGGGTAMRILGG 64 Score = 38.3 bits (85), Expect = 0.040 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGG 881 GGGG GG GGG GGG GGG Sbjct: 37 GGGGGGGGGGGGGGGGGGGG 56 Score = 37.9 bits (84), Expect = 0.053 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG 875 G GG GG GGG GGG GGG G Sbjct: 35 GAGGGGGGGGGGGGGGGGGGGG 56 Score = 37.9 bits (84), Expect = 0.053 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 G G GG GGG GGG GGG GG Sbjct: 35 GAGGGGGGGGGGGGGGGGGGGG 56 Score = 37.1 bits (82), Expect = 0.093 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GGG GGG GGG GGG G Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 34.7 bits (76), Expect = 0.49 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GG G GGG GGG GGG GGG Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGG 53 Score = 34.3 bits (75), Expect = 0.65 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GGG GGG G GG Sbjct: 10 GGGGGGGGGGGLGGGLGNVLGG 31 Score = 34.3 bits (75), Expect = 0.65 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 7/35 (20%) Frame = -2 Query: 940 GGGGXXGGXGGGXG-------GGXGGGXGGGXXPG 857 GGGG GG GGG G G GGG GGG G Sbjct: 13 GGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGG 47 Score = 34.3 bits (75), Expect = 0.65 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 7/35 (20%) Frame = -2 Query: 940 GGGGXXGGXGG-------GXGGGXGGGXGGGXXPG 857 GGGG GG G G GGG GGG GGG G Sbjct: 17 GGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGG 51 Score = 31.9 bits (69), Expect = 3.5 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 913 GGGXGGGXGGGXGGG 869 GGG GGG GGG GGG Sbjct: 10 GGGGGGGGGGGLGGG 24 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG GG Sbjct: 41 GGGGGGGGGGGGGGGGTAMRILGG 64 >BC000592-1|AAH00592.1| 268|Homo sapiens calpain, small subunit 1 protein. Length = 268 Score = 41.5 bits (93), Expect = 0.004 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GG G GGG GGG GGG GGG G T R G Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGGGGGTAMRILGG 64 Score = 38.3 bits (85), Expect = 0.040 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGG 881 GGGG GG GGG GGG GGG Sbjct: 37 GGGGGGGGGGGGGGGGGGGG 56 Score = 37.9 bits (84), Expect = 0.053 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG 875 G GG GG GGG GGG GGG G Sbjct: 35 GAGGGGGGGGGGGGGGGGGGGG 56 Score = 37.9 bits (84), Expect = 0.053 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 G G GG GGG GGG GGG GG Sbjct: 35 GAGGGGGGGGGGGGGGGGGGGG 56 Score = 37.1 bits (82), Expect = 0.093 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GGG GGG GGG GGG G Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 34.7 bits (76), Expect = 0.49 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GG G GGG GGG GGG GGG Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGG 53 Score = 34.3 bits (75), Expect = 0.65 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GGG GGG G GG Sbjct: 10 GGGGGGGGGGGLGGGLGNVLGG 31 Score = 34.3 bits (75), Expect = 0.65 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 7/35 (20%) Frame = -2 Query: 940 GGGGXXGGXGGGXG-------GGXGGGXGGGXXPG 857 GGGG GG GGG G G GGG GGG G Sbjct: 13 GGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGG 47 Score = 34.3 bits (75), Expect = 0.65 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 7/35 (20%) Frame = -2 Query: 940 GGGGXXGGXGG-------GXGGGXGGGXGGGXXPG 857 GGGG GG G G GGG GGG GGG G Sbjct: 17 GGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGG 51 Score = 31.9 bits (69), Expect = 3.5 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 913 GGGXGGGXGGGXGGG 869 GGG GGG GGG GGG Sbjct: 10 GGGGGGGGGGGLGGG 24 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG GG Sbjct: 41 GGGGGGGGGGGGGGGGTAMRILGG 64 >AY789642-1|AAV40829.1| 268|Homo sapiens calpain, small subunit 1 protein. Length = 268 Score = 41.5 bits (93), Expect = 0.004 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GG G GGG GGG GGG GGG G T R G Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGGGGGTAMRILGG 64 Score = 38.3 bits (85), Expect = 0.040 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGG 881 GGGG GG GGG GGG GGG Sbjct: 37 GGGGGGGGGGGGGGGGGGGG 56 Score = 37.9 bits (84), Expect = 0.053 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG 875 G GG GG GGG GGG GGG G Sbjct: 35 GAGGGGGGGGGGGGGGGGGGGG 56 Score = 37.9 bits (84), Expect = 0.053 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 G G GG GGG GGG GGG GG Sbjct: 35 GAGGGGGGGGGGGGGGGGGGGG 56 Score = 37.1 bits (82), Expect = 0.093 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GGG GGG GGG GGG G Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 34.7 bits (76), Expect = 0.49 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GG G GGG GGG GGG GGG Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGG 53 Score = 34.3 bits (75), Expect = 0.65 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GGG GGG G GG Sbjct: 10 GGGGGGGGGGGLGGGLGNVLGG 31 Score = 34.3 bits (75), Expect = 0.65 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 7/35 (20%) Frame = -2 Query: 940 GGGGXXGGXGGGXG-------GGXGGGXGGGXXPG 857 GGGG GG GGG G G GGG GGG G Sbjct: 13 GGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGG 47 Score = 34.3 bits (75), Expect = 0.65 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 7/35 (20%) Frame = -2 Query: 940 GGGGXXGGXGG-------GXGGGXGGGXGGGXXPG 857 GGGG GG G G GGG GGG GGG G Sbjct: 17 GGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGG 51 Score = 31.9 bits (69), Expect = 3.5 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 913 GGGXGGGXGGGXGGG 869 GGG GGG GGG GGG Sbjct: 10 GGGGGGGGGGGLGGG 24 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG GG Sbjct: 41 GGGGGGGGGGGGGGGGTAMRILGG 64 >AF521671-1|AAN03447.1| 2165|Homo sapiens SWI/SNF chromatin remodeling complex subunit OSA2 protein. Length = 2165 Score = 41.5 bits (93), Expect = 0.004 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GG GGG GG GGG GGG G Sbjct: 234 GAGGGGGGGGGGGGGSGGGGGGGGAGAG 261 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/30 (56%), Positives = 18/30 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRT 851 GGGG GG GGG GG GGG G G R+ Sbjct: 236 GGGGGGGGGGGGGSGGGGGGGGAGAGGSRS 265 Score = 39.1 bits (87), Expect = 0.023 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG G G GGG GG GG G Sbjct: 239 GGGGGGGGGGSGGGGGGGGAGAGGSRSG 266 Score = 35.1 bits (77), Expect = 0.37 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -2 Query: 922 GGXGGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GG GGG GGG GG GGG G R G Sbjct: 236 GGGGGGGGGGGGGSGGGGGGGGAGAGGSRSG 266 Score = 32.7 bits (71), Expect = 2.0 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GGG GGG GGG GG G Sbjct: 229 GYSRPGAGGGGGGGGGGGGGSGGGGGG 255 Score = 31.1 bits (67), Expect = 6.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 234 GAGGGGGGGGGGGGGSGGGGGGGG 257 >AF253515-1|AAN70985.1| 1957|Homo sapiens BAF250b subunit protein. Length = 1957 Score = 41.5 bits (93), Expect = 0.004 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GG GGG GG GGG GGG G Sbjct: 26 GAGGGGGGGGGGGGGSGGGGGGGGAGAG 53 Score = 41.5 bits (93), Expect = 0.004 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG G G Sbjct: 29 GGGGGGGGGGGGSGGGGGGGGAGAGGAG 56 Score = 39.1 bits (87), Expect = 0.023 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG G G GGG GG GG G Sbjct: 31 GGGGGGGGGGSGGGGGGGGAGAGGAGAG 58 Score = 38.7 bits (86), Expect = 0.030 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG G G GGG GG G Sbjct: 28 GGGGGGGGGGGGGSGGGGGGGGAGAGG 54 Score = 32.7 bits (71), Expect = 2.0 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GGG GGG GGG GG G Sbjct: 21 GYSRPGAGGGGGGGGGGGGGSGGGGGG 47 Score = 31.1 bits (67), Expect = 6.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 26 GAGGGGGGGGGGGGGSGGGGGGGG 49 >AD001527-4|AAB51183.1| 268|Homo sapiens calcium-dependent protease, small (regulatory) subunit (calpain) (calcium-activ protein. Length = 268 Score = 41.5 bits (93), Expect = 0.004 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GG G GGG GGG GGG GGG G T R G Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGGGGGTAMRILGG 64 Score = 38.3 bits (85), Expect = 0.040 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGG 881 GGGG GG GGG GGG GGG Sbjct: 37 GGGGGGGGGGGGGGGGGGGG 56 Score = 37.9 bits (84), Expect = 0.053 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG 875 G GG GG GGG GGG GGG G Sbjct: 35 GAGGGGGGGGGGGGGGGGGGGG 56 Score = 37.9 bits (84), Expect = 0.053 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 G G GG GGG GGG GGG GG Sbjct: 35 GAGGGGGGGGGGGGGGGGGGGG 56 Score = 37.1 bits (82), Expect = 0.093 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GGG GGG GGG GGG G Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 34.7 bits (76), Expect = 0.49 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GG G GGG GGG GGG GGG Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGG 53 Score = 34.3 bits (75), Expect = 0.65 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GGG GGG G GG Sbjct: 10 GGGGGGGGGGGLGGGLGNVLGG 31 Score = 34.3 bits (75), Expect = 0.65 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 7/35 (20%) Frame = -2 Query: 940 GGGGXXGGXGGGXG-------GGXGGGXGGGXXPG 857 GGGG GG GGG G G GGG GGG G Sbjct: 13 GGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGG 47 Score = 34.3 bits (75), Expect = 0.65 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 7/35 (20%) Frame = -2 Query: 940 GGGGXXGGXGG-------GXGGGXGGGXGGGXXPG 857 GGGG GG G G GGG GGG GGG G Sbjct: 17 GGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGG 51 Score = 31.9 bits (69), Expect = 3.5 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 913 GGGXGGGXGGGXGGG 869 GGG GGG GGG GGG Sbjct: 10 GGGGGGGGGGGLGGG 24 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG GG Sbjct: 41 GGGGGGGGGGGGGGGGTAMRILGG 64 >AC002984-1|AAB81546.1| 268|Homo sapiens CANS_Human protein. Length = 268 Score = 41.5 bits (93), Expect = 0.004 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GG G GGG GGG GGG GGG G T R G Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGGGGGTAMRILGG 64 Score = 38.3 bits (85), Expect = 0.040 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGG 881 GGGG GG GGG GGG GGG Sbjct: 37 GGGGGGGGGGGGGGGGGGGG 56 Score = 37.9 bits (84), Expect = 0.053 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG 875 G GG GG GGG GGG GGG G Sbjct: 35 GAGGGGGGGGGGGGGGGGGGGG 56 Score = 37.9 bits (84), Expect = 0.053 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 G G GG GGG GGG GGG GG Sbjct: 35 GAGGGGGGGGGGGGGGGGGGGG 56 Score = 37.1 bits (82), Expect = 0.093 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GGG GGG GGG GGG G Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 34.7 bits (76), Expect = 0.49 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GG G GGG GGG GGG GGG Sbjct: 30 GGLISGAGGGGGGGGGGGGGGGGG 53 Score = 34.3 bits (75), Expect = 0.65 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GGG GGG G GG Sbjct: 10 GGGGGGGGGGGLGGGLGNVLGG 31 Score = 34.3 bits (75), Expect = 0.65 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 7/35 (20%) Frame = -2 Query: 940 GGGGXXGGXGGGXG-------GGXGGGXGGGXXPG 857 GGGG GG GGG G G GGG GGG G Sbjct: 13 GGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGG 47 Score = 34.3 bits (75), Expect = 0.65 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 7/35 (20%) Frame = -2 Query: 940 GGGGXXGGXGG-------GXGGGXGGGXGGGXXPG 857 GGGG GG G G GGG GGG GGG G Sbjct: 17 GGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGG 51 Score = 31.9 bits (69), Expect = 3.5 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 913 GGGXGGGXGGGXGGG 869 GGG GGG GGG GGG Sbjct: 10 GGGGGGGGGGGLGGG 24 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG GG Sbjct: 41 GGGGGGGGGGGGGGGGTAMRILGG 64 >AB002337-1|BAA20797.2| 1709|Homo sapiens KIAA0339 protein protein. Length = 1709 Score = 41.5 bits (93), Expect = 0.004 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPP 938 G PPP P P P PPP PP PPP Sbjct: 593 GGSPPPAPTPPQQPPPPPPPPPPPPP 618 Score = 40.3 bits (90), Expect = 0.010 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPPP 941 P P P PP PPP PP PPPP Sbjct: 596 PPPAPTPPQQPPPPPPPPPPPP 617 Score = 37.9 bits (84), Expect = 0.053 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXP 920 P PP PPP PPP PPP P Sbjct: 598 PAPTPPQQPPPPPPPPPPPPP 618 Score = 35.5 bits (78), Expect = 0.28 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 2/50 (4%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXP--SPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 PP PP P PP P P P P PP P P PPPH Sbjct: 609 PPPPPPPPPPYLASLPLGYPPHQPAYLLPPRPDGPPPPEYP-PPPPPPPH 657 Score = 33.1 bits (72), Expect = 1.5 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 5/34 (14%) Frame = +3 Query: 855 LPGXXPPPXP----PPXPP-PXPPPXPPXXPPPP 941 LP PP P PP P P PP PP PPPP Sbjct: 623 LPLGYPPHQPAYLLPPRPDGPPPPEYPPPPPPPP 656 Score = 32.3 bits (70), Expect = 2.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPP 935 PPP PPP PPP P PP Sbjct: 608 PPPPPPPPPPPYLASLPLGYPP 629 Score = 31.5 bits (68), Expect = 4.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP PPP PPP P PP Sbjct: 603 PQQPPPPPPPPPPPPPYLASLPLGYPP 629 Score = 31.1 bits (67), Expect = 6.1 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPP 914 P + +LP P PP PPP PPP Sbjct: 628 PPHQPAYLLPPRPDGPPPPEYPPPPPPP 655 Score = 30.7 bits (66), Expect = 8.0 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P+PP PP P P L P P P P PPP Sbjct: 600 PTPPQQPPPPPPPPPPPPPYLASLPLGYPPHQPAYLLPPRPDGPPP 645 Score = 26.2 bits (55), Expect(2) = 4.2 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 837 RSLSXVLPGXXPPPXPPPXPP 899 RSL PPP PPP PP Sbjct: 1394 RSLRSHARRRRPPPPPPPPPP 1414 Score = 23.8 bits (49), Expect(2) = 4.2 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +3 Query: 882 PPPXPPPXPPPXPP 923 PPP PPP P P Sbjct: 1406 PPPPPPPPPRAYEP 1419 >Z46389-1|CAA86523.1| 380|Homo sapiens vasodilator-stimulated phosphoprotein (VASP) protein. Length = 380 Score = 41.1 bits (92), Expect = 0.006 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P PPP P P PPP PPP PP PP Sbjct: 166 PAGGPPPPPGPPPPPGPPP-PPGLPP 190 Score = 39.5 bits (88), Expect = 0.017 Identities = 17/26 (65%), Positives = 17/26 (65%), Gaps = 3/26 (11%) Frame = +3 Query: 873 PPXPP---PXPPPXPPPXPPXXPPPP 941 PP PP P PPP PPP PP PPPP Sbjct: 162 PPAPPAGGPPPPPGPPP-PPGPPPPP 186 Score = 38.7 bits (86), Expect = 0.030 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PP P PPP P P PP PPPP Sbjct: 162 PPAPPAGGPPPPPGPPPPPGPPPP 185 Score = 35.9 bits (79), Expect = 0.21 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P PPP P P PPP PP PPP Sbjct: 162 PPAPPAGGPPPPPGPPPPPGPP--PPP 186 Score = 33.1 bits (72), Expect = 1.5 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P P P PPP PPP PP PP P Sbjct: 170 PPPPPGPPPPPGPPP-PPGLPPSGVP 194 >X98534-1|CAA67147.2| 378|Homo sapiens vasodilator-stimulated phosphoprotein protein. Length = 378 Score = 41.1 bits (92), Expect = 0.006 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P PPP P P PPP PPP PP PP Sbjct: 164 PAGGPPPPPGPPPPPGPPP-PPGLPP 188 Score = 39.5 bits (88), Expect = 0.017 Identities = 17/26 (65%), Positives = 17/26 (65%), Gaps = 3/26 (11%) Frame = +3 Query: 873 PPXPP---PXPPPXPPPXPPXXPPPP 941 PP PP P PPP PPP PP PPPP Sbjct: 160 PPAPPAGGPPPPPGPPP-PPGPPPPP 184 Score = 38.7 bits (86), Expect = 0.030 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PP P PPP P P PP PPPP Sbjct: 160 PPAPPAGGPPPPPGPPPPPGPPPP 183 Score = 35.9 bits (79), Expect = 0.21 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P PPP P P PPP PP PPP Sbjct: 160 PPAPPAGGPPPPPGPPPPPGPP--PPP 184 Score = 33.1 bits (72), Expect = 1.5 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P P P PPP PPP PP PP P Sbjct: 168 PPPPPGPPPPPGPPP-PPGLPPSGVP 192 >X67337-1|CAA47752.1| 551|Homo sapiens Human pre-mRNA cleavage factor I 68 kDa subunit protein. Length = 551 Score = 41.1 bits (92), Expect = 0.006 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LP PPP P PPP PPP PPPP Sbjct: 292 LPPGPPPPVPGYGPPPGPPPPQQGPPPPP 320 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/31 (54%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +3 Query: 855 LPGXXPPPXPPP---XPPPXPPPXPPXXPPP 938 +PG PPP PPP PPP P P PP P P Sbjct: 300 VPGYGPPPGPPPPQQGPPPPPGPFPPRPPGP 330 Score = 39.9 bits (89), Expect = 0.013 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 2/50 (4%) Frame = +1 Query: 796 PPSPPXPXPPXXXXX--PSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 PP PP P P P P P P P PP P P PPPH Sbjct: 293 PPGPPPPVPGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPH 342 Score = 39.1 bits (87), Expect = 0.023 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PPP P PP PP PP P PP Sbjct: 223 PGGPPPPFPAGQTPPRPPLGPPGPPGPP 250 Score = 38.3 bits (85), Expect = 0.040 Identities = 25/72 (34%), Positives = 25/72 (34%), Gaps = 2/72 (2%) Frame = +3 Query: 732 GXWGGSXPXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPP--PXPPPXPPPX 905 G G P PP P Q P L P PP P PP PPP Sbjct: 242 GPPGPPGPPGPPPPGQVLPPPLAGPPNRGDRPPPP-VLFPGQPFGQPPLGPLPPGPPPPV 300 Query: 906 PPPXPPXXPPPP 941 P PP PPPP Sbjct: 301 PGYGPPPGPPPP 312 Score = 36.7 bits (81), Expect = 0.12 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 3/30 (10%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPP---XXPPPP 941 G PP PPP P PPP PP PPPP Sbjct: 290 GPLPPGPPPPVPGYGPPPGPPPPQQGPPPP 319 Score = 32.3 bits (70), Expect = 2.6 Identities = 19/65 (29%), Positives = 20/65 (30%) Frame = +3 Query: 744 GSXPXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPPXPP 923 G P PP P + P PG PP PP P P PP Sbjct: 290 GPLPPGPPPPVPGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGP-PP 348 Query: 924 XXPPP 938 PPP Sbjct: 349 GAPPP 353 Score = 31.9 bits (69), Expect = 3.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PP P P PP PP P PP Sbjct: 320 PGPFPPRPPGPLGPPLTLAPPPHLPGPP 347 Score = 31.5 bits (68), Expect = 4.6 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPP-PXPPPXPPPXPPPXPPXXPPPP 941 PG P PPP P PP PP PP P Sbjct: 218 PGPAGPGGPPPPFPAGQTPPRPPLGPPGP 246 Score = 31.1 bits (67), Expect = 6.1 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = +3 Query: 873 PPXPPPXP--PPXPPPXPPXXPPP 938 PP PP P PP PPP PPP Sbjct: 239 PPLGPPGPPGPPGPPPPGQVLPPP 262 Score = 30.7 bits (66), Expect = 8.0 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP P P PP P P P P PP PPP Sbjct: 319 PPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGAPPPAPHVNPAFFPPP 365 >X67336-1|CAA47751.1| 551|Homo sapiens HPBRII-7 protein. Length = 551 Score = 41.1 bits (92), Expect = 0.006 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LP PPP P PPP PPP PPPP Sbjct: 292 LPPGPPPPVPGYGPPPGPPPPQQGPPPPP 320 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/31 (54%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +3 Query: 855 LPGXXPPPXPPP---XPPPXPPPXPPXXPPP 938 +PG PPP PPP PPP P P PP P P Sbjct: 300 VPGYGPPPGPPPPQQGPPPPPGPFPPRPPGP 330 Score = 39.9 bits (89), Expect = 0.013 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 2/50 (4%) Frame = +1 Query: 796 PPSPPXPXPPXXXXX--PSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 PP PP P P P P P P P PP P P PPPH Sbjct: 293 PPGPPPPVPGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPH 342 Score = 39.1 bits (87), Expect = 0.023 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PPP P PP PP PP P PP Sbjct: 223 PGGPPPPFPAGQTPPRPPLGPPGPPGPP 250 Score = 38.3 bits (85), Expect = 0.040 Identities = 25/72 (34%), Positives = 25/72 (34%), Gaps = 2/72 (2%) Frame = +3 Query: 732 GXWGGSXPXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPP--PXPPPXPPPX 905 G G P PP P Q P L P PP P PP PPP Sbjct: 242 GPPGPPGPPGPPPPGQVLPPPLAGPPNRGDRPPPP-VLFPGQPFGQPPLGPLPPGPPPPV 300 Query: 906 PPPXPPXXPPPP 941 P PP PPPP Sbjct: 301 PGYGPPPGPPPP 312 Score = 36.7 bits (81), Expect = 0.12 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 3/30 (10%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPP---XXPPPP 941 G PP PPP P PPP PP PPPP Sbjct: 290 GPLPPGPPPPVPGYGPPPGPPPPQQGPPPP 319 Score = 32.3 bits (70), Expect = 2.6 Identities = 19/65 (29%), Positives = 20/65 (30%) Frame = +3 Query: 744 GSXPXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPPXPP 923 G P PP P + P PG PP PP P P PP Sbjct: 290 GPLPPGPPPPVPGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGP-PP 348 Query: 924 XXPPP 938 PPP Sbjct: 349 GAPPP 353 Score = 31.9 bits (69), Expect = 3.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PP P P PP PP P PP Sbjct: 320 PGPFPPRPPGPLGPPLTLAPPPHLPGPP 347 Score = 31.5 bits (68), Expect = 4.6 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPP-PXPPPXPPPXPPPXPPXXPPPP 941 PG P PPP P PP PP PP P Sbjct: 218 PGPAGPGGPPPPFPAGQTPPRPPLGPPGP 246 Score = 31.1 bits (67), Expect = 6.1 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = +3 Query: 873 PPXPPPXP--PPXPPPXPPXXPPP 938 PP PP P PP PPP PPP Sbjct: 239 PPLGPPGPPGPPGPPPPGQVLPPP 262 Score = 30.7 bits (66), Expect = 8.0 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP P P PP P P P P PP PPP Sbjct: 319 PPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGAPPPAPHVNPAFFPPP 365 >X14487-1|CAA32649.1| 593|Homo sapiens protein ( Human gene for acidic (type I) cytokeratin 10. ). Length = 593 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GG GGG GGG G Sbjct: 479 GGGSSGGGYGGGHGGSSGGGYGGGSSGG 506 Score = 39.1 bits (87), Expect = 0.023 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GG GGG GGG GG G Sbjct: 484 GGGYGGGHGGSSGGGYGGGSSGGGSSG 510 Score = 38.7 bits (86), Expect = 0.030 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG GG GGG GG GGG GGG G Sbjct: 532 GGSSSGGYGGGSSGGGGGGYGGGSSGG 558 Score = 36.7 bits (81), Expect = 0.12 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -2 Query: 940 GGGGXXGGX-GGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GG GGG G Sbjct: 474 GGGSSGGGSSGGGYGGGHGGSSGGGYGGG 502 Score = 36.7 bits (81), Expect = 0.12 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG G G GGG GGG G Sbjct: 546 GGGGGYGGGSSGGGSSSGGGYGGGSSSG 573 Score = 36.3 bits (80), Expect = 0.16 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GG GG GGG GG G Sbjct: 523 GGGSSSGGHGGSSSGGYGGGSSGGGGGG 550 Score = 35.1 bits (77), Expect = 0.37 Identities = 16/25 (64%), Positives = 16/25 (64%), Gaps = 2/25 (8%) Frame = -2 Query: 940 GGGGXXGGX--GGGXGGGXGGGXGG 872 GGG GG GGG GGG GGG GG Sbjct: 113 GGGSFGGGGFGGGGFGGGFGGGFGG 137 Score = 35.1 bits (77), Expect = 0.37 Identities = 16/26 (61%), Positives = 16/26 (61%), Gaps = 2/26 (7%) Frame = -2 Query: 940 GGGGXXGGXGGG--XGGGXGGGXGGG 869 GGG GG GGG GG GGG GGG Sbjct: 465 GGGSFGGGYGGGSSGGGSSGGGYGGG 490 Score = 34.7 bits (76), Expect = 0.49 Identities = 18/30 (60%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXGGX-GGGXGGG-XGGGXGGGXXPG 857 GGGG GG GGG GGG GGG GG G Sbjct: 460 GGGGRGGGSFGGGYGGGSSGGGSSGGGYGG 489 Score = 34.3 bits (75), Expect = 0.65 Identities = 16/28 (57%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGX-GGGXGGGXXPG 857 GGG G GGG GGG GGG GG G Sbjct: 488 GGGHGGSSGGGYGGGSSGGGSSGGGYGG 515 Score = 33.9 bits (74), Expect = 0.86 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG G GG GGG GGG G Sbjct: 108 GGGSFGGGSFGGGGFGGGGFGGGFGGG 134 Score = 33.9 bits (74), Expect = 0.86 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG 875 GGG GG GGG GGG GG G Sbjct: 119 GGGFGGGGFGGGFGGGFGGDGG 140 Score = 33.9 bits (74), Expect = 0.86 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGX--GGGXGGGXXPG 857 GG GG GGG GG GGG GGG G Sbjct: 492 GGSSGGGYGGGSSGGGSSGGGYGGGSSSG 520 Score = 33.5 bits (73), Expect = 1.1 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G GG GGG GGG GG G Sbjct: 457 GSSGGGGRGGGSFGGGYGGGSSGGGSSG 484 Score = 33.5 bits (73), Expect = 1.1 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -2 Query: 937 GGGXXGGXGGGX--GGGXGGGXGGGXXPG 857 GGG GG GG GGG GGG GG G Sbjct: 470 GGGYGGGSSGGGSSGGGYGGGHGGSSGGG 498 Score = 33.5 bits (73), Expect = 1.1 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGX--GGGXGGGXXPG 857 GGG GG GGG GGG GG GG G Sbjct: 540 GGGSSGGGGGGYGGGSSGGGSSSGGGYGG 568 Score = 33.1 bits (72), Expect = 1.5 Identities = 17/27 (62%), Positives = 17/27 (62%), Gaps = 3/27 (11%) Frame = -2 Query: 940 GGGGXXGGX--GGGXGG-GXGGGXGGG 869 GGG GG GGG GG G GGG GGG Sbjct: 108 GGGSFGGGSFGGGGFGGGGFGGGFGGG 134 Score = 32.7 bits (71), Expect = 2.0 Identities = 17/30 (56%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXGGX-GGGXGGG-XGGGXGGGXXPG 857 GGG GG GGG GGG GG GGG G Sbjct: 500 GGGSSGGGSSGGGYGGGSSSGGHGGGSSSG 529 Score = 32.3 bits (70), Expect = 2.6 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GG GG GGG G G Sbjct: 540 GGGSSGGGGGGYGGGSSGGGSSSGGGYG 567 Score = 31.9 bits (69), Expect = 3.5 Identities = 28/97 (28%), Positives = 29/97 (29%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXGGX 758 G G GG G G GG GGG GGG G + G G GG Sbjct: 455 GEGSSGGGGRG-GGSFGGGYGGGSSGGGSSGGGYGGGHGGSSGGGYGGGSSGGGSSGGGY 513 Query: 757 LGXEPPHXPRGGXEKGXXCGG*GXLRGXXGPXXGXGG 647 G GG G G G G GG Sbjct: 514 GGGSSSGGHGGGSSSGGHGGSSSGGYGGGSSGGGGGG 550 Score = 31.9 bits (69), Expect = 3.5 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = -2 Query: 940 GGGGXXGGXGGG-XGGGXGGGXGGGXXPG 857 GGG GG GGG GG GGG G G Sbjct: 505 GGGSSGGGYGGGSSSGGHGGGSSSGGHGG 533 Score = 31.9 bits (69), Expect = 3.5 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = -2 Query: 940 GGGGXXGGXGGG-XGGGXGGGXGGGXXPG 857 GGG GG GGG GG GG GG G Sbjct: 514 GGGSSSGGHGGGSSSGGHGGSSSGGYGGG 542 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GGG GG GG GGG G Sbjct: 537 GGYGGGSSGGGGGGYGGGSSGGGSSSG 563 Score = 31.5 bits (68), Expect = 4.6 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG G G GGG GGG G Sbjct: 103 GGGNFGGGSFGGGSFGGGGFGGGGFGG 129 Score = 30.7 bits (66), Expect = 8.0 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG G GGG GG GG GG G Sbjct: 470 GGGYGGGSSGGGSSGGGYGGGHGGSSGG 497 >BC109221-1|AAI09222.1| 1019|Homo sapiens SLC4A5 protein protein. Length = 1019 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GGG G G G Sbjct: 378 GGGAPGGGNGGGGGGGSGGGAGSGGAGG 405 Score = 39.5 bits (88), Expect = 0.017 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GGG GGG GGG GGG G Sbjct: 376 GGGG--GAPGGGNGGGGGGGSGGGAGSG 401 Score = 39.5 bits (88), Expect = 0.017 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRTXE 845 GGG GG GGG GGG G G GG G E Sbjct: 383 GGGNGGGGGGGSGGGAGSGGAGGTSSGDDGE 413 Score = 37.9 bits (84), Expect = 0.053 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRT 851 GGGG GG GG GGG GG G G T Sbjct: 377 GGGGAPGGGNGGGGGGGSGGGAGSGGAGGT 406 Score = 36.3 bits (80), Expect = 0.16 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GG GGG GGG GGG G Sbjct: 373 GSVGGGGGAPGGGNGGGGGGGSGGG 397 >BC038224-1|AAH38224.1| 380|Homo sapiens vasodilator-stimulated phosphoprotein protein. Length = 380 Score = 41.1 bits (92), Expect = 0.006 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P PPP P P PPP PPP PP PP Sbjct: 166 PAGGPPPPPGPPPPPGPPP-PPGLPP 190 Score = 39.5 bits (88), Expect = 0.017 Identities = 17/26 (65%), Positives = 17/26 (65%), Gaps = 3/26 (11%) Frame = +3 Query: 873 PPXPP---PXPPPXPPPXPPXXPPPP 941 PP PP P PPP PPP PP PPPP Sbjct: 162 PPAPPAGGPPPPPGPPP-PPGPPPPP 186 Score = 38.7 bits (86), Expect = 0.030 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PP P PPP P P PP PPPP Sbjct: 162 PPAPPAGGPPPPPGPPPPPGPPPP 185 Score = 35.9 bits (79), Expect = 0.21 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P PPP P P PPP PP PPP Sbjct: 162 PPAPPAGGPPPPPGPPPPPGPP--PPP 186 Score = 33.1 bits (72), Expect = 1.5 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P P P PPP PPP PP PP P Sbjct: 170 PPPPPGPPPPPGPPP-PPGLPPSGVP 194 >BC034697-1|AAH34697.1| 584|Homo sapiens keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) protein. Length = 584 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GG GGG GGG G Sbjct: 479 GGGSSGGGYGGGHGGSSGGGYGGGSSGG 506 Score = 39.1 bits (87), Expect = 0.023 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GG GGG GGG GG G Sbjct: 484 GGGYGGGHGGSSGGGYGGGSSGGGSSG 510 Score = 38.7 bits (86), Expect = 0.030 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG GG GGG GG GGG GGG G Sbjct: 523 GGSSSGGYGGGSSGGGGGGYGGGSSGG 549 Score = 36.7 bits (81), Expect = 0.12 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -2 Query: 940 GGGGXXGGX-GGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GG GGG G Sbjct: 474 GGGSSGGGSSGGGYGGGHGGSSGGGYGGG 502 Score = 36.7 bits (81), Expect = 0.12 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG G G GGG GGG G Sbjct: 537 GGGGGYGGGSSGGGSSSGGGYGGGSSSG 564 Score = 36.3 bits (80), Expect = 0.16 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GG GG GGG GG G Sbjct: 514 GGGSSSGGHGGSSSGGYGGGSSGGGGGG 541 Score = 35.1 bits (77), Expect = 0.37 Identities = 16/25 (64%), Positives = 16/25 (64%), Gaps = 2/25 (8%) Frame = -2 Query: 940 GGGGXXGGX--GGGXGGGXGGGXGG 872 GGG GG GGG GGG GGG GG Sbjct: 113 GGGSFGGGGFGGGGFGGGFGGGFGG 137 Score = 35.1 bits (77), Expect = 0.37 Identities = 16/26 (61%), Positives = 16/26 (61%), Gaps = 2/26 (7%) Frame = -2 Query: 940 GGGGXXGGXGGG--XGGGXGGGXGGG 869 GGG GG GGG GG GGG GGG Sbjct: 465 GGGSFGGGYGGGSSGGGSSGGGYGGG 490 Score = 34.7 bits (76), Expect = 0.49 Identities = 18/30 (60%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXGGX-GGGXGGG-XGGGXGGGXXPG 857 GGGG GG GGG GGG GGG GG G Sbjct: 460 GGGGRGGGSFGGGYGGGSSGGGSSGGGYGG 489 Score = 34.3 bits (75), Expect = 0.65 Identities = 16/28 (57%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGX-GGGXGGGXXPG 857 GGG G GGG GGG GGG GG G Sbjct: 488 GGGHGGSSGGGYGGGSSGGGSSGGGYGG 515 Score = 33.9 bits (74), Expect = 0.86 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG G GG GGG GGG G Sbjct: 108 GGGSFGGGSFGGGGFGGGGFGGGFGGG 134 Score = 33.9 bits (74), Expect = 0.86 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG 875 GGG GG GGG GGG GG G Sbjct: 119 GGGFGGGGFGGGFGGGFGGDGG 140 Score = 33.9 bits (74), Expect = 0.86 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGX--GGGXGGGXXPG 857 GG GG GGG GG GGG GGG G Sbjct: 492 GGSSGGGYGGGSSGGGSSGGGYGGGSSSG 520 Score = 33.5 bits (73), Expect = 1.1 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G GG GGG GGG GG G Sbjct: 457 GSSGGGGRGGGSFGGGYGGGSSGGGSSG 484 Score = 33.5 bits (73), Expect = 1.1 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -2 Query: 937 GGGXXGGXGGGX--GGGXGGGXGGGXXPG 857 GGG GG GG GGG GGG GG G Sbjct: 470 GGGYGGGSSGGGSSGGGYGGGHGGSSGGG 498 Score = 33.5 bits (73), Expect = 1.1 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGX--GGGXGGGXXPG 857 GGG GG GGG GGG GG GG G Sbjct: 531 GGGSSGGGGGGYGGGSSGGGSSSGGGYGG 559 Score = 33.1 bits (72), Expect = 1.5 Identities = 17/27 (62%), Positives = 17/27 (62%), Gaps = 3/27 (11%) Frame = -2 Query: 940 GGGGXXGGX--GGGXGG-GXGGGXGGG 869 GGG GG GGG GG G GGG GGG Sbjct: 108 GGGSFGGGSFGGGGFGGGGFGGGFGGG 134 Score = 32.7 bits (71), Expect = 2.0 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG G GG GG GG GGG G Sbjct: 510 GGGYGGGSSSGGHGGSSSGGYGGGSSGG 537 Score = 32.3 bits (70), Expect = 2.6 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GG GG GGG G G Sbjct: 531 GGGSSGGGGGGYGGGSSGGGSSSGGGYG 558 Score = 31.9 bits (69), Expect = 3.5 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = -2 Query: 940 GGGGXXGGXGGG-XGGGXGGGXGGGXXPG 857 GGG GG GGG GG GG GG G Sbjct: 505 GGGSSGGGYGGGSSSGGHGGSSSGGYGGG 533 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GGG GG GG GGG G Sbjct: 528 GGYGGGSSGGGGGGYGGGSSGGGSSSG 554 Score = 31.5 bits (68), Expect = 4.6 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG G G GGG GGG G Sbjct: 103 GGGSFGGGSFGGGSFGGGGFGGGGFGG 129 Score = 31.5 bits (68), Expect = 4.6 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = -2 Query: 940 GGGGXXGGX-GGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG G GG G Sbjct: 500 GGGSSGGGSSGGGYGGGSSSGGHGGSSSG 528 Score = 31.1 bits (67), Expect = 6.1 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = -2 Query: 937 GGGXXGGXGGGX--GGGXGGGXGGGXXPG 857 GGG GG GG GGG GGG G G Sbjct: 496 GGGYGGGSSGGGSSGGGYGGGSSSGGHGG 524 Score = 30.7 bits (66), Expect = 8.0 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG G G GG GGG GGG G Sbjct: 455 GEGSSGGGGRG-GGSFGGGYGGGSSGG 480 Score = 30.7 bits (66), Expect = 8.0 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG G GGG GG GG GG G Sbjct: 470 GGGYGGGSSGGGSSGGGYGGGHGGSSGG 497 >BC026019-1|AAH26019.1| 380|Homo sapiens vasodilator-stimulated phosphoprotein protein. Length = 380 Score = 41.1 bits (92), Expect = 0.006 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P PPP P P PPP PPP PP PP Sbjct: 167 PAGGPPPPPGPPPPPGPPP-PPGLPP 191 Score = 39.5 bits (88), Expect = 0.017 Identities = 17/26 (65%), Positives = 17/26 (65%), Gaps = 3/26 (11%) Frame = +3 Query: 873 PPXPP---PXPPPXPPPXPPXXPPPP 941 PP PP P PPP PPP PP PPPP Sbjct: 163 PPAPPAGGPPPPPGPPP-PPGPPPPP 187 Score = 38.7 bits (86), Expect = 0.030 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PP P PPP P P PP PPPP Sbjct: 163 PPAPPAGGPPPPPGPPPPPGPPPP 186 Score = 35.9 bits (79), Expect = 0.21 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P PPP P P PPP PP PPP Sbjct: 163 PPAPPAGGPPPPPGPPPPPGPP--PPP 187 Score = 33.1 bits (72), Expect = 1.5 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P P P PPP PPP PP PP P Sbjct: 171 PPPPPGPPPPPGPPP-PPGLPPSGVP 195 >BC005000-1|AAH05000.1| 478|Homo sapiens CPSF6 protein protein. Length = 478 Score = 41.1 bits (92), Expect = 0.006 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LP PPP P PPP PPP PPPP Sbjct: 219 LPPGPPPPVPGYGPPPGPPPPQQGPPPPP 247 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/31 (54%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +3 Query: 855 LPGXXPPPXPPP---XPPPXPPPXPPXXPPP 938 +PG PPP PPP PPP P P PP P P Sbjct: 227 VPGYGPPPGPPPPQQGPPPPPGPFPPRPPGP 257 Score = 39.9 bits (89), Expect = 0.013 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 2/50 (4%) Frame = +1 Query: 796 PPSPPXPXPPXXXXX--PSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 PP PP P P P P P P P PP P P PPPH Sbjct: 220 PPGPPPPVPGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPH 269 Score = 36.7 bits (81), Expect = 0.12 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPP--PXPPPXPPPXPPPXPPXXPPPP 941 P PP P PP PPP P PP PPPP Sbjct: 210 PFGQPPLGPLPPGPPPPVPGYGPPPGPPPP 239 Score = 36.7 bits (81), Expect = 0.12 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 3/30 (10%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPP---XXPPPP 941 G PP PPP P PPP PP PPPP Sbjct: 217 GPLPPGPPPPVPGYGPPPGPPPPQQGPPPP 246 Score = 32.3 bits (70), Expect = 2.6 Identities = 19/65 (29%), Positives = 20/65 (30%) Frame = +3 Query: 744 GSXPXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPPXPP 923 G P PP P + P PG PP PP P P PP Sbjct: 217 GPLPPGPPPPVPGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGP-PP 275 Query: 924 XXPPP 938 PPP Sbjct: 276 GAPPP 280 Score = 31.9 bits (69), Expect = 3.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PP P P PP PP P PP Sbjct: 247 PGPFPPRPPGPLGPPLTLAPPPHLPGPP 274 Score = 30.7 bits (66), Expect = 8.0 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP P P PP P P P P PP PPP Sbjct: 246 PPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGAPPPAPHVNPAFFPPP 292 >BC000714-1|AAH00714.1| 588|Homo sapiens CPSF6 protein protein. Length = 588 Score = 41.1 bits (92), Expect = 0.006 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LP PPP P PPP PPP PPPP Sbjct: 329 LPPGPPPPVPGYGPPPGPPPPQQGPPPPP 357 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/31 (54%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +3 Query: 855 LPGXXPPPXPPP---XPPPXPPPXPPXXPPP 938 +PG PPP PPP PPP P P PP P P Sbjct: 337 VPGYGPPPGPPPPQQGPPPPPGPFPPRPPGP 367 Score = 39.9 bits (89), Expect = 0.013 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 2/50 (4%) Frame = +1 Query: 796 PPSPPXPXPPXXXXX--PSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 PP PP P P P P P P P PP P P PPPH Sbjct: 330 PPGPPPPVPGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPH 379 Score = 38.3 bits (85), Expect = 0.040 Identities = 25/72 (34%), Positives = 25/72 (34%), Gaps = 2/72 (2%) Frame = +3 Query: 732 GXWGGSXPXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPP--PXPPPXPPPX 905 G G P PP P Q P L P PP P PP PPP Sbjct: 279 GPPGPPGPPGPPPPGQVLPPPLAGPPNRGDRPPPP-VLFPGQPFGQPPLGPLPPGPPPPV 337 Query: 906 PPPXPPXXPPPP 941 P PP PPPP Sbjct: 338 PGYGPPPGPPPP 349 Score = 36.7 bits (81), Expect = 0.12 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 3/30 (10%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPP---XXPPPP 941 G PP PPP P PPP PP PPPP Sbjct: 327 GPLPPGPPPPVPGYGPPPGPPPPQQGPPPP 356 Score = 32.3 bits (70), Expect = 2.6 Identities = 19/65 (29%), Positives = 20/65 (30%) Frame = +3 Query: 744 GSXPXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPPXPP 923 G P PP P + P PG PP PP P P PP Sbjct: 327 GPLPPGPPPPVPGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGP-PP 385 Query: 924 XXPPP 938 PPP Sbjct: 386 GAPPP 390 Score = 31.9 bits (69), Expect = 3.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PP P P PP PP P PP Sbjct: 357 PGPFPPRPPGPLGPPLTLAPPPHLPGPP 384 Score = 31.5 bits (68), Expect = 4.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPP 938 PP PP PP PP PP PPP Sbjct: 273 PPRPPLGPP--GPPGPPGPPPP 292 Score = 31.1 bits (67), Expect = 6.1 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = +3 Query: 873 PPXPPPXPP--PXPPPXPPXXPPP 938 PP PP PP P PPP PPP Sbjct: 276 PPLGPPGPPGPPGPPPPGQVLPPP 299 Score = 30.7 bits (66), Expect = 8.0 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP P P PP P P P P PP PPP Sbjct: 356 PPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGAPPPAPHVNPAFFPPP 402 >AY388963-1|AAR26468.1| 837|Homo sapiens protocadherin 15 isoform B protein. Length = 837 Score = 41.1 bits (92), Expect = 0.006 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 + P P P PPP PP PPP P PPP Sbjct: 622 ISPSACPLPPPPPISPPSPPPAPAPLAPPP 651 Score = 37.5 bits (83), Expect = 0.070 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LS G PP PP P P PPP P PPP Sbjct: 680 LSVSTSGPPTPPLLPPFPTPLPPPPPSIPCPPP 712 Score = 34.7 bits (76), Expect = 0.49 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P PPP PP PP P P Sbjct: 620 PNISPSACPLPPPPPISPPSPPPAPAP 646 >AY029237-1|AAK31804.1| 1955|Homo sapiens protocadherin 15 protein. Length = 1955 Score = 41.1 bits (92), Expect = 0.006 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 + P P P PPP PP PPP P PPP Sbjct: 1740 ISPSACPLPPPPPISPPSPPPAPAPLAPPP 1769 Score = 37.5 bits (83), Expect = 0.070 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LS G PP PP P P PPP P PPP Sbjct: 1798 LSVSTSGPPTPPLLPPFPTPLPPPPPSIPCPPP 1830 Score = 34.7 bits (76), Expect = 0.49 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P PPP PP PP P P Sbjct: 1738 PNISPSACPLPPPPPISPPSPPPAPAP 1764 >AY029205-1|AAK31581.1| 1955|Homo sapiens protocadherin 15 protein. Length = 1955 Score = 41.1 bits (92), Expect = 0.006 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 + P P P PPP PP PPP P PPP Sbjct: 1740 ISPSACPLPPPPPISPPSPPPAPAPLAPPP 1769 Score = 37.5 bits (83), Expect = 0.070 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LS G PP PP P P PPP P PPP Sbjct: 1798 LSVSTSGPPTPPLLPPFPTPLPPPPPSIPCPPP 1830 Score = 34.7 bits (76), Expect = 0.49 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P PPP PP PP P P Sbjct: 1738 PNISPSACPLPPPPPISPPSPPPAPAP 1764 >AL365496-11|CAH73917.1| 837|Homo sapiens protocadherin 15 protein. Length = 837 Score = 41.1 bits (92), Expect = 0.006 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 + P P P PPP PP PPP P PPP Sbjct: 622 ISPSACPLPPPPPISPPSPPPAPAPLAPPP 651 Score = 37.5 bits (83), Expect = 0.070 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LS G PP PP P P PPP P PPP Sbjct: 680 LSVSTSGPPTPPLLPPFPTPLPPPPPSIPCPPP 712 Score = 34.7 bits (76), Expect = 0.49 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P PPP PP PP P P Sbjct: 620 PNISPSACPLPPPPPISPPSPPPAPAP 646 >AL365496-10|CAM19874.1| 1957|Homo sapiens protocadherin 15 protein. Length = 1957 Score = 41.1 bits (92), Expect = 0.006 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 + P P P PPP PP PPP P PPP Sbjct: 1742 ISPSACPLPPPPPISPPSPPPAPAPLAPPP 1771 Score = 37.5 bits (83), Expect = 0.070 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LS G PP PP P P PPP P PPP Sbjct: 1800 LSVSTSGPPTPPLLPPFPTPLPPPPPSIPCPPP 1832 Score = 34.7 bits (76), Expect = 0.49 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P PPP PP PP P P Sbjct: 1740 PNISPSACPLPPPPPISPPSPPPAPAP 1766 >AL365496-9|CAM19873.1| 1952|Homo sapiens protocadherin 15 protein. Length = 1952 Score = 41.1 bits (92), Expect = 0.006 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 + P P P PPP PP PPP P PPP Sbjct: 1737 ISPSACPLPPPPPISPPSPPPAPAPLAPPP 1766 Score = 37.5 bits (83), Expect = 0.070 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LS G PP PP P P PPP P PPP Sbjct: 1795 LSVSTSGPPTPPLLPPFPTPLPPPPPSIPCPPP 1827 Score = 34.7 bits (76), Expect = 0.49 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P PPP PP PP P P Sbjct: 1735 PNISPSACPLPPPPPISPPSPPPAPAP 1761 >AL365496-8|CAM19872.1| 1932|Homo sapiens protocadherin 15 protein. Length = 1932 Score = 41.1 bits (92), Expect = 0.006 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 + P P P PPP PP PPP P PPP Sbjct: 1717 ISPSACPLPPPPPISPPSPPPAPAPLAPPP 1746 Score = 37.5 bits (83), Expect = 0.070 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LS G PP PP P P PPP P PPP Sbjct: 1775 LSVSTSGPPTPPLLPPFPTPLPPPPPSIPCPPP 1807 Score = 34.7 bits (76), Expect = 0.49 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P PPP PP PP P P Sbjct: 1715 PNISPSACPLPPPPPISPPSPPPAPAP 1741 >AL365496-7|CAH73916.1| 1955|Homo sapiens protocadherin 15 protein. Length = 1955 Score = 41.1 bits (92), Expect = 0.006 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 + P P P PPP PP PPP P PPP Sbjct: 1740 ISPSACPLPPPPPISPPSPPPAPAPLAPPP 1769 Score = 37.5 bits (83), Expect = 0.070 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LS G PP PP P P PPP P PPP Sbjct: 1798 LSVSTSGPPTPPLLPPFPTPLPPPPPSIPCPPP 1830 Score = 34.7 bits (76), Expect = 0.49 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P PPP PP PP P P Sbjct: 1738 PNISPSACPLPPPPPISPPSPPPAPAP 1764 >AL360214-13|CAM21542.1| 1957|Homo sapiens protocadherin 15 protein. Length = 1957 Score = 41.1 bits (92), Expect = 0.006 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 + P P P PPP PP PPP P PPP Sbjct: 1742 ISPSACPLPPPPPISPPSPPPAPAPLAPPP 1771 Score = 37.5 bits (83), Expect = 0.070 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LS G PP PP P P PPP P PPP Sbjct: 1800 LSVSTSGPPTPPLLPPFPTPLPPPPPSIPCPPP 1832 Score = 34.7 bits (76), Expect = 0.49 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P PPP PP PP P P Sbjct: 1740 PNISPSACPLPPPPPISPPSPPPAPAP 1766 >AL360214-12|CAM21543.1| 1952|Homo sapiens protocadherin 15 protein. Length = 1952 Score = 41.1 bits (92), Expect = 0.006 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 + P P P PPP PP PPP P PPP Sbjct: 1737 ISPSACPLPPPPPISPPSPPPAPAPLAPPP 1766 Score = 37.5 bits (83), Expect = 0.070 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LS G PP PP P P PPP P PPP Sbjct: 1795 LSVSTSGPPTPPLLPPFPTPLPPPPPSIPCPPP 1827 Score = 34.7 bits (76), Expect = 0.49 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P PPP PP PP P P Sbjct: 1735 PNISPSACPLPPPPPISPPSPPPAPAP 1761 >AL360214-11|CAM21544.1| 1932|Homo sapiens protocadherin 15 protein. Length = 1932 Score = 41.1 bits (92), Expect = 0.006 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 + P P P PPP PP PPP P PPP Sbjct: 1717 ISPSACPLPPPPPISPPSPPPAPAPLAPPP 1746 Score = 37.5 bits (83), Expect = 0.070 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LS G PP PP P P PPP P PPP Sbjct: 1775 LSVSTSGPPTPPLLPPFPTPLPPPPPSIPCPPP 1807 Score = 34.7 bits (76), Expect = 0.49 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P PPP PP PP P P Sbjct: 1715 PNISPSACPLPPPPPISPPSPPPAPAP 1741 >AL360214-10|CAI15201.1| 1955|Homo sapiens protocadherin 15 protein. Length = 1955 Score = 41.1 bits (92), Expect = 0.006 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 + P P P PPP PP PPP P PPP Sbjct: 1740 ISPSACPLPPPPPISPPSPPPAPAPLAPPP 1769 Score = 37.5 bits (83), Expect = 0.070 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LS G PP PP P P PPP P PPP Sbjct: 1798 LSVSTSGPPTPPLLPPFPTPLPPPPPSIPCPPP 1830 Score = 34.7 bits (76), Expect = 0.49 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P PPP PP PP P P Sbjct: 1738 PNISPSACPLPPPPPISPPSPPPAPAP 1764 >AL356114-13|CAM15124.1| 1957|Homo sapiens protocadherin 15 protein. Length = 1957 Score = 41.1 bits (92), Expect = 0.006 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 + P P P PPP PP PPP P PPP Sbjct: 1742 ISPSACPLPPPPPISPPSPPPAPAPLAPPP 1771 Score = 37.5 bits (83), Expect = 0.070 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LS G PP PP P P PPP P PPP Sbjct: 1800 LSVSTSGPPTPPLLPPFPTPLPPPPPSIPCPPP 1832 Score = 34.7 bits (76), Expect = 0.49 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P PPP PP PP P P Sbjct: 1740 PNISPSACPLPPPPPISPPSPPPAPAP 1766 >AL356114-12|CAM15123.1| 1952|Homo sapiens protocadherin 15 protein. Length = 1952 Score = 41.1 bits (92), Expect = 0.006 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 + P P P PPP PP PPP P PPP Sbjct: 1737 ISPSACPLPPPPPISPPSPPPAPAPLAPPP 1766 Score = 37.5 bits (83), Expect = 0.070 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LS G PP PP P P PPP P PPP Sbjct: 1795 LSVSTSGPPTPPLLPPFPTPLPPPPPSIPCPPP 1827 Score = 34.7 bits (76), Expect = 0.49 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P PPP PP PP P P Sbjct: 1735 PNISPSACPLPPPPPISPPSPPPAPAP 1761 >AL356114-11|CAM15125.1| 1932|Homo sapiens protocadherin 15 protein. Length = 1932 Score = 41.1 bits (92), Expect = 0.006 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 + P P P PPP PP PPP P PPP Sbjct: 1717 ISPSACPLPPPPPISPPSPPPAPAPLAPPP 1746 Score = 37.5 bits (83), Expect = 0.070 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LS G PP PP P P PPP P PPP Sbjct: 1775 LSVSTSGPPTPPLLPPFPTPLPPPPPSIPCPPP 1807 Score = 34.7 bits (76), Expect = 0.49 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P PPP PP PP P P Sbjct: 1715 PNISPSACPLPPPPPISPPSPPPAPAP 1741 >AL356114-10|CAH71769.1| 1955|Homo sapiens protocadherin 15 protein. Length = 1955 Score = 41.1 bits (92), Expect = 0.006 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 + P P P PPP PP PPP P PPP Sbjct: 1740 ISPSACPLPPPPPISPPSPPPAPAPLAPPP 1769 Score = 37.5 bits (83), Expect = 0.070 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LS G PP PP P P PPP P PPP Sbjct: 1798 LSVSTSGPPTPPLLPPFPTPLPPPPPSIPCPPP 1830 Score = 34.7 bits (76), Expect = 0.49 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P PPP PP PP P P Sbjct: 1738 PNISPSACPLPPPPPISPPSPPPAPAP 1764 >AL355338-2|CAH70367.1| 532|Homo sapiens Zic family member 2 (odd-paired homolog, Drosophila) protein. Length = 532 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG G G GGG G Sbjct: 477 GGGSGSGGAGGGSGGGSGSGGGGGGAGG 504 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGG GG GGG GGG GG GGG Sbjct: 490 GGGSGSGGGGGGAGGGGGGSSGGG 513 Score = 38.7 bits (86), Expect = 0.030 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GG GGG G G GGG GG G Sbjct: 481 GSGGAGGGSGGGSGSGGGGGGAGGGGGG 508 Score = 38.7 bits (86), Expect = 0.030 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG G G GGG GG GGG G Sbjct: 486 GGGSGGGSGSGGGGGGAGGGGGGSSGG 512 Score = 36.7 bits (81), Expect = 0.12 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GG G GGG G G GGG G Sbjct: 484 GAGGGSGGGSGSGGGGGGAGGGGGGSSG 511 Score = 35.5 bits (78), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG 875 G GG GG GGG GG GGG G Sbjct: 494 GSGGGGGGAGGGGGGSSGGGSG 515 Score = 34.7 bits (76), Expect = 0.49 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGGG GG GGG GG G GG Sbjct: 497 GGGGGAGGGGGGSSGGGSGTAGG 519 Score = 34.3 bits (75), Expect = 0.65 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG G GGG G G GGG G G Sbjct: 488 GSGGGSGSGGGGGGAGGGGGGSSGGGSG 515 Score = 33.1 bits (72), Expect = 1.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG G GGG G G G GG Sbjct: 496 GGGGGGAGGGGGGSSGGGSGTAGG 519 >AL353784-11|CAM16792.1| 1957|Homo sapiens protocadherin 15 protein. Length = 1957 Score = 41.1 bits (92), Expect = 0.006 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 + P P P PPP PP PPP P PPP Sbjct: 1742 ISPSACPLPPPPPISPPSPPPAPAPLAPPP 1771 Score = 37.5 bits (83), Expect = 0.070 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LS G PP PP P P PPP P PPP Sbjct: 1800 LSVSTSGPPTPPLLPPFPTPLPPPPPSIPCPPP 1832 Score = 34.7 bits (76), Expect = 0.49 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P PPP PP PP P P Sbjct: 1740 PNISPSACPLPPPPPISPPSPPPAPAP 1766 >AL353784-10|CAM16791.1| 1952|Homo sapiens protocadherin 15 protein. Length = 1952 Score = 41.1 bits (92), Expect = 0.006 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 + P P P PPP PP PPP P PPP Sbjct: 1737 ISPSACPLPPPPPISPPSPPPAPAPLAPPP 1766 Score = 37.5 bits (83), Expect = 0.070 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LS G PP PP P P PPP P PPP Sbjct: 1795 LSVSTSGPPTPPLLPPFPTPLPPPPPSIPCPPP 1827 Score = 34.7 bits (76), Expect = 0.49 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P PPP PP PP P P Sbjct: 1735 PNISPSACPLPPPPPISPPSPPPAPAP 1761 >AL353784-9|CAH72390.1| 1955|Homo sapiens protocadherin 15 protein. Length = 1955 Score = 41.1 bits (92), Expect = 0.006 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 + P P P PPP PP PPP P PPP Sbjct: 1740 ISPSACPLPPPPPISPPSPPPAPAPLAPPP 1769 Score = 37.5 bits (83), Expect = 0.070 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LS G PP PP P P PPP P PPP Sbjct: 1798 LSVSTSGPPTPPLLPPFPTPLPPPPPSIPCPPP 1830 Score = 34.7 bits (76), Expect = 0.49 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P PPP PP PP P P Sbjct: 1738 PNISPSACPLPPPPPISPPSPPPAPAP 1764 >AK223568-1|BAD97288.1| 551|Homo sapiens cleavage and polyadenylation specific factor 6, 68 kD subunit variant protein. Length = 551 Score = 41.1 bits (92), Expect = 0.006 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LP PPP P PPP PPP PPPP Sbjct: 292 LPPGPPPPVPGYGPPPGPPPPQQGPPPPP 320 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/31 (54%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +3 Query: 855 LPGXXPPPXPPP---XPPPXPPPXPPXXPPP 938 +PG PPP PPP PPP P P PP P P Sbjct: 300 VPGYGPPPGPPPPQQGPPPPPGPFPPRPPGP 330 Score = 39.9 bits (89), Expect = 0.013 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 2/50 (4%) Frame = +1 Query: 796 PPSPPXPXPPXXXXX--PSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 PP PP P P P P P P P PP P P PPPH Sbjct: 293 PPGPPPPVPGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPH 342 Score = 39.1 bits (87), Expect = 0.023 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PPP P PP PP PP P PP Sbjct: 223 PGGPPPPFPAGQTPPRPPLGPPGPPGPP 250 Score = 38.3 bits (85), Expect = 0.040 Identities = 25/72 (34%), Positives = 25/72 (34%), Gaps = 2/72 (2%) Frame = +3 Query: 732 GXWGGSXPXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPP--PXPPPXPPPX 905 G G P PP P Q P L P PP P PP PPP Sbjct: 242 GPPGPPGPPGPPPPGQVLPPPLAGPPNRGDRPPPP-VLFPGQPFGQPPLGPLPPGPPPPV 300 Query: 906 PPPXPPXXPPPP 941 P PP PPPP Sbjct: 301 PGYGPPPGPPPP 312 Score = 36.7 bits (81), Expect = 0.12 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 3/30 (10%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPP---XXPPPP 941 G PP PPP P PPP PP PPPP Sbjct: 290 GPLPPGPPPPVPGYGPPPGPPPPQQGPPPP 319 Score = 32.3 bits (70), Expect = 2.6 Identities = 19/65 (29%), Positives = 20/65 (30%) Frame = +3 Query: 744 GSXPXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPPXPP 923 G P PP P + P PG PP PP P P PP Sbjct: 290 GPLPPGPPPPVPGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGP-PP 348 Query: 924 XXPPP 938 PPP Sbjct: 349 GAPPP 353 Score = 31.9 bits (69), Expect = 3.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PP P P PP PP P PP Sbjct: 320 PGPFPPRPPGPLGPPLTLAPPPHLPGPP 347 Score = 31.5 bits (68), Expect = 4.6 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPP-PXPPPXPPPXPPPXPPXXPPPP 941 PG P PPP P PP PP PP P Sbjct: 218 PGPAGPGGPPPPFPAGQTPPRPPLGPPGP 246 Score = 31.1 bits (67), Expect = 6.1 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = +3 Query: 873 PPXPPPXP--PPXPPPXPPXXPPP 938 PP PP P PP PPP PPP Sbjct: 239 PPLGPPGPPGPPGPPPPGQVLPPP 262 Score = 30.7 bits (66), Expect = 8.0 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP P P PP P P P P PP PPP Sbjct: 319 PPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGAPPPAPHVNPAFFPPP 365 >AJ007041-1|CAB45385.1| 2715|Homo sapiens trithorax homologue 2 protein. Length = 2715 Score = 41.1 bits (92), Expect = 0.006 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PP PPP PP P PPPP Sbjct: 425 PPPLCPPPPPPVSPPPLPSPPPPP 448 Score = 40.3 bits (90), Expect = 0.010 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP P PP PPP PP PPP Sbjct: 414 PPPLPPPSTSPPPPLCPPPPPPVSPPP 440 Score = 39.9 bits (89), Expect = 0.013 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP P PP PPPP Sbjct: 411 PSPPPPLPPPSTSPPPPLCPPPP 433 Score = 38.7 bits (86), Expect = 0.030 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PP P P PP PP PPP Sbjct: 403 PPPLTPPAPSPPPPLPPPSTSPPP 426 Score = 38.3 bits (85), Expect = 0.040 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P S LP P PP PPP PP PP P PP Sbjct: 409 PAPSPPPPLPPPSTSPPPPLCPPPPPPVSPPPLPSPP 445 Score = 37.1 bits (82), Expect(2) = 0.006 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPPPXPPPXPPPXP 920 SL+ LP PPP PPP P P PPP P Sbjct: 613 SLTRELP--PPPPAPPPPPAPSPPPAP 637 Score = 36.3 bits (80), Expect = 0.16 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPP 923 P PPP PP PPP P P PP Sbjct: 426 PPLCPPPPPPVSPPPLPSPPPP 447 Score = 35.5 bits (78), Expect = 0.28 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP P PPP P P PPPP Sbjct: 420 PSTSPPPPLCPPPPPPVSPPPLPSPPPP 447 Score = 35.1 bits (77), Expect = 0.37 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 3/49 (6%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXF---SLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PSPP P PP P P P P P PP P PPP Sbjct: 411 PSPPPPLPPPSTSPPPPLCPPPPPPVSPPPLPSPPPPPAQEEQEESPPP 459 Score = 35.1 bits (77), Expect = 0.37 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXP 932 P PPP PPP P P PP P Sbjct: 619 PPPPPAPPPPPAPSPPPAP 637 Score = 34.7 bits (76), Expect = 0.49 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PP PP PP P P P PPPP Sbjct: 404 PPLTPPAPSPPPPLPPPSTSPPPP 427 Score = 32.7 bits (71), Expect = 2.0 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 888 PXPPPXPPPXPPXXPPP 938 P PPP PPP P PPP Sbjct: 619 PPPPPAPPPPPAPSPPP 635 Score = 32.3 bits (70), Expect = 2.6 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P +PP P PP PS P P PP P P PPP Sbjct: 405 PLTPPAPSPPPPLPPPS-----TSPPPPLCPPPPPPVSPPPLPSPPP 446 Score = 31.9 bits (69), Expect = 3.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXPPP 938 PPP P P PPP P P P Sbjct: 619 PPPPPAPPPPPAPSPPPAP 637 Score = 31.9 bits (69), Expect = 3.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 885 PPXPPPXPPPXPPXXPPPP 941 PP PP PPP P PP P Sbjct: 619 PPPPPAPPPPPAPSPPPAP 637 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +3 Query: 831 PXRSL-SXVLPGXXPPPXPPPXPPPXPPPXPP 923 P ++L + +LP PPP P PPP P PP Sbjct: 740 PLQALQTQLLPQALPPPQPQLQPPPSPQQMPP 771 Score = 23.0 bits (47), Expect(2) = 0.006 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +3 Query: 894 PPPXPPPXPPXXPPPP 941 PPP P P PPP Sbjct: 668 PPPLGAPEAPEPEPPP 683 >AF453528-1|AAL50802.1| 760|Homo sapiens sodium bicarbonate cotransporter 4f protein. Length = 760 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GGG G G G Sbjct: 442 GGGAPGGGNGGGGGGGSGGGAGSGGAGG 469 Score = 39.5 bits (88), Expect = 0.017 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GGG GGG GGG GGG G Sbjct: 440 GGGG--GAPGGGNGGGGGGGSGGGAGSG 465 Score = 39.5 bits (88), Expect = 0.017 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRTXE 845 GGG GG GGG GGG G G GG G E Sbjct: 447 GGGNGGGGGGGSGGGAGSGGAGGTSSGDDGE 477 Score = 37.9 bits (84), Expect = 0.053 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRT 851 GGGG GG GG GGG GG G G T Sbjct: 441 GGGGAPGGGNGGGGGGGSGGGAGSGGAGGT 470 Score = 36.3 bits (80), Expect = 0.16 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GG GGG GGG GGG G Sbjct: 437 GSVGGGGGAPGGGNGGGGGGGSGGG 461 >AF452248-1|AAL48291.1| 1051|Homo sapiens sodium bicarbonate cotransporter NBC4e protein. Length = 1051 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GGG G G G Sbjct: 442 GGGAPGGGNGGGGGGGSGGGAGSGGAGG 469 Score = 39.5 bits (88), Expect = 0.017 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GGG GGG GGG GGG G Sbjct: 440 GGGG--GAPGGGNGGGGGGGSGGGAGSG 465 Score = 39.5 bits (88), Expect = 0.017 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRTXE 845 GGG GG GGG GGG G G GG G E Sbjct: 447 GGGNGGGGGGGSGGGAGSGGAGGTSSGDDGE 477 Score = 37.9 bits (84), Expect = 0.053 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRT 851 GGGG GG GG GGG GG G G T Sbjct: 441 GGGGAPGGGNGGGGGGGSGGGAGSGGAGGT 470 Score = 36.3 bits (80), Expect = 0.16 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GG GGG GGG GGG G Sbjct: 437 GSVGGGGGAPGGGNGGGGGGGSGGG 461 >AF293338-1|AAK97073.1| 1040|Homo sapiens sodium bicarbonate cotransporter NBC4d protein. Length = 1040 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GGG G G G Sbjct: 442 GGGAPGGGNGGGGGGGSGGGAGSGGAGG 469 Score = 39.5 bits (88), Expect = 0.017 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GGG GGG GGG GGG G Sbjct: 440 GGGG--GAPGGGNGGGGGGGSGGGAGSG 465 Score = 39.5 bits (88), Expect = 0.017 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRTXE 845 GGG GG GGG GGG G G GG G E Sbjct: 447 GGGNGGGGGGGSGGGAGSGGAGGTSSGDDGE 477 Score = 37.9 bits (84), Expect = 0.053 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRT 851 GGGG GG GG GGG GG G G T Sbjct: 441 GGGGAPGGGNGGGGGGGSGGGAGSGGAGGT 470 Score = 36.3 bits (80), Expect = 0.16 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GG GGG GGG GGG G Sbjct: 437 GSVGGGGGAPGGGNGGGGGGGSGGG 461 >AF293337-1|AAK97072.1| 1121|Homo sapiens sodium bicarbonate cotransporter NBC4c protein. Length = 1121 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GGG G G G Sbjct: 442 GGGAPGGGNGGGGGGGSGGGAGSGGAGG 469 Score = 39.5 bits (88), Expect = 0.017 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GGG GGG GGG GGG G Sbjct: 440 GGGG--GAPGGGNGGGGGGGSGGGAGSG 465 Score = 39.5 bits (88), Expect = 0.017 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRTXE 845 GGG GG GGG GGG G G GG G E Sbjct: 447 GGGNGGGGGGGSGGGAGSGGAGGTSSGDDGE 477 Score = 37.9 bits (84), Expect = 0.053 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRT 851 GGGG GG GG GGG GG G G T Sbjct: 441 GGGGAPGGGNGGGGGGGSGGGAGSGGAGGT 470 Score = 36.3 bits (80), Expect = 0.16 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GG GGG GGG GGG G Sbjct: 437 GSVGGGGGAPGGGNGGGGGGGSGGG 461 >AF243499-1|AAK26741.1| 1137|Homo sapiens sodium bicarbonate cotransporter NBC4a protein. Length = 1137 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GGG G G G Sbjct: 442 GGGAPGGGNGGGGGGGSGGGAGSGGAGG 469 Score = 39.5 bits (88), Expect = 0.017 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GGG GGG GGG GGG G Sbjct: 440 GGGG--GAPGGGNGGGGGGGSGGGAGSG 465 Score = 39.5 bits (88), Expect = 0.017 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRTXE 845 GGG GG GGG GGG G G GG G E Sbjct: 447 GGGNGGGGGGGSGGGAGSGGAGGTSSGDDGE 477 Score = 37.9 bits (84), Expect = 0.053 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRT 851 GGGG GG GG GGG GG G G T Sbjct: 441 GGGGAPGGGNGGGGGGGSGGGAGSGGAGGT 470 Score = 36.3 bits (80), Expect = 0.16 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GG GGG GGG GGG G Sbjct: 437 GSVGGGGGAPGGGNGGGGGGGSGGG 461 >AF207661-1|AAG18492.1| 1074|Homo sapiens sodium bicarbonate cotransporter-like protein protein. Length = 1074 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GGG G G G Sbjct: 442 GGGAPGGGNGGGGGGGSGGGAGSGGAGG 469 Score = 39.5 bits (88), Expect = 0.017 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GGG GGG GGG GGG G Sbjct: 440 GGGG--GAPGGGNGGGGGGGSGGGAGSG 465 Score = 39.5 bits (88), Expect = 0.017 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRTXE 845 GGG GG GGG GGG G G GG G E Sbjct: 447 GGGNGGGGGGGSGGGAGSGGAGGTSSGDDGE 477 Score = 37.9 bits (84), Expect = 0.053 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRT 851 GGGG GG GG GGG GG G G T Sbjct: 441 GGGGAPGGGNGGGGGGGSGGGAGSGGAGGT 470 Score = 36.3 bits (80), Expect = 0.16 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GG GGG GGG GGG G Sbjct: 437 GSVGGGGGAPGGGNGGGGGGGSGGG 461 >AF193855-1|AAG28409.1| 532|Homo sapiens zinc finger protein of cerebellum ZIC2 protein. Length = 532 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG G G GGG G Sbjct: 477 GGGSGSGGAGGGSGGGSGSGGGGGGAGG 504 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGG GG GGG GGG GG GGG Sbjct: 490 GGGSGSGGGGGGAGGGGGGSSGGG 513 Score = 38.7 bits (86), Expect = 0.030 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GG GGG G G GGG GG G Sbjct: 481 GSGGAGGGSGGGSGSGGGGGGAGGGGGG 508 Score = 38.7 bits (86), Expect = 0.030 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG G G GGG GG GGG G Sbjct: 486 GGGSGGGSGSGGGGGGAGGGGGGSSGG 512 Score = 36.7 bits (81), Expect = 0.12 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GG G GGG G G GGG G Sbjct: 484 GAGGGSGGGSGSGGGGGGAGGGGGGSSG 511 Score = 35.5 bits (78), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG 875 G GG GG GGG GG GGG G Sbjct: 494 GSGGGGGGAGGGGGGSSGGGSG 515 Score = 34.7 bits (76), Expect = 0.49 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGGG GG GGG GG G GG Sbjct: 497 GGGGGAGGGGGGSSGGGSGTAGG 519 Score = 34.3 bits (75), Expect = 0.65 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG G GGG G G GGG G G Sbjct: 488 GSGGGSGSGGGGGGAGGGGGGSSGGGSG 515 Score = 33.1 bits (72), Expect = 1.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG G GGG G G G GG Sbjct: 496 GGGGGGAGGGGGGSSGGGSGTAGG 519 >AF186605-1|AAD56420.1| 2605|Homo sapiens MLL2 protein protein. Length = 2605 Score = 41.1 bits (92), Expect = 0.006 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PP PPP PP P PPPP Sbjct: 315 PPPLCPPPPPPVSPPPLPSPPPPP 338 Score = 40.3 bits (90), Expect = 0.010 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP P PP PPP PP PPP Sbjct: 304 PPPLPPPSTSPPPPLCPPPPPPVSPPP 330 Score = 39.9 bits (89), Expect = 0.013 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP P PP PPPP Sbjct: 301 PSPPPPLPPPSTSPPPPLCPPPP 323 Score = 38.7 bits (86), Expect = 0.030 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PP P P PP PP PPP Sbjct: 293 PPPLTPPAPSPPPPLPPPSTSPPP 316 Score = 38.3 bits (85), Expect = 0.040 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P S LP P PP PPP PP PP P PP Sbjct: 299 PAPSPPPPLPPPSTSPPPPLCPPPPPPVSPPPLPSPP 335 Score = 37.1 bits (82), Expect(2) = 0.006 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPPPXPPPXPPPXP 920 SL+ LP PPP PPP P P PPP P Sbjct: 503 SLTRELP--PPPPAPPPPPAPSPPPAP 527 Score = 36.3 bits (80), Expect = 0.16 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPP 923 P PPP PP PPP P P PP Sbjct: 316 PPLCPPPPPPVSPPPLPSPPPP 337 Score = 35.5 bits (78), Expect = 0.28 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP P PPP P P PPPP Sbjct: 310 PSTSPPPPLCPPPPPPVSPPPLPSPPPP 337 Score = 35.1 bits (77), Expect = 0.37 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 3/49 (6%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXF---SLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PSPP P PP P P P P P PP P PPP Sbjct: 301 PSPPPPLPPPSTSPPPPLCPPPPPPVSPPPLPSPPPPPAQEEQEESPPP 349 Score = 35.1 bits (77), Expect = 0.37 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXP 932 P PPP PPP P P PP P Sbjct: 509 PPPPPAPPPPPAPSPPPAP 527 Score = 34.7 bits (76), Expect = 0.49 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PP PP PP P P P PPPP Sbjct: 294 PPLTPPAPSPPPPLPPPSTSPPPP 317 Score = 32.7 bits (71), Expect = 2.0 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 888 PXPPPXPPPXPPXXPPP 938 P PPP PPP P PPP Sbjct: 509 PPPPPAPPPPPAPSPPP 525 Score = 32.3 bits (70), Expect = 2.6 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P +PP P PP PS P P PP P P PPP Sbjct: 295 PLTPPAPSPPPPLPPPS-----TSPPPPLCPPPPPPVSPPPLPSPPP 336 Score = 31.9 bits (69), Expect = 3.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXPPP 938 PPP P P PPP P P P Sbjct: 509 PPPPPAPPPPPAPSPPPAP 527 Score = 31.9 bits (69), Expect = 3.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 885 PPXPPPXPPPXPPXXPPPP 941 PP PP PPP P PP P Sbjct: 509 PPPPPAPPPPPAPSPPPAP 527 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +3 Query: 831 PXRSL-SXVLPGXXPPPXPPPXPPPXPPPXPP 923 P ++L + +LP PPP P PPP P PP Sbjct: 630 PLQALQTQLLPQALPPPQPQLQPPPSPQQMPP 661 Score = 23.0 bits (47), Expect(2) = 0.006 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +3 Query: 894 PPPXPPPXPPXXPPPP 941 PPP P P PPP Sbjct: 558 PPPLGAPEAPEPEPPP 573 >AF104902-1|AAC96325.1| 533|Homo sapiens ZIC2 protein protein. Length = 533 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG G G GGG G Sbjct: 478 GGGSGSGGAGGGSGGGSGSGGGGGGAGG 505 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGG GG GGG GGG GG GGG Sbjct: 491 GGGSGSGGGGGGAGGGGGGSSGGG 514 Score = 38.7 bits (86), Expect = 0.030 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GG GGG G G GGG GG G Sbjct: 482 GSGGAGGGSGGGSGSGGGGGGAGGGGGG 509 Score = 38.7 bits (86), Expect = 0.030 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG G G GGG GG GGG G Sbjct: 487 GGGSGGGSGSGGGGGGAGGGGGGSSGG 513 Score = 36.7 bits (81), Expect = 0.12 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GG G GGG G G GGG G Sbjct: 485 GAGGGSGGGSGSGGGGGGAGGGGGGSSG 512 Score = 35.5 bits (78), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG 875 G GG GG GGG GG GGG G Sbjct: 495 GSGGGGGGAGGGGGGSSGGGSG 516 Score = 34.7 bits (76), Expect = 0.49 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGGG GG GGG GG G GG Sbjct: 498 GGGGGAGGGGGGSSGGGSGTAGG 520 Score = 34.3 bits (75), Expect = 0.65 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG G GGG G G GGG G G Sbjct: 489 GSGGGSGSGGGGGGAGGGGGGSSGGGSG 516 Score = 33.1 bits (72), Expect = 1.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG G GGG G G G GG Sbjct: 497 GGGGGGAGGGGGGSSGGGSGTAGG 520 >AF051782-1|AAC05373.1| 1248|Homo sapiens diaphanous 1 protein. Length = 1248 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXP---PXXPPPP 941 PG P PPP PPP PPP P PPPP Sbjct: 593 PGDSTTPPPPPPPPPPPPPLPGGTAISPPPP 623 Score = 37.1 bits (82), Expect = 0.093 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PP P P PPP PP PPPP Sbjct: 584 GTIIPPPPAPGDSTTPPPPPPPPPPPP 610 Score = 36.3 bits (80), Expect = 0.16 Identities = 18/49 (36%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXP--SPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP+PP P P +P S P P P PP P T PPP Sbjct: 574 PPAPPLPGDSGTIIPPPPAPGDSTTPPPPPPPPPPPPPLPGGTAISPPP 622 Score = 36.3 bits (80), Expect = 0.16 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 PPP P P PPP PP PPP Sbjct: 589 PPPAPGDSTTPPPPPPPPPPPPP 611 Score = 35.9 bits (79), Expect = 0.21 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PPP PP PPPP Sbjct: 588 PPPPAPGDSTTPPPPPPPPPPPPP 611 Score = 35.9 bits (79), Expect = 0.21 Identities = 29/119 (24%), Positives = 30/119 (25%), Gaps = 4/119 (3%) Frame = +3 Query: 597 PPXXXXXKKSPXXXXFRPPXPXXGPXXXXXXXXXXXXXXXXXXXRGXWGGSXPXNPPXPX 776 PP P PP P G G + P PP P Sbjct: 603 PPPPPPPPPLPGGTAISPPPPLSGDATIPPPPPLPEGVGIPSPSSLPGGTAIPPPPPLPG 662 Query: 777 QRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXP----PPXPPPXPPPXPPXXPPPP 941 P G PPP P P PPP P P P PPPP Sbjct: 663 SARIPPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPPP 721 Score = 33.9 bits (74), Expect = 0.86 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PPP P P PPP PPPP Sbjct: 703 PGIPPPPPFPGGPGIPPPPPGMGMPPPP 730 Score = 31.1 bits (67), Expect = 6.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LPG PPP P PP PPPP Sbjct: 579 LPGDSGTIIPPPPAPGDSTTPPPPPPPPP 607 >AC073263-6|AAX93062.1| 714|Homo sapiens unknown protein. Length = 714 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GGG G G G Sbjct: 19 GGGAPGGGNGGGGGGGSGGGAGSGGAGG 46 Score = 39.5 bits (88), Expect = 0.017 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GGG GGG GGG GGG G Sbjct: 17 GGGG--GAPGGGNGGGGGGGSGGGAGSG 42 Score = 39.5 bits (88), Expect = 0.017 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRTXE 845 GGG GG GGG GGG G G GG G E Sbjct: 24 GGGNGGGGGGGSGGGAGSGGAGGTSSGDDGE 54 Score = 37.9 bits (84), Expect = 0.053 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRT 851 GGGG GG GG GGG GG G G T Sbjct: 18 GGGGAPGGGNGGGGGGGSGGGAGSGGAGGT 47 Score = 36.3 bits (80), Expect = 0.16 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GG GGG GGG GGG G Sbjct: 14 GSVGGGGGAPGGGNGGGGGGGSGGG 38 >AB209752-1|BAD92989.1| 906|Homo sapiens sodium bicarbonate transporter 4 isoform d variant protein. Length = 906 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GGG G G G Sbjct: 355 GGGAPGGGNGGGGGGGSGGGAGSGGAGG 382 Score = 39.5 bits (88), Expect = 0.017 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GGG GGG GGG GGG G Sbjct: 353 GGGG--GAPGGGNGGGGGGGSGGGAGSG 378 Score = 39.5 bits (88), Expect = 0.017 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRTXE 845 GGG GG GGG GGG G G GG G E Sbjct: 360 GGGNGGGGGGGSGGGAGSGGAGGTSSGDDGE 390 Score = 37.9 bits (84), Expect = 0.053 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRT 851 GGGG GG GG GGG GG G G T Sbjct: 354 GGGGAPGGGNGGGGGGGSGGGAGSGGAGGT 383 Score = 36.3 bits (80), Expect = 0.16 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GG GGG GGG GGG G Sbjct: 350 GSVGGGGGAPGGGNGGGGGGGSGGG 374 >AB209373-1|BAD92610.1| 410|Homo sapiens CS0DA006YC23 variant protein. Length = 410 Score = 41.1 bits (92), Expect = 0.006 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPPPX---PPPXPPPXPPXXPPPP 941 P PPP PPP PPP PP P PPPP Sbjct: 310 PNPPPPPVPPPPASFPPPAIPPPTPGYPPPP 340 Score = 37.9 bits (84), Expect = 0.053 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPX-PPPXP--PPXPPPXPPXXPPPP 941 P PPP PPP P PP PP P PPPP Sbjct: 321 PASFPPPAIPPPTPGYPPPPPTYNPNFPPPP 351 Score = 36.7 bits (81), Expect = 0.12 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPPPX-PPPXPPPXPPXXPPP 938 P PPP PP PP PPP PP PP Sbjct: 372 PASYPPPAVPPGGQPPVPPPIPPPGMPP 399 Score = 35.9 bits (79), Expect = 0.21 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PPP PP P PP PPP Sbjct: 305 PHVYPPNPPPPPVPPPPASFPPPAIPPP 332 Score = 34.7 bits (76), Expect = 0.49 Identities = 18/55 (32%), Positives = 19/55 (34%) Frame = +1 Query: 772 PXSXFXWXPPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P + P PP P PP P P P P P PP P PPP Sbjct: 302 PYHPHVYPPNPPPPPVPPPPASFPPPAI-----PPPTPGYPPPPPTYNPNFPPPP 351 Score = 33.9 bits (74), Expect = 0.86 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 5/51 (9%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXP-----XXPPXPXXPXTXXXPP 933 PP PP P PP P+ P P P PP P P T PP Sbjct: 312 PPPPPVPPPPASFPPPAIPPPTPGYPPPPPTYNPNFPPPPPRLPPTHAVPP 362 Score = 33.5 bits (73), Expect = 1.1 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LP PP P P PPP P PPPP Sbjct: 226 LPKVQIPPPAHPAPVHQPPPLPHRPPPPP 254 Score = 33.5 bits (73), Expect = 1.1 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +3 Query: 861 GXXPPPXPPP-XPPPXPPPXPPXXPPP 938 G P PPP PP PP PP PPP Sbjct: 369 GLPPASYPPPAVPPGGQPPVPPPIPPP 395 Score = 31.5 bits (68), Expect = 4.6 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXP-PPXPPPXPPPXPPXXPPPP 941 P ++ PG PPP P PP PP PP PP Sbjct: 325 PPPAIPPPTPGYPPPPPTYNPNFPPPPPRLPPTHAVPP 362 Score = 31.5 bits (68), Expect = 4.6 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPP 914 +P PP PPP PPP PP Sbjct: 380 VPPGGQPPVPPPIPPPGMPP 399 >AB002302-1|BAA20763.3| 2415|Homo sapiens KIAA0304 protein protein. Length = 2415 Score = 41.1 bits (92), Expect = 0.006 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PP PPP PP P PPPP Sbjct: 125 PPPLCPPPPPPVSPPPLPSPPPPP 148 Score = 40.3 bits (90), Expect = 0.010 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP P PP PPP PP PPP Sbjct: 114 PPPLPPPSTSPPPPLCPPPPPPVSPPP 140 Score = 39.9 bits (89), Expect = 0.013 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP P PP PPPP Sbjct: 111 PSPPPPLPPPSTSPPPPLCPPPP 133 Score = 38.7 bits (86), Expect = 0.030 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PP P P PP PP PPP Sbjct: 103 PPPLTPPAPSPPPPLPPPSTSPPP 126 Score = 38.3 bits (85), Expect = 0.040 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P S LP P PP PPP PP PP P PP Sbjct: 109 PAPSPPPPLPPPSTSPPPPLCPPPPPPVSPPPLPSPP 145 Score = 37.1 bits (82), Expect(2) = 0.006 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPPPXPPPXPPPXP 920 SL+ LP PPP PPP P P PPP P Sbjct: 313 SLTRELP--PPPPAPPPPPAPSPPPAP 337 Score = 36.3 bits (80), Expect = 0.16 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPP 923 P PPP PP PPP P P PP Sbjct: 126 PPLCPPPPPPVSPPPLPSPPPP 147 Score = 35.5 bits (78), Expect = 0.28 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP P PPP P P PPPP Sbjct: 120 PSTSPPPPLCPPPPPPVSPPPLPSPPPP 147 Score = 35.1 bits (77), Expect = 0.37 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 3/49 (6%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXF---SLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PSPP P PP P P P P P PP P PPP Sbjct: 111 PSPPPPLPPPSTSPPPPLCPPPPPPVSPPPLPSPPPPPAQEEQEESPPP 159 Score = 35.1 bits (77), Expect = 0.37 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXP 932 P PPP PPP P P PP P Sbjct: 319 PPPPPAPPPPPAPSPPPAP 337 Score = 34.7 bits (76), Expect = 0.49 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PP PP PP P P P PPPP Sbjct: 104 PPLTPPAPSPPPPLPPPSTSPPPP 127 Score = 32.7 bits (71), Expect = 2.0 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 888 PXPPPXPPPXPPXXPPP 938 P PPP PPP P PPP Sbjct: 319 PPPPPAPPPPPAPSPPP 335 Score = 32.3 bits (70), Expect = 2.6 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P +PP P PP PS P P PP P P PPP Sbjct: 105 PLTPPAPSPPPPLPPPS-----TSPPPPLCPPPPPPVSPPPLPSPPP 146 Score = 31.9 bits (69), Expect = 3.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXPPP 938 PPP P P PPP P P P Sbjct: 319 PPPPPAPPPPPAPSPPPAP 337 Score = 31.9 bits (69), Expect = 3.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 885 PPXPPPXPPPXPPXXPPPP 941 PP PP PPP P PP P Sbjct: 319 PPPPPAPPPPPAPSPPPAP 337 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +3 Query: 831 PXRSL-SXVLPGXXPPPXPPPXPPPXPPPXPP 923 P ++L + +LP PPP P PPP P PP Sbjct: 440 PLQALQTQLLPQALPPPQPQLQPPPSPQQMPP 471 Score = 23.0 bits (47), Expect(2) = 0.006 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +3 Query: 894 PPPXPPPXPPXXPPPP 941 PPP P P PPP Sbjct: 368 PPPLGAPEAPEPEPPP 383 >Z11933-1|CAA77990.1| 443|Homo sapiens N-Oct 3 octamer DNA (ATGCAAAT) binding protein with brn-2 POU domain protein. Length = 443 Score = 40.7 bits (91), Expect = 0.008 Identities = 19/30 (63%), Positives = 19/30 (63%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRT 851 GGGG GG GGG GGG GGG GG P T Sbjct: 68 GGGG--GGGGGGGGGGGGGGGGGDGSPWST 95 >L37868-1|AAB59611.1| 443|Homo sapiens POU-domain transcription factor protein. Length = 443 Score = 40.7 bits (91), Expect = 0.008 Identities = 19/30 (63%), Positives = 19/30 (63%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRT 851 GGGG GG GGG GGG GGG GG P T Sbjct: 68 GGGG--GGGGGGGGGGGGGGGGGDGSPWST 95 >BX537864-1|CAD97867.1| 270|Homo sapiens hypothetical protein protein. Length = 270 Score = 40.7 bits (91), Expect = 0.008 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPP 935 PP PPP PPP PPP P PP Sbjct: 242 PPPPPPPPPPPPPPAPKMPPP 262 Score = 40.7 bits (91), Expect = 0.008 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPP 938 P PPP PPP PPP P PPP Sbjct: 242 PPPPPPPPPPPPPPAPKMPPP 262 Score = 39.9 bits (89), Expect = 0.013 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 VL P PPP PPP P PP PPPP Sbjct: 39 VLQPPLPLEMPPPPPPPPESPPPPPPPPPP 68 Score = 37.5 bits (83), Expect = 0.070 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP PP PP Sbjct: 242 PPPPPPPPPPPPPPAPKMPP 261 Score = 37.5 bits (83), Expect = 0.070 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP P PPP Sbjct: 243 PPPPPPPPPPPPPAPKMPPP 262 Score = 35.5 bits (78), Expect = 0.28 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 +P PP PPP PPP P PPPP Sbjct: 37 VPVLQPPLPLEMPPPPPPPPESPPPPPPP 65 Score = 35.5 bits (78), Expect = 0.28 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPP 923 PPP PPP PPP P PP Sbjct: 244 PPPPPPPPPPPPAPKMPP 261 Score = 32.3 bits (70), Expect = 2.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPP 911 P L P PP PPP PPP PP Sbjct: 42 PPLPLEMPPPPPPPPESPPPPPPPPPP 68 Score = 32.3 bits (70), Expect = 2.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPP 923 P PPP PPP PPP P PP Sbjct: 242 PPPPPPPPPPP-PPPAPKMPPP 262 >BC094799-1|AAH94799.1| 1222|Homo sapiens valosin containing protein (p97)/p47 complex interacting protein 1 protein. Length = 1222 Score = 40.7 bits (91), Expect = 0.008 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXP 932 PPP PPP PPP PPP P P Sbjct: 4 PPPPPPPLPPPPPPPEAPQTP 24 Score = 35.5 bits (78), Expect = 0.28 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXPP 935 PPP PPP PPP PP P Sbjct: 4 PPPPPPPLPPPPPPPEAP 21 Score = 33.9 bits (74), Expect = 0.86 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXP 920 P PPP PPP PPP P P Sbjct: 4 PPPPPPPLPPPPPPPEAPQTP 24 Score = 33.9 bits (74), Expect = 0.86 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXPPPP 941 PPP PP PPP PP P P Sbjct: 5 PPPPPPLPPPPPPPEAPQTP 24 Score = 33.5 bits (73), Expect = 1.1 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 894 PPPXPPPXPPXXPPP 938 PPP PPP PP PPP Sbjct: 4 PPPPPPPLPPPPPPP 18 >BC051699-1|AAH51699.2| 443|Homo sapiens POU class 3 homeobox 2 protein. Length = 443 Score = 40.7 bits (91), Expect = 0.008 Identities = 19/30 (63%), Positives = 19/30 (63%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRT 851 GGGG GG GGG GGG GGG GG P T Sbjct: 68 GGGG--GGGGGGGGGGGGGGGGGDGSPWST 95 >BC037404-1|AAH37404.1| 1015|Homo sapiens formin binding protein 4 protein. Length = 1015 Score = 40.7 bits (91), Expect = 0.008 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPP 935 PP PPP PPP PPP P PP Sbjct: 903 PPPPPPPPPPPPPPAPKMPPP 923 Score = 40.7 bits (91), Expect = 0.008 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPP 938 P PPP PPP PPP P PPP Sbjct: 903 PPPPPPPPPPPPPPAPKMPPP 923 Score = 39.9 bits (89), Expect = 0.013 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 VL P PPP PPP P PP PPPP Sbjct: 700 VLQPPLPLEMPPPPPPPPESPPPPPPPPPP 729 Score = 37.5 bits (83), Expect = 0.070 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP PP PP Sbjct: 903 PPPPPPPPPPPPPPAPKMPP 922 Score = 37.5 bits (83), Expect = 0.070 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP P PPP Sbjct: 904 PPPPPPPPPPPPPAPKMPPP 923 Score = 35.5 bits (78), Expect = 0.28 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 +P PP PPP PPP P PPPP Sbjct: 698 VPVLQPPLPLEMPPPPPPPPESPPPPPPP 726 Score = 35.5 bits (78), Expect = 0.28 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPP 923 PPP PPP PPP P PP Sbjct: 905 PPPPPPPPPPPPAPKMPP 922 Score = 32.3 bits (70), Expect = 2.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPP 911 P L P PP PPP PPP PP Sbjct: 703 PPLPLEMPPPPPPPPESPPPPPPPPPP 729 Score = 32.3 bits (70), Expect = 2.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPP 923 P PPP PPP PPP P PP Sbjct: 903 PPPPPPPPPPP-PPPAPKMPPP 923 >BC036035-1|AAH36035.1| 979|Homo sapiens DHX36 protein protein. Length = 979 Score = 40.7 bits (91), Expect = 0.008 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGR 854 GGG GG GG G G GGG GGG GR Sbjct: 23 GGGPAGGHGGNRGSGGGGGGGGGGRGGR 50 Score = 37.5 bits (83), Expect = 0.070 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXR 836 GGG GG GG GG G G GGG G R R Sbjct: 19 GGGYGGGPAGGHGGNRGSGGGGGGGGGGRGGRGR 52 Score = 37.1 bits (82), Expect = 0.093 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXER 842 GG G G GGG GGG GG G G PG R Sbjct: 28 GGHGGNRGSGGGGGGGGGGRGGRGRHPGHLKGR 60 >BC003413-1|AAH03413.1| 217|Homo sapiens nucleolar protein family A, member 1 (H/ACA small nucleolar RNPs) protein. Length = 217 Score = 40.7 bits (91), Expect = 0.008 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGR 854 GGGG GG GGG GG GGG GGG GR Sbjct: 181 GGGGRGGGRGGGFRGGRGGG-GGGFRGGR 208 Score = 39.1 bits (87), Expect = 0.023 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGR 854 GGG G GG GGG GGG GGG GR Sbjct: 170 GGGRGGRGGGRGGGGRGGGRGGGFRGGR 197 Score = 38.7 bits (86), Expect = 0.030 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGG GG GGG GGG GG GGG Sbjct: 177 GGGRGGGGRGGGRGGGFRGGRGGG 200 Score = 35.5 bits (78), Expect = 0.28 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 GGG GG GGG GGG GG GGG Sbjct: 190 GGGFRGGRGGG-GGGFRGGRGGG 211 Score = 35.1 bits (77), Expect = 0.37 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -2 Query: 940 GGGGXXGGXGGGX-GGGXGGGXGGGXXPG 857 G GG GG GGG GGG GGG GG G Sbjct: 172 GRGGRGGGRGGGGRGGGRGGGFRGGRGGG 200 Score = 33.1 bits (72), Expect = 1.5 Identities = 17/26 (65%), Positives = 17/26 (65%), Gaps = 3/26 (11%) Frame = -2 Query: 940 GGGGXXGGX--GGGXGG-GXGGGXGG 872 GGGG GG GGG GG G GGG GG Sbjct: 32 GGGGGGGGNFRGGGRGGFGRGGGRGG 57 Score = 32.3 bits (70), Expect = 2.6 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGG-GXGGG 869 GGG GG G GGG GG G GGG Sbjct: 31 GGGGGGGGGNFRGGGRGGFGRGGG 54 Score = 31.5 bits (68), Expect = 4.6 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GG GGG GGG GG G Sbjct: 166 GPPRGGGRGGRGGGRGGGGRGGGRGG 191 >AL022395-2|CAB37982.1| 443|Homo sapiens POU domain, class 3, transcription factor 2 protein. Length = 443 Score = 40.7 bits (91), Expect = 0.008 Identities = 19/30 (63%), Positives = 19/30 (63%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRT 851 GGGG GG GGG GGG GGG GG P T Sbjct: 68 GGGG--GGGGGGGGGGGGGGGGGDGSPWST 95 >AK022987-1|BAB14348.1| 560|Homo sapiens protein ( Homo sapiens cDNA FLJ12925 fis, clone NT2RP2004710, highly similar to Mus musculus formin binding protein 30 mRNA. ). Length = 560 Score = 40.7 bits (91), Expect = 0.008 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPP 935 PP PPP PPP PPP P PP Sbjct: 448 PPPPPPPPPPPPPPAPKMPPP 468 Score = 40.7 bits (91), Expect = 0.008 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPP 938 P PPP PPP PPP P PPP Sbjct: 448 PPPPPPPPPPPPPPAPKMPPP 468 Score = 39.9 bits (89), Expect = 0.013 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 VL P PPP PPP P PP PPPP Sbjct: 245 VLQPPLPLEMPPPPPPPPESPPPPPPPPPP 274 Score = 37.5 bits (83), Expect = 0.070 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP PP PP Sbjct: 448 PPPPPPPPPPPPPPAPKMPP 467 Score = 37.5 bits (83), Expect = 0.070 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP P PPP Sbjct: 449 PPPPPPPPPPPPPAPKMPPP 468 Score = 35.5 bits (78), Expect = 0.28 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 +P PP PPP PPP P PPPP Sbjct: 243 VPVLQPPLPLEMPPPPPPPPESPPPPPPP 271 Score = 35.5 bits (78), Expect = 0.28 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPP 923 PPP PPP PPP P PP Sbjct: 450 PPPPPPPPPPPPAPKMPP 467 Score = 32.3 bits (70), Expect = 2.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPP 911 P L P PP PPP PPP PP Sbjct: 248 PPLPLEMPPPPPPPPESPPPPPPPPPP 274 Score = 32.3 bits (70), Expect = 2.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPP 923 P PPP PPP PPP P PP Sbjct: 448 PPPPPPPPPPP-PPPAPKMPPP 468 >AJ577134-1|CAE11803.1| 994|Homo sapiens putative DExH/D RNA helicase protein. Length = 994 Score = 40.7 bits (91), Expect = 0.008 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGR 854 GGG GG GG G G GGG GGG GR Sbjct: 23 GGGPAGGHGGNRGSGGGGGGGGGGRGGR 50 Score = 37.5 bits (83), Expect = 0.070 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXR 836 GGG GG GG GG G G GGG G R R Sbjct: 19 GGGYGGGPAGGHGGNRGSGGGGGGGGGGRGGRGR 52 Score = 37.1 bits (82), Expect = 0.093 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXER 842 GG G G GGG GGG GG G G PG R Sbjct: 28 GGHGGNRGSGGGGGGGGGGRGGRGRHPGHLKGR 60 >AJ577133-1|CAE11802.1| 1008|Homo sapiens putative DExH/D RNA helicase protein. Length = 1008 Score = 40.7 bits (91), Expect = 0.008 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGR 854 GGG GG GG G G GGG GGG GR Sbjct: 23 GGGPAGGHGGNRGSGGGGGGGGGGRGGR 50 Score = 37.5 bits (83), Expect = 0.070 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXR 836 GGG GG GG GG G G GGG G R R Sbjct: 19 GGGYGGGPAGGHGGNRGSGGGGGGGGGGRGGRGR 52 Score = 37.1 bits (82), Expect = 0.093 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXER 842 GG G G GGG GGG GG G G PG R Sbjct: 28 GGHGGNRGSGGGGGGGGGGRGGRGRHPGHLKGR 60 >AJ276003-1|CAB76563.1| 217|Homo sapiens GAR1 protein protein. Length = 217 Score = 40.7 bits (91), Expect = 0.008 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGR 854 GGGG GG GGG GG GGG GGG GR Sbjct: 181 GGGGRGGGRGGGFRGGRGGG-GGGFRGGR 208 Score = 39.1 bits (87), Expect = 0.023 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGR 854 GGG G GG GGG GGG GGG GR Sbjct: 170 GGGRGGRGGGRGGGGRGGGRGGGFRGGR 197 Score = 38.7 bits (86), Expect = 0.030 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGG GG GGG GGG GG GGG Sbjct: 177 GGGRGGGGRGGGRGGGFRGGRGGG 200 Score = 35.5 bits (78), Expect = 0.28 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 GGG GG GGG GGG GG GGG Sbjct: 190 GGGFRGGRGGG-GGGFRGGRGGG 211 Score = 35.1 bits (77), Expect = 0.37 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -2 Query: 940 GGGGXXGGXGGGX-GGGXGGGXGGGXXPG 857 G GG GG GGG GGG GGG GG G Sbjct: 172 GRGGRGGGRGGGGRGGGRGGGFRGGRGGG 200 Score = 33.1 bits (72), Expect = 1.5 Identities = 17/26 (65%), Positives = 17/26 (65%), Gaps = 3/26 (11%) Frame = -2 Query: 940 GGGGXXGGX--GGGXGG-GXGGGXGG 872 GGGG GG GGG GG G GGG GG Sbjct: 32 GGGGGGGGNFRGGGRGGFGRGGGRGG 57 Score = 32.3 bits (70), Expect = 2.6 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGG-GXGGG 869 GGG GG G GGG GG G GGG Sbjct: 31 GGGGGGGGGNFRGGGRGGFGRGGG 54 Score = 31.5 bits (68), Expect = 4.6 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GG GGG GGG GG G Sbjct: 166 GPPRGGGRGGRGGGRGGGGRGGGRGG 191 >AF217190-1|AAG36783.1| 1008|Homo sapiens MLEL1 protein protein. Length = 1008 Score = 40.7 bits (91), Expect = 0.008 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGR 854 GGG GG GG G G GGG GGG GR Sbjct: 23 GGGPAGGHGGNRGSGGGGGGGGGGRGGR 50 Score = 37.5 bits (83), Expect = 0.070 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXR 836 GGG GG GG GG G G GGG G R R Sbjct: 19 GGGYGGGPAGGHGGNRGSGGGGGGGGGGRGGRGR 52 Score = 37.1 bits (82), Expect = 0.093 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXER 842 GG G G GGG GGG GG G G PG R Sbjct: 28 GGHGGNRGSGGGGGGGGGGRGGRGRHPGHLKGR 60 >AB058753-1|BAB47479.1| 1236|Homo sapiens KIAA1850 protein protein. Length = 1236 Score = 40.7 bits (91), Expect = 0.008 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXP 932 PPP PPP PPP PPP P P Sbjct: 18 PPPPPPPLPPPPPPPEAPQTP 38 Score = 35.9 bits (79), Expect = 0.21 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG P PPP P P PPP PP P P Sbjct: 12 PGAMSQPPPPPPPLP-PPPPPPEAPQTP 38 >AB023231-1|BAA76858.2| 1050|Homo sapiens KIAA1014 protein protein. Length = 1050 Score = 40.7 bits (91), Expect = 0.008 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPP 935 PP PPP PPP PPP P PP Sbjct: 938 PPPPPPPPPPPPPPAPKMPPP 958 Score = 40.7 bits (91), Expect = 0.008 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPP 938 P PPP PPP PPP P PPP Sbjct: 938 PPPPPPPPPPPPPPAPKMPPP 958 Score = 39.9 bits (89), Expect = 0.013 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 VL P PPP PPP P PP PPPP Sbjct: 735 VLQPPLPLEMPPPPPPPPESPPPPPPPPPP 764 Score = 37.5 bits (83), Expect = 0.070 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP PP PP Sbjct: 938 PPPPPPPPPPPPPPAPKMPP 957 Score = 37.5 bits (83), Expect = 0.070 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP P PPP Sbjct: 939 PPPPPPPPPPPPPAPKMPPP 958 Score = 35.5 bits (78), Expect = 0.28 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 +P PP PPP PPP P PPPP Sbjct: 733 VPVLQPPLPLEMPPPPPPPPESPPPPPPP 761 Score = 35.5 bits (78), Expect = 0.28 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPP 923 PPP PPP PPP P PP Sbjct: 940 PPPPPPPPPPPPAPKMPP 957 Score = 32.3 bits (70), Expect = 2.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPP 911 P L P PP PPP PPP PP Sbjct: 738 PPLPLEMPPPPPPPPESPPPPPPPPPP 764 Score = 32.3 bits (70), Expect = 2.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPP 923 P PPP PPP PPP P PP Sbjct: 938 PPPPPPPPPPP-PPPAPKMPPP 958 >Z86061-3|CAI42258.1| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LPG PPP PP P P P PP PP P Sbjct: 557 LPGVGPPPPPPAPPLPGGAPLPPPPPPLP 585 Score = 37.1 bits (82), Expect = 0.093 Identities = 19/36 (52%), Positives = 19/36 (52%), Gaps = 7/36 (19%) Frame = +3 Query: 855 LPGXXP-PPXPPPXP------PPXPPPXPPXXPPPP 941 LPG P PP PPP P PP PPP PPPP Sbjct: 571 LPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPP 606 Score = 35.9 bits (79), Expect = 0.21 Identities = 18/33 (54%), Positives = 18/33 (54%), Gaps = 4/33 (12%) Frame = +3 Query: 855 LPGXX--PPPXPPPXPPPXPPPXPP--XXPPPP 941 LPG PPP PPP PPP PP PPPP Sbjct: 584 LPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPP 616 Score = 33.9 bits (74), Expect = 0.86 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXP---PXXPPPP 941 P P P P PPP PP P P PPPP Sbjct: 552 PAAPPLPGVGPPPPPPAPPLPGGAPLPPPPP 582 Score = 33.5 bits (73), Expect = 1.1 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 8/35 (22%) Frame = +3 Query: 861 GXXPPPXPPPXP---PPXPPPXPP-----XXPPPP 941 G PP PP P PP PPP PP PPPP Sbjct: 547 GIPGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPPP 581 Score = 31.9 bits (69), Expect = 3.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P PP PP P P P P PP P P PPP Sbjct: 549 PGPPAA-PPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPP 593 >Z86061-2|CAI42257.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LPG PPP PP P P P PP PP P Sbjct: 557 LPGVGPPPPPPAPPLPGGAPLPPPPPPLP 585 Score = 37.1 bits (82), Expect = 0.093 Identities = 19/36 (52%), Positives = 19/36 (52%), Gaps = 7/36 (19%) Frame = +3 Query: 855 LPGXXP-PPXPPPXP------PPXPPPXPPXXPPPP 941 LPG P PP PPP P PP PPP PPPP Sbjct: 571 LPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPP 606 Score = 35.9 bits (79), Expect = 0.21 Identities = 18/33 (54%), Positives = 18/33 (54%), Gaps = 4/33 (12%) Frame = +3 Query: 855 LPGXX--PPPXPPPXPPPXPPPXPP--XXPPPP 941 LPG PPP PPP PPP PP PPPP Sbjct: 584 LPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPP 616 Score = 33.9 bits (74), Expect = 0.86 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXP---PXXPPPP 941 P P P P PPP PP P P PPPP Sbjct: 552 PAAPPLPGVGPPPPPPAPPLPGGAPLPPPPP 582 Score = 33.5 bits (73), Expect = 1.1 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 8/35 (22%) Frame = +3 Query: 861 GXXPPPXPPPXP---PPXPPPXPP-----XXPPPP 941 G PP PP P PP PPP PP PPPP Sbjct: 547 GIPGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPPP 581 Score = 31.9 bits (69), Expect = 3.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P PP PP P P P P PP P P PPP Sbjct: 549 PGPPAA-PPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPP 593 >Y15909-1|CAA75870.1| 1101|Homo sapiens DIA-156 protein protein. Length = 1101 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LPG PPP PP P P P PP PP P Sbjct: 557 LPGVGPPPPPPAPPLPGGAPLPPPPPPLP 585 Score = 37.1 bits (82), Expect = 0.093 Identities = 19/36 (52%), Positives = 19/36 (52%), Gaps = 7/36 (19%) Frame = +3 Query: 855 LPGXXP-PPXPPPXP------PPXPPPXPPXXPPPP 941 LPG P PP PPP P PP PPP PPPP Sbjct: 571 LPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPP 606 Score = 35.9 bits (79), Expect = 0.21 Identities = 18/33 (54%), Positives = 18/33 (54%), Gaps = 4/33 (12%) Frame = +3 Query: 855 LPGXX--PPPXPPPXPPPXPPPXPP--XXPPPP 941 LPG PPP PPP PPP PP PPPP Sbjct: 584 LPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPP 616 Score = 33.9 bits (74), Expect = 0.86 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXP---PXXPPPP 941 P P P P PPP PP P P PPPP Sbjct: 552 PAAPPLPGVGPPPPPPAPPLPGGAPLPPPPP 582 Score = 33.5 bits (73), Expect = 1.1 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 8/35 (22%) Frame = +3 Query: 861 GXXPPPXPPPXP---PPXPPPXPP-----XXPPPP 941 G PP PP P PP PPP PP PPPP Sbjct: 547 GIPGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPPP 581 Score = 31.9 bits (69), Expect = 3.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P PP PP P P P P PP P P PPP Sbjct: 549 PGPPAA-PPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPP 593 >Y15908-1|CAA75869.1| 1096|Homo sapiens DIA-12C protein protein. Length = 1096 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LPG PPP PP P P P PP PP P Sbjct: 557 LPGVGPPPPPPAPPLPGGAPLPPPPPPLP 585 Score = 37.1 bits (82), Expect = 0.093 Identities = 19/36 (52%), Positives = 19/36 (52%), Gaps = 7/36 (19%) Frame = +3 Query: 855 LPGXXP-PPXPPPXP------PPXPPPXPPXXPPPP 941 LPG P PP PPP P PP PPP PPPP Sbjct: 571 LPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPP 606 Score = 35.9 bits (79), Expect = 0.21 Identities = 18/33 (54%), Positives = 18/33 (54%), Gaps = 4/33 (12%) Frame = +3 Query: 855 LPGXX--PPPXPPPXPPPXPPPXPP--XXPPPP 941 LPG PPP PPP PPP PP PPPP Sbjct: 584 LPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPP 616 Score = 33.9 bits (74), Expect = 0.86 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXP---PXXPPPP 941 P P P P PPP PP P P PPPP Sbjct: 552 PAAPPLPGVGPPPPPPAPPLPGGAPLPPPPP 582 Score = 33.5 bits (73), Expect = 1.1 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 8/35 (22%) Frame = +3 Query: 861 GXXPPPXPPPXP---PPXPPPXPP-----XXPPPP 941 G PP PP P PP PPP PP PPPP Sbjct: 547 GIPGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPPP 581 Score = 31.9 bits (69), Expect = 3.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P PP PP P P P P PP P P PPP Sbjct: 549 PGPPAA-PPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPP 593 >X64624-1|CAA45907.1| 331|Homo sapiens RDC-1 protein. Length = 331 Score = 40.3 bits (90), Expect = 0.010 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GG GGG GGG GG G Sbjct: 62 GGGGPRGGGGGPGGGGPGGGGGGAAGGG 89 Score = 40.3 bits (90), Expect = 0.010 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GG GGG GG GGG G Sbjct: 69 GGGGPGGGGPGGGGGGAAGGGGGGPGGG 96 Score = 37.9 bits (84), Expect = 0.053 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG G G GGG G GGG G Sbjct: 68 GGGGGPGGGGPGGGGGGAAGGGGGGPGG 95 Score = 35.9 bits (79), Expect = 0.21 Identities = 19/32 (59%), Positives = 19/32 (59%), Gaps = 4/32 (12%) Frame = -2 Query: 940 GGG--GXXGGXGGGXGGGXGGG--XGGGXXPG 857 GGG G GG GGG GG GGG GGG PG Sbjct: 63 GGGPRGGGGGPGGGGPGGGGGGAAGGGGGGPG 94 Score = 34.3 bits (75), Expect = 0.65 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GGG G GGG GGG G Sbjct: 53 GGGGAHDAAGGGGPRGGGGGPGGGGPGG 80 Score = 33.9 bits (74), Expect = 0.86 Identities = 17/30 (56%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXGGXGGGXGG--GXGGGXGGGXXPG 857 GGG GG GGG GG G GGG GG G Sbjct: 70 GGGPGGGGPGGGGGGAAGGGGGGPGGGLLG 99 Score = 32.7 bits (71), Expect = 2.0 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -3 Query: 822 GGGGXGGGGXPXEXAXRGGGGX*XXNLPTXPGGG 721 GGG GGGG P GGGG PGGG Sbjct: 63 GGGPRGGGGGPGGGGPGGGGGGAAGGGGGGPGGG 96 Score = 32.3 bits (70), Expect = 2.6 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GGG GG GG GGG G Sbjct: 54 GGGAHDAAGGGGPRGGGGGPGGGGPGGG 81 >X07696-1|CAA30535.1| 456|Homo sapiens protein ( Human mRNA for cytokeratin 15. ). Length = 456 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GGG GGG GGG GG Sbjct: 78 GGGFGGGVGGGFGGGFGGGDGG 99 Score = 37.5 bits (83), Expect = 0.070 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GGG GGG GGG GGG G Sbjct: 70 GGGAGSVFGGGFGGGVGGGFGGGFGGG 96 Score = 33.9 bits (74), Expect = 0.86 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GGG GGG GG G Sbjct: 82 GGGVGGGFGGGFGGGDGGLLSG 103 Score = 33.1 bits (72), Expect = 1.5 Identities = 17/32 (53%), Positives = 17/32 (53%), Gaps = 4/32 (12%) Frame = -2 Query: 940 GGG----GXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG G GG G GGG GGG GGG G Sbjct: 61 GGGMRVCGFGGGAGSVFGGGFGGGVGGGFGGG 92 >U88666-1|AAC05299.1| 686|Homo sapiens serine kinase SRPK2 protein. Length = 686 Score = 40.3 bits (90), Expect = 0.010 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP P PP P Sbjct: 24 PPPPPPPPPPPPPLPDPTPPEP 45 Score = 39.1 bits (87), Expect = 0.023 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P PPP PPP PPP P P PP Sbjct: 16 PQQKAPLVPPPPPPPPPPPPPLPDPTPP 43 Score = 33.5 bits (73), Expect = 1.1 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPP 923 ++P PPP PPP P P P P P Sbjct: 22 LVPPPPPPPPPPPPPLPDPTPPEP 45 Score = 33.1 bits (72), Expect = 1.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPPP 941 P P P PPP PP PPPP Sbjct: 14 PEPQQKAPLVPPPPPPPPPPPP 35 Score = 31.9 bits (69), Expect = 3.5 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXP 920 P + V P PPP PPP P PP P Sbjct: 16 PQQKAPLVPPPPPPPPPPPPPLPDPTPPEP 45 >L35013-1|AAA60300.1| 424|Homo sapiens spliceosomal protein protein. Length = 424 Score = 40.3 bits (90), Expect = 0.010 Identities = 18/31 (58%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPP-PXPPPXPPPX--PPPXPPXXPPPP 941 PG PP PPP PPP PP PP PPPP Sbjct: 235 PGMPPPGSFPPPVPPPGALPPGIPPAMPPPP 265 Score = 35.1 bits (77), Expect = 0.37 Identities = 16/28 (57%), Positives = 16/28 (57%), Gaps = 3/28 (10%) Frame = +3 Query: 861 GXXPPPXPPP-XPPPXPPP--XPPXXPP 935 G PPP PPP P P PPP PP PP Sbjct: 330 GGQPPPRPPPGMPHPGPPPMGMPPRGPP 357 Score = 33.5 bits (73), Expect = 1.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 PG PP PP PPP PP PP Sbjct: 250 PGALPPGIPPAMPPPPMPPGAAGHGPP 276 Score = 31.9 bits (69), Expect = 3.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP PPP PPP P PPP Sbjct: 326 PPGSGGQPPPRPPPGMPHPGPPP 348 Score = 30.7 bits (66), Expect = 8.0 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 7/34 (20%) Frame = +3 Query: 861 GXXPPPXPPPX-------PPPXPPPXPPXXPPPP 941 G PP PPP PPP P P PP P P Sbjct: 384 GYTGPPRPPPYGYQRGPLPPPRPTPRPPVPPRGP 417 >D10250-1|BAA01095.1| 2783|Homo sapiens alpha-fetoprotein enhancer binding protein protein. Length = 2783 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGGG G GGG GGG GGG GG Sbjct: 2585 GGGGGGSGGGGGGGGGGGGGGGG 2607 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 GGG G GGG GGG GGG GGG Sbjct: 2585 GGGGGGSGGGGGGGGGGGGGGGG 2607 Score = 39.5 bits (88), Expect = 0.017 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP P PP P Sbjct: 1123 PEPPPPPPPPPPPPLPAAPPQP 1144 Score = 37.1 bits (82), Expect = 0.093 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPP 938 P PPP PPP PPP P P P Sbjct: 1123 PEPPPPPPPPPPPPLPAAPPQP 1144 Score = 37.1 bits (82), Expect = 0.093 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -2 Query: 922 GGXGGGXGGGXGGGXGGGXXPG 857 GG GGG GGG GGG GGG G Sbjct: 2585 GGGGGGSGGGGGGGGGGGGGGG 2606 Score = 36.7 bits (81), Expect = 0.12 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 P P P PPP PPP PP PP Sbjct: 1120 PQTPEPPPPPPPPPPPPLPAAPP 1142 Score = 35.5 bits (78), Expect = 0.28 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPPPXPPPXPP-PXPPPXPPXXPPPP 941 P PPP PPP PP P PP P P P Sbjct: 1123 PEPPPPPPPPPPPPLPAAPPQPASTPAIP 1151 Score = 34.7 bits (76), Expect = 0.49 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXP 932 P PP PPP PPP P P P P Sbjct: 1120 PQTPEPPPPPPPPPPPPLPAAPPQP 1144 Score = 34.7 bits (76), Expect = 0.49 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 922 GGXGGGXGGGXGGGXGGGXXPG 857 GG GG GGG GGG GGG G Sbjct: 2586 GGGGGSGGGGGGGGGGGGGGGG 2607 Score = 32.7 bits (71), Expect = 2.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPPP 941 P P P P PPP PP PP P Sbjct: 1117 PLRPQTPEPPPPPPPPPPPPLP 1138 Score = 31.9 bits (69), Expect = 3.5 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 4/40 (10%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXP--PPXPPPXP--PXXPPP 938 P R + P PPP PPP P PP P P P PP Sbjct: 1117 PLRPQTPEPPPPPPPPPPPPLPAAPPQPASTPAIPASAPP 1156 >BT007261-1|AAP35925.1| 456|Homo sapiens keratin 15 protein. Length = 456 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GGG GGG GGG GG Sbjct: 78 GGGFGGGVGGGFGGGFGGGDGG 99 Score = 37.5 bits (83), Expect = 0.070 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GGG GGG GGG GGG G Sbjct: 70 GGGAGSVFGGGFGGGVGGGFGGGFGGG 96 Score = 33.9 bits (74), Expect = 0.86 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GGG GGG GG G Sbjct: 82 GGGVGGGFGGGFGGGDGGLLSG 103 Score = 33.1 bits (72), Expect = 1.5 Identities = 17/32 (53%), Positives = 17/32 (53%), Gaps = 4/32 (12%) Frame = -2 Query: 940 GGG----GXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG G GG G GGG GGG GGG G Sbjct: 61 GGGMRVCGFGGGAGSVFGGGFGGGVGGGFGGG 92 >BC117414-1|AAI17415.1| 1103|Homo sapiens DIAPH2 protein protein. Length = 1103 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LPG PPP PP P P P PP PP P Sbjct: 564 LPGVGPPPPPPAPPLPGGAPLPPPPPPLP 592 Score = 37.1 bits (82), Expect = 0.093 Identities = 19/36 (52%), Positives = 19/36 (52%), Gaps = 7/36 (19%) Frame = +3 Query: 855 LPGXXP-PPXPPPXP------PPXPPPXPPXXPPPP 941 LPG P PP PPP P PP PPP PPPP Sbjct: 578 LPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPP 613 Score = 35.9 bits (79), Expect = 0.21 Identities = 18/33 (54%), Positives = 18/33 (54%), Gaps = 4/33 (12%) Frame = +3 Query: 855 LPGXX--PPPXPPPXPPPXPPPXPP--XXPPPP 941 LPG PPP PPP PPP PP PPPP Sbjct: 591 LPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPP 623 Score = 33.9 bits (74), Expect = 0.86 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXP---PXXPPPP 941 P P P P PPP PP P P PPPP Sbjct: 559 PAAPPLPGVGPPPPPPAPPLPGGAPLPPPPP 589 Score = 33.5 bits (73), Expect = 1.1 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 8/35 (22%) Frame = +3 Query: 861 GXXPPPXPPPXP---PPXPPPXPP-----XXPPPP 941 G PP PP P PP PPP PP PPPP Sbjct: 554 GIPGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPPP 588 Score = 31.9 bits (69), Expect = 3.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P PP PP P P P P PP P P PPP Sbjct: 556 PGPPAA-PPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPP 600 >BC105018-1|AAI05019.1| 306|Homo sapiens RNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog protein. Length = 306 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGG GG GGG GGG GG GGG Sbjct: 227 GGGAGGGGGGGGSGGGGSGGGGGG 250 Score = 40.3 bits (90), Expect = 0.010 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GG G GG GG GGG GGG GGG Sbjct: 228 GGAGGGGGGGGSGGGGSGGGGGGG 251 Score = 38.7 bits (86), Expect = 0.030 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGR 854 GGG GG GGG GG G G GGG R Sbjct: 227 GGGAGGGGGGGGSGGGGSGGGGGGGSSR 254 Score = 37.5 bits (83), Expect = 0.070 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 G GG GG GGG G G GG GGG Sbjct: 225 GDGGGAGGGGGGGGSGGGGSGGGG 248 Score = 37.5 bits (83), Expect = 0.070 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXP 860 G GG GG G G GG GGG GG P Sbjct: 229 GAGGGGGGGGSGGGGSGGGGGGGSSRP 255 Score = 35.9 bits (79), Expect = 0.21 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXP 860 GGGG GG GGG G G GGG G P Sbjct: 231 GGGGGGGGSGGG-GSGGGGGGGSSRPP 256 Score = 33.5 bits (73), Expect = 1.1 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GGG GGG GGG GG G Sbjct: 221 GKKKGDGGGAGGGGGGGGSGGGGSG 245 Score = 32.7 bits (71), Expect = 2.0 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG GGG GGG GGG G Sbjct: 221 GKKKGDGGGAGGGGGGGGSGGGGSGG 246 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,050,368 Number of Sequences: 237096 Number of extensions: 3452934 Number of successful extensions: 133168 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 13304 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68853 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 12381054106 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -