BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_J23 (941 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 54 1e-07 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 50 3e-06 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 47 2e-05 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 47 2e-05 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 46 4e-05 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 46 4e-05 At4g01985.1 68417.m00265 expressed protein 45 6e-05 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 45 6e-05 At2g30560.1 68415.m03722 glycine-rich protein 45 8e-05 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 44 1e-04 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 44 1e-04 At4g16240.1 68417.m02464 hypothetical protein 44 2e-04 At3g50180.1 68416.m05486 hypothetical protein 43 3e-04 At1g75550.1 68414.m08780 glycine-rich protein 43 3e-04 At1g10620.1 68414.m01204 protein kinase family protein contains ... 43 3e-04 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 42 4e-04 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 42 4e-04 At5g46730.1 68418.m05757 glycine-rich protein 42 6e-04 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 42 6e-04 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 42 6e-04 At5g38560.1 68418.m04662 protein kinase family protein contains ... 41 0.001 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 41 0.001 At2g05440.2 68415.m00575 glycine-rich protein 41 0.001 At4g29030.1 68417.m04151 glycine-rich protein glycine-rich prote... 41 0.001 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 41 0.001 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 40 0.002 At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containi... 40 0.002 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 40 0.002 At4g30460.1 68417.m04325 glycine-rich protein 40 0.002 At4g08230.1 68417.m01358 glycine-rich protein 40 0.002 At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein... 40 0.002 At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar... 40 0.002 At1g53625.1 68414.m06096 expressed protein 40 0.002 At1g11850.2 68414.m01364 expressed protein 40 0.002 At1g04800.1 68414.m00476 glycine-rich protein 40 0.002 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 40 0.003 At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; g... 40 0.003 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 40 0.003 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 40 0.003 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 40 0.003 At1g29380.1 68414.m03592 hypothetical protein 40 0.003 At1g26150.1 68414.m03192 protein kinase family protein similar t... 40 0.003 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 40 0.003 At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family... 38 0.003 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 39 0.004 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 39 0.004 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 39 0.004 At2g05440.1 68415.m00574 glycine-rich protein 39 0.004 At1g61080.1 68414.m06877 proline-rich family protein 39 0.004 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 39 0.004 At4g18570.1 68417.m02749 proline-rich family protein common fami... 39 0.006 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 39 0.006 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 39 0.006 At1g53640.1 68414.m06100 hypothetical protein ; expression suppo... 39 0.006 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 38 0.007 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 38 0.007 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 38 0.007 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 38 0.007 At2g04170.1 68415.m00402 meprin and TRAF homology domain-contain... 38 0.007 At5g59270.1 68418.m07427 lectin protein kinase family protein co... 38 0.010 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 38 0.010 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 38 0.010 At3g50140.1 68416.m05481 expressed protein contains Pfam profile... 38 0.010 At3g16350.1 68416.m02068 myb family transcription factor ; conta... 38 0.010 At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ b... 38 0.010 At1g70990.1 68414.m08190 proline-rich family protein 38 0.010 At1g62240.1 68414.m07021 expressed protein 38 0.010 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 38 0.010 At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family... 29 0.012 At5g62210.1 68418.m07811 embryo-specific protein-related contain... 38 0.013 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 38 0.013 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 38 0.013 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 38 0.013 At5g04970.1 68418.m00526 pectinesterase, putative contains simil... 38 0.013 At3g26400.1 68416.m03292 eukaryotic translation initiation facto... 38 0.013 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 38 0.013 At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family... 37 0.017 At5g19750.1 68418.m02348 peroxisomal membrane 22 kDa family prot... 37 0.017 At5g19090.1 68418.m02269 heavy-metal-associated domain-containin... 37 0.017 At5g08230.1 68418.m00965 PWWP domain-containing protein putative... 37 0.017 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 37 0.017 At2g34670.1 68415.m04259 proline-rich family protein contains pr... 37 0.017 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 37 0.017 At1g53620.1 68414.m06094 glycine-rich protein 37 0.017 At1g27710.1 68414.m03387 glycine-rich protein 37 0.017 At1g15830.1 68414.m01900 expressed protein 37 0.017 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 37 0.022 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 37 0.022 At3g51290.1 68416.m05614 proline-rich family protein 37 0.022 At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1... 37 0.022 At3g08640.1 68416.m01003 alphavirus core protein family contains... 37 0.022 At3g08630.1 68416.m01002 expressed protein 37 0.022 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 37 0.022 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 37 0.022 At1g61750.1 68414.m06964 expressed protein contains Pfam profile... 37 0.022 At1g27750.1 68414.m03391 ubiquitin system component Cue domain-c... 37 0.022 At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family... 37 0.022 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 36 0.029 At5g19090.2 68418.m02270 heavy-metal-associated domain-containin... 36 0.029 At4g33660.1 68417.m04781 expressed protein 36 0.029 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 36 0.029 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 36 0.029 At1g74720.1 68414.m08658 C2 domain-containing protein contains I... 36 0.029 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 36 0.029 At1g13020.1 68414.m01510 eukaryotic translation initiation facto... 36 0.029 At5g56140.1 68418.m07003 KH domain-containing protein 36 0.039 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 36 0.039 At5g10550.1 68418.m01221 DNA-binding bromodomain-containing prot... 36 0.039 At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, ... 36 0.039 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 36 0.039 At2g39750.1 68415.m04881 dehydration-responsive family protein s... 36 0.039 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 36 0.039 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 36 0.039 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 36 0.039 At1g07135.1 68414.m00759 glycine-rich protein 36 0.039 At5g51300.2 68418.m06360 splicing factor-related contains simila... 36 0.051 At5g51300.1 68418.m06359 splicing factor-related contains simila... 36 0.051 At5g07510.1 68418.m00860 glycine-rich protein (GRP14) oleosin; g... 36 0.051 At5g02600.2 68418.m00195 heavy-metal-associated domain-containin... 36 0.051 At5g02600.1 68418.m00196 heavy-metal-associated domain-containin... 36 0.051 At4g21720.1 68417.m03145 expressed protein 36 0.051 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 36 0.051 At2g28490.1 68415.m03462 cupin family protein similar to preproM... 36 0.051 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 36 0.051 At1g04930.1 68414.m00490 hydroxyproline-rich glycoprotein family... 36 0.051 At5g65630.1 68418.m08256 DNA-binding bromodomain-containing prot... 35 0.068 At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protei... 35 0.068 At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protei... 35 0.068 At5g52470.1 68418.m06510 fibrillarin 1 (FBR1) (FIB1) (SKIP7) ide... 35 0.068 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 35 0.068 At3g55950.1 68416.m06217 protein kinase family protein contains ... 35 0.068 At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein ... 35 0.068 At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family... 35 0.068 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 35 0.090 At5g25590.1 68418.m03045 expressed protein contains Pfam profile... 35 0.090 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 35 0.090 At4g33520.3 68417.m04762 metal-transporting P-type ATPase, putat... 35 0.090 At4g33520.2 68417.m04761 metal-transporting P-type ATPase, putat... 35 0.090 At4g33520.1 68417.m04760 metal-transporting P-type ATPase, putat... 35 0.090 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 35 0.090 At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / he... 35 0.090 At3g24550.1 68416.m03083 protein kinase family protein contains ... 35 0.090 At3g24250.1 68416.m03044 glycine-rich protein 35 0.090 At3g05920.1 68416.m00668 heavy-metal-associated domain-containin... 35 0.090 At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ b... 35 0.090 At2g11005.1 68415.m01177 glycine-rich protein 35 0.090 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 35 0.090 At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin fa... 35 0.090 At3g05470.1 68416.m00599 formin homology 2 domain-containing pro... 28 0.099 At5g61660.1 68418.m07736 glycine-rich protein 34 0.12 At5g33390.1 68418.m03985 glycine-rich protein similar to nuclear... 34 0.12 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 34 0.12 At5g07190.1 68418.m00819 embryo-specific protein 3, putative sim... 34 0.12 At4g32340.1 68417.m04603 expressed protein 34 0.12 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 34 0.12 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 34 0.12 At3g43583.1 68416.m04636 hypothetical protein 34 0.12 At2g05510.1 68415.m00583 glycine-rich protein 34 0.12 At1g80130.1 68414.m09379 expressed protein 34 0.12 At1g69440.1 68414.m07979 PAZ domain-containing protein / piwi do... 34 0.12 At1g02710.1 68414.m00222 glycine-rich protein 34 0.12 At5g43770.1 68418.m05353 proline-rich family protein contains pr... 34 0.16 At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ... 34 0.16 At4g03390.1 68417.m00461 leucine-rich repeat transmembrane prote... 34 0.16 At3g46740.1 68416.m05074 chloroplast outer envelope protein, put... 34 0.16 At3g18360.1 68416.m02335 VQ motif-containing protein contains PF... 34 0.16 At2g35920.1 68415.m04409 helicase domain-containing protein simi... 34 0.16 At2g05380.1 68415.m00566 glycine-rich protein (GRP3S) identical ... 34 0.16 At1g54060.1 68414.m06160 expressed protein similar to 6b-interac... 34 0.16 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 34 0.16 At1g11850.1 68414.m01363 expressed protein 34 0.16 At5g66960.1 68418.m08442 prolyl oligopeptidase family protein si... 33 0.21 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 33 0.21 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 33 0.21 At4g37900.1 68417.m05360 glycine-rich protein 33 0.21 At4g29020.1 68417.m04149 glycine-rich protein supporting cDNA gi... 33 0.21 At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containi... 33 0.21 At3g55790.1 68416.m06199 expressed protein predicted protein, Ar... 33 0.21 At3g06130.1 68416.m00704 heavy-metal-associated domain-containin... 33 0.21 At2g05540.1 68415.m00586 glycine-rich protein 33 0.21 At5g59950.3 68418.m07518 RNA and export factor-binding protein, ... 33 0.27 At5g59950.2 68418.m07519 RNA and export factor-binding protein, ... 33 0.27 At5g59950.1 68418.m07517 RNA and export factor-binding protein, ... 33 0.27 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 33 0.27 At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family... 33 0.27 At4g38770.1 68417.m05490 proline-rich family protein (PRP4) simi... 33 0.27 At4g12470.1 68417.m01972 protease inhibitor/seed storage/lipid t... 33 0.27 At3g15000.1 68416.m01897 expressed protein similar to DAG protei... 33 0.27 At2g26410.1 68415.m03169 calmodulin-binding family protein simil... 33 0.27 At2g05530.1 68415.m00585 glycine-rich protein 33 0.27 At1g77030.1 68414.m08970 glycine-rich protein 33 0.27 At1g68390.1 68414.m07813 expressed protein contains Pfam profile... 33 0.27 At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family... 33 0.27 At1g35617.1 68414.m04424 hypothetical protein 33 0.27 At5g66400.1 68418.m08374 dehydrin (RAB18) nearly identical to SP... 33 0.36 At5g62440.1 68418.m07837 expressed protein 33 0.36 At5g14540.1 68418.m01704 proline-rich family protein contains pr... 33 0.36 At5g07650.1 68418.m00876 formin homology 2 domain-containing pro... 33 0.36 At4g16830.1 68417.m02540 nuclear RNA-binding protein (RGGA) iden... 33 0.36 At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) ... 33 0.36 At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) ... 33 0.36 At3g45540.1 68416.m04918 zinc finger (C3HC4-type RING finger) fa... 33 0.36 At2g04190.1 68415.m00404 meprin and TRAF homology domain-contain... 33 0.36 At1g35880.1 68414.m04457 hypothetical protein 33 0.36 At5g60850.1 68418.m07633 Dof-type zinc finger domain-containing ... 32 0.48 At5g04290.1 68418.m00422 KOW domain-containing transcription fac... 32 0.48 At4g29240.1 68417.m04182 leucine-rich repeat family protein / ex... 32 0.48 At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibri... 32 0.48 At3g46270.1 68416.m05008 receptor protein kinase-related contain... 32 0.48 At1g47660.1 68414.m05295 hypothetical protein 32 0.48 At1g19950.1 68414.m02500 abscisic acid-responsive HVA22 family p... 32 0.48 At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp... 32 0.48 At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family... 32 0.48 At5g48360.1 68418.m05975 formin homology 2 domain-containing pro... 32 0.63 At4g14750.1 68417.m02270 calmodulin-binding family protein conta... 32 0.63 At3g50130.1 68416.m05480 expressed protein ; expression supporte... 32 0.63 At3g44950.1 68416.m04843 glycine-rich protein 32 0.63 At3g22330.1 68416.m02820 DEAD box RNA helicase, putative similar... 32 0.63 At3g04640.1 68416.m00497 glycine-rich protein predicted proteins... 32 0.63 At2g24590.1 68415.m02936 splicing factor, putative similar to to... 32 0.63 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 32 0.63 At1g52030.2 68414.m05870 myrosinase-binding protein, putative (F... 32 0.63 At1g52030.1 68414.m05869 myrosinase-binding protein, putative (F... 32 0.63 At1g31750.1 68414.m03895 proline-rich family protein contains pr... 32 0.63 At1g04660.1 68414.m00463 glycine-rich protein 32 0.63 At5g62190.1 68418.m07807 DEAD box RNA helicase (PRH75) nearly id... 31 0.84 At5g57290.1 68418.m07157 60S acidic ribosomal protein P3 (RPP3B) 31 0.84 At5g15870.1 68418.m01857 glycosyl hydrolase family 81 protein si... 31 0.84 At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identica... 31 0.84 At4g34440.1 68417.m04894 protein kinase family protein contains ... 31 0.84 At4g34150.1 68417.m04846 C2 domain-containing protein similar to... 31 0.84 At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-l... 31 0.84 At4g17800.1 68417.m02656 DNA-binding protein-related contains Pf... 31 0.84 At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family... 31 0.84 At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar... 31 0.84 At3g11402.1 68416.m01388 DC1 domain-containing protein contains ... 31 0.84 At3g07195.1 68416.m00858 proline-rich family protein 31 0.84 At1g63600.1 68414.m07189 protein kinase-related low similarity t... 31 0.84 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 31 0.84 At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR... 31 0.84 At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR... 31 0.84 At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR... 31 0.84 At2g41260.2 68415.m05096 glycine-rich protein / late embryogenes... 27 0.87 At2g41260.1 68415.m05095 glycine-rich protein / late embryogenes... 27 0.89 At1g27090.1 68414.m03302 glycine-rich protein 26 1.1 At5g22790.1 68418.m02664 expressed protein 31 1.1 At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin fa... 31 1.1 At5g13910.1 68418.m01627 AP2/EREBP-like transcription factor LEA... 31 1.1 At5g11550.1 68418.m01347 expressed protein 31 1.1 At5g07150.1 68418.m00815 leucine-rich repeat family protein cont... 31 1.1 At3g58020.1 68416.m06466 DNAJ heat shock N-terminal domain-conta... 31 1.1 At3g56990.1 68416.m06344 glycine-rich protein conserved hypothet... 31 1.1 At3g46240.1 68416.m05005 protein kinase-related similar to light... 31 1.1 At3g22070.1 68416.m02785 proline-rich family protein contains pr... 31 1.1 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 31 1.1 At3g01430.1 68416.m00066 expressed protein 31 1.1 At2g30505.1 68415.m03716 Expressed protein 31 1.1 At2g02070.1 68415.m00143 zinc finger (C2H2 type) family protein ... 31 1.1 At1g58380.1 68414.m06642 40S ribosomal protein S2 (RPS2A) simila... 31 1.1 At1g35830.1 68414.m04452 VQ motif-containing protein contains PF... 31 1.1 At1g32360.1 68414.m03989 zinc finger (CCCH-type) family protein ... 31 1.1 At1g15840.1 68414.m01901 expressed protein 31 1.1 At5g45300.1 68418.m05561 glycosyl hydrolase family 14 protein si... 31 1.5 At5g20130.1 68418.m02396 expressed protein 31 1.5 At5g13760.1 68418.m01604 expressed protein similar to unknown pr... 31 1.5 At4g15460.1 68417.m02363 glycine-rich protein 31 1.5 At3g49300.1 68416.m05388 proline-rich family protein contains pr... 31 1.5 At3g43520.1 68416.m04614 expressed protein contains Pfam profile... 31 1.5 At3g18810.1 68416.m02389 protein kinase family protein contains ... 31 1.5 At3g01560.1 68416.m00086 proline-rich family protein contains pr... 31 1.5 At2g43150.1 68415.m05358 proline-rich extensin-like family prote... 31 1.5 At1g70250.1 68414.m08082 receptor serine/threonine kinase, putat... 31 1.5 At1g62510.1 68414.m07053 protease inhibitor/seed storage/lipid t... 31 1.5 At1g27880.1 68414.m03416 ATP-dependent DNA helicase, putative si... 31 1.5 At1g26240.1 68414.m03201 proline-rich extensin-like family prote... 31 1.5 At1g17790.1 68414.m02202 DNA-binding bromodomain-containing prot... 31 1.5 At1g12380.1 68414.m01431 expressed protein 31 1.5 At1g02460.1 68414.m00195 glycoside hydrolase family 28 protein /... 31 1.5 At5g67060.1 68418.m08455 basic helix-loop-helix (bHLH) family pr... 30 1.9 At5g35190.1 68418.m04170 proline-rich extensin-like family prote... 30 1.9 At5g25425.1 68418.m03017 glycine-rich protein 30 1.9 At5g12470.1 68418.m01465 expressed protein 30 1.9 At5g11990.1 68418.m01402 proline-rich family protein contains pr... 30 1.9 At4g21620.1 68417.m03134 glycine-rich protein 30 1.9 At4g08370.1 68417.m01382 proline-rich extensin-like family prote... 30 1.9 At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative stro... 30 1.9 At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) s... 30 1.9 At3g06780.1 68416.m00805 glycine-rich protein 30 1.9 At2g41500.1 68415.m05127 WD-40 repeat family protein / small nuc... 30 1.9 At2g35270.1 68415.m04326 DNA-binding protein-related contains Pf... 30 1.9 At2g24060.1 68415.m02874 translation initiation factor 3 (IF-3) ... 30 1.9 At2g23770.1 68415.m02839 protein kinase family protein / peptido... 30 1.9 At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to... 30 1.9 At1g59359.1 68414.m06677 40S ribosomal protein S2 (RPS2B) simila... 30 1.9 At1g58983.1 68414.m06666 40S ribosomal protein S2, putative simi... 30 1.9 At1g58684.1 68414.m06657 40S ribosomal protein S2, putative 30 1.9 At1g55540.1 68414.m06356 proline-rich family protein contains pr... 30 1.9 At1g30780.1 68414.m03763 F-box family protein 30 1.9 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 30 1.9 At1g20120.1 68414.m02517 family II extracellular lipase, putativ... 30 1.9 At1g19960.1 68414.m02501 expressed protein 30 1.9 At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family... 30 2.6 At5g25550.1 68418.m03040 leucine-rich repeat family protein / ex... 30 2.6 At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp... 30 2.6 At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp... 30 2.6 At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp... 30 2.6 At4g11870.1 68417.m01888 hypothetical protein 30 2.6 At3g09770.2 68416.m01158 zinc finger (C3HC4-type RING finger) fa... 30 2.6 At3g09770.1 68416.m01157 zinc finger (C3HC4-type RING finger) fa... 30 2.6 At3g07540.1 68416.m00900 formin homology 2 domain-containing pro... 30 2.6 At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) fa... 30 2.6 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 30 2.6 At1g36675.1 68414.m04563 glycine-rich protein 30 2.6 At3g50870.1 68416.m05570 zinc finger (GATA type) family protein ... 25 3.2 At5g60980.2 68418.m07650 nuclear transport factor 2 (NTF2) famil... 29 3.4 At5g60980.1 68418.m07649 nuclear transport factor 2 (NTF2) famil... 29 3.4 At5g49080.1 68418.m06074 proline-rich extensin-like family prote... 29 3.4 At5g37790.1 68418.m04551 protein kinase family protein contains ... 29 3.4 At5g37720.1 68418.m04541 RNA and export factor-binding protein, ... 29 3.4 At5g22560.1 68418.m02635 hypothetical protein contains Pfam prof... 29 3.4 At5g17760.2 68418.m02083 AAA-type ATPase family protein contains... 29 3.4 At5g17760.1 68418.m02082 AAA-type ATPase family protein contains... 29 3.4 At5g03380.1 68418.m00291 heavy-metal-associated domain-containin... 29 3.4 At5g01170.1 68418.m00021 glycine-rich protein predicted proteins... 29 3.4 At4g39680.1 68417.m05614 SAP domain-containing protein contains ... 29 3.4 At4g35610.1 68417.m05058 zinc finger (C2H2 type) family protein ... 29 3.4 At4g26480.1 68417.m03810 KH domain-containing protein qkI-7, Mus... 29 3.4 At4g23140.2 68417.m03338 receptor-like protein kinase 5 (RLK5) i... 29 3.4 At4g23140.1 68417.m03337 receptor-like protein kinase 5 (RLK5) i... 29 3.4 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 29 3.4 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 29 3.4 At4g19920.1 68417.m02918 disease resistance protein (TIR class),... 29 3.4 At4g12480.1 68417.m01973 protease inhibitor/seed storage/lipid t... 29 3.4 At4g08380.1 68417.m01384 proline-rich extensin-like family prote... 29 3.4 At3g51770.1 68416.m05677 tetratricopeptide repeat (TPR)-containi... 29 3.4 At3g23750.1 68416.m02986 leucine-rich repeat family protein / pr... 29 3.4 At3g21215.1 68416.m02681 RNA-binding protein, putative contains ... 29 3.4 At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PL... 29 3.4 At2g37860.2 68415.m04648 expressed protein 29 3.4 At2g37860.1 68415.m04647 expressed protein 29 3.4 At2g28500.1 68415.m03463 LOB domain protein 11 / lateral organ b... 29 3.4 At2g25050.1 68415.m02996 formin homology 2 domain-containing pro... 29 3.4 At1g49270.1 68414.m05524 protein kinase family protein contains ... 29 3.4 At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp... 29 3.4 At3g29060.1 68416.m03635 EXS family protein / ERD1/XPR1/SYG1 fam... 25 3.8 At5g59170.1 68418.m07416 proline-rich family protein contains pr... 29 4.5 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 29 4.5 At5g28480.1 68418.m03462 hypothetical protein 29 4.5 At5g25220.1 68418.m02990 homeobox protein knotted-1 like 3 (KNAT... 29 4.5 At5g07530.1 68418.m00862 glycine-rich protein (GRP17) olesin; gl... 29 4.5 At4g35230.1 68417.m05007 protein kinase family protein contains ... 29 4.5 At4g17940.1 68417.m02672 expressed protein 29 4.5 At4g08400.1 68417.m01388 proline-rich extensin-like family prote... 29 4.5 At3g28550.1 68416.m03565 proline-rich extensin-like family prote... 29 4.5 At3g04930.1 68416.m00535 expressed protein contains Pfam profil... 29 4.5 At3g03776.1 68416.m00385 hydroxyproline-rich glycoprotein family... 29 4.5 At3g01650.1 68416.m00096 copine-related low similarity to SP|Q99... 29 4.5 At2g32710.2 68415.m04003 kip-related protein 4 (KRP4) / cyclin-d... 29 4.5 At2g32710.1 68415.m04002 kip-related protein 4 (KRP4) / cyclin-d... 29 4.5 At2g32080.2 68415.m03921 PUR alpha-1 protein identical to PUR al... 29 4.5 At2g32080.1 68415.m03920 PUR alpha-1 protein identical to PUR al... 29 4.5 At2g27660.1 68415.m03352 DC1 domain-containing protein contains ... 29 4.5 At2g24980.1 68415.m02987 proline-rich extensin-like family prote... 29 4.5 At2g24450.1 68415.m02922 fasciclin-like arabinogalactan family p... 29 4.5 At2g22660.1 68415.m02685 glycine-rich protein 29 4.5 At2g18470.1 68415.m02151 protein kinase family protein contains ... 29 4.5 At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putat... 29 4.5 At2g12100.1 68415.m01300 Ulp1 protease family protein contains P... 29 4.5 At1g72600.1 68414.m08395 hydroxyproline-rich glycoprotein family... 29 4.5 At1g67035.1 68414.m07623 expressed protein ; expression supporte... 29 4.5 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 29 4.5 At1g51580.1 68414.m05806 KH domain-containing protein 29 4.5 At1g48100.1 68414.m05368 glycoside hydrolase family 28 protein /... 29 4.5 At1g45090.1 68414.m05169 Ulp1 protease family protein similar to... 29 4.5 At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identica... 29 4.5 At1g31290.1 68414.m03829 PAZ domain-containing protein / piwi do... 29 4.5 At1g23540.1 68414.m02960 protein kinase family protein contains ... 29 4.5 At1g13920.1 68414.m01633 remorin family protein contains Pfam do... 29 4.5 At1g07310.1 68414.m00778 C2 domain-containing protein contains s... 29 4.5 At5g08530.1 68418.m01013 NADH-ubiquinone oxidoreductase 51 kDa s... 25 5.2 At5g62820.1 68418.m07885 integral membrane protein, putative MtN... 29 5.9 At5g41460.1 68418.m05035 fringe-related protein strong similarit... 29 5.9 At4g01120.1 68417.m00150 G-box binding factor 2 (GBF2) identical... 29 5.9 At3g59640.1 68416.m06654 glycine-rich protein 29 5.9 At3g45890.1 68416.m04966 expressed protein contains Pfam domain,... 29 5.9 At3g28180.1 68416.m03521 glycosyl transferase family 2 protein s... 29 5.9 At3g19090.1 68416.m02426 RNA-binding protein, putative similar t... 29 5.9 At3g07100.1 68416.m00845 protein transport protein Sec24, putati... 29 5.9 At2g39250.1 68415.m04820 AP2 domain-containing transcription fac... 29 5.9 At2g36010.3 68415.m04422 E2F transcription factor-3 (E2F3) ident... 29 5.9 At2g36010.2 68415.m04421 E2F transcription factor-3 (E2F3) ident... 29 5.9 At2g36010.1 68415.m04420 E2F transcription factor-3 (E2F3) ident... 29 5.9 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 29 5.9 At2g16630.1 68415.m01909 proline-rich family protein contains pr... 29 5.9 At1g79480.1 68414.m09263 hypothetical protein low similarity to ... 29 5.9 At1g63570.1 68414.m07186 receptor-like protein kinase-related co... 29 5.9 At1g31280.1 68414.m03828 PAZ domain-containing protein / piwi do... 29 5.9 At1g21170.1 68414.m02647 expressed protein 29 5.9 At1g20110.1 68414.m02516 zinc finger (FYVE type) family protein ... 29 5.9 At3g05220.1 68416.m00569 heavy-metal-associated domain-containin... 24 6.6 At2g17870.1 68415.m02070 cold-shock DNA-binding family protein c... 25 7.0 At5g64290.1 68418.m08076 oxoglutarate/malate translocator, putat... 28 7.8 At5g63120.2 68418.m07924 ethylene-responsive DEAD box RNA helica... 28 7.8 At5g63120.1 68418.m07925 ethylene-responsive DEAD box RNA helica... 28 7.8 At5g62760.2 68418.m07879 nuclear protein ZAP-related similar to ... 28 7.8 At5g62760.1 68418.m07878 nuclear protein ZAP-related similar to ... 28 7.8 At5g52060.1 68418.m06462 BAG domain-containing protein contains ... 28 7.8 At5g25420.1 68418.m03016 xanthine/uracil permease family protein... 28 7.8 At5g21160.1 68418.m02528 La domain-containing protein / proline-... 28 7.8 At5g20190.1 68418.m02405 expressed protein 28 7.8 At5g11930.1 68418.m01395 glutaredoxin family protein contains IN... 28 7.8 At5g07540.2 68418.m00864 glycine-rich protein (GRP16) oleosin; g... 28 7.8 At5g06640.1 68418.m00750 proline-rich extensin-like family prote... 28 7.8 At5g06630.1 68418.m00749 proline-rich extensin-like family prote... 28 7.8 At5g02530.1 68418.m00187 RNA and export factor-binding protein, ... 28 7.8 At4g13390.1 68417.m02092 proline-rich extensin-like family prote... 28 7.8 At4g12880.1 68417.m02016 plastocyanin-like domain-containing pro... 28 7.8 At4g08410.1 68417.m01390 proline-rich extensin-like family prote... 28 7.8 At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacy... 28 7.8 At3g57670.1 68416.m06425 zinc finger (C2H2 type) protein (WIP2) ... 28 7.8 At3g54590.1 68416.m06040 proline-rich extensin-like family prote... 28 7.8 At3g54580.1 68416.m06039 proline-rich extensin-like family prote... 28 7.8 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 28 7.8 At3g53330.1 68416.m05884 plastocyanin-like domain-containing pro... 28 7.8 At3g19070.1 68416.m02422 cell wall protein-related similar to ve... 28 7.8 At3g15400.1 68416.m01954 anther development protein, putative si... 28 7.8 At3g11820.2 68416.m01448 syntaxin 121 (SYP121) / syntaxin-relate... 28 7.8 At3g11820.1 68416.m01449 syntaxin 121 (SYP121) / syntaxin-relate... 28 7.8 At3g04460.1 68416.m00473 Pex2/Pex12 N-terminal domain-containing... 28 7.8 At2g28670.1 68415.m03485 disease resistance-responsive family pr... 28 7.8 At2g18790.1 68415.m02187 phytochrome B (PHYB) Identical to SP|P1... 28 7.8 At1g73090.1 68414.m08451 expressed protein 28 7.8 At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 28 7.8 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 28 7.8 At1g70470.1 68414.m08108 expressed protein 28 7.8 At1g63550.1 68414.m07184 hypothetical protein low similarity to ... 28 7.8 At1g50300.1 68414.m05639 zinc finger (Ran-binding) family protei... 28 7.8 At1g48410.2 68414.m05409 argonaute protein (AGO1) identical to S... 28 7.8 At1g48410.1 68414.m05408 argonaute protein (AGO1) identical to S... 28 7.8 At1g30475.1 68414.m03725 expressed protein 28 7.8 At1g28000.1 68414.m03429 hypothetical protein 28 7.8 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 54.4 bits (125), Expect = 1e-07 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP PPP PP PPPP Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 53.6 bits (123), Expect = 2e-07 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP PPP PP PPPP Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 53.6 bits (123), Expect = 2e-07 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP PPP PP PPPP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 53.6 bits (123), Expect = 2e-07 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP PPP PP PPPP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 50.8 bits (116), Expect = 1e-06 Identities = 18/27 (66%), Positives = 18/27 (66%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PP PPP PPP PPP PP PPPP Sbjct: 373 GCSPPSPPPPPPPPPPPPPPPPPPPPP 399 Score = 47.6 bits (108), Expect = 1e-05 Identities = 19/31 (61%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPP---XXPPPP 941 P PPP PPP PPP PPP PP PPPP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPP 416 Score = 45.6 bits (103), Expect = 5e-05 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP PP P PPPP Sbjct: 390 PPPPPPPPPPPPPPPPPPYVYPSPPPPP 417 Score = 43.2 bits (97), Expect = 3e-04 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = +1 Query: 784 FXWXPPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 F PPSPP P PP P P P P P PP P P PPP Sbjct: 372 FGCSPPSPPPPPPPPPPPPPPP-------PPPPPPPPPPPPPPYVYPSPPP 415 Score = 43.2 bits (97), Expect = 3e-04 Identities = 18/32 (56%), Positives = 18/32 (56%), Gaps = 5/32 (15%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXP-----PPXPPXXPPP 938 P PPP PPP PPP P PP PP PPP Sbjct: 391 PPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 42.7 bits (96), Expect = 3e-04 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP P PP PP P Sbjct: 393 PPPPPPPPPPPPPPPYVYPSPPPPPPSP 420 Score = 40.7 bits (91), Expect = 0.001 Identities = 24/68 (35%), Positives = 25/68 (36%), Gaps = 2/68 (2%) Frame = +3 Query: 744 GSXPXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPX--PPPX 917 G P +PP P P V P PP PPP PPP PPP Sbjct: 373 GCSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPS---PPPPPPSPPPYVYPPPP 429 Query: 918 PPXXPPPP 941 PP PPP Sbjct: 430 PPYVYPPP 437 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P PP P P P P PP P P PPP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPP 428 Score = 37.9 bits (84), Expect = 0.010 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P PP P P P P PP P PPP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPP 430 Score = 37.1 bits (82), Expect = 0.017 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P PSP + P P PP P P PPP Sbjct: 403 PPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPP 449 Score = 37.1 bits (82), Expect = 0.017 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP PP P P + P P PP P P P P Sbjct: 413 PPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSP 459 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PP PP P P PPPP Sbjct: 422 PYVYPPPPPPYVYPPPPSPPYVYPPPPP 449 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPPX--PPPXPPPXPPXXPPPP 941 P PPP PP PPP P P P P PP Sbjct: 431 PYVYPPPPSPPYVYPPPPPSPQPYMYPSPP 460 Score = 28.7 bits (61), Expect = 5.9 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +3 Query: 852 VLPGXXPPPXPPPXP-PPXPPPXPPXXPPP 938 V P PP PP P PP P PP P P Sbjct: 424 VYPPPPPPYVYPPPPSPPYVYPPPPPSPQP 453 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 49.6 bits (113), Expect = 3e-06 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 PPP PPP PPP PPP PP PPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPP 64 Score = 49.6 bits (113), Expect = 3e-06 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP PPP PPP PPP PP PPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPP 64 Score = 47.2 bits (107), Expect = 2e-05 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P PPP PPP PPP PP PPPP Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPP 62 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/47 (31%), Positives = 17/47 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P PP P P ++ P PP PPP Sbjct: 47 PPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPP 93 Score = 33.5 bits (73), Expect = 0.21 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PP PPPP Sbjct: 51 PPPPPPPPPPPPPPAVNMSVETGIPPPP 78 Score = 31.9 bits (69), Expect = 0.63 Identities = 19/69 (27%), Positives = 23/69 (33%), Gaps = 6/69 (8%) Frame = +3 Query: 753 PXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPPXPP--- 923 P PP P P ++ ++ PP P P P PPP PP Sbjct: 51 PPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPRSQPPPKPPQKN 110 Query: 924 ---XXPPPP 941 PPPP Sbjct: 111 LPRRHPPPP 119 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PP P P PP P P Sbjct: 98 PRSQPPPKPPQKNLPRRHPPPPRSPEKP 125 Score = 28.7 bits (61), Expect = 5.9 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +1 Query: 784 FXWXPPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 F PP PP P PP P P P P P PP PPP Sbjct: 38 FPQSPPPPPPPPPPP----PPP-------PPPPPPPPPAVNMSVETGIPPP 77 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 47.2 bits (107), Expect = 2e-05 Identities = 18/26 (69%), Positives = 18/26 (69%), Gaps = 2/26 (7%) Frame = +3 Query: 870 PPPXPPPXPPP--XPPPXPPXXPPPP 941 PPP PPP PPP PPP PP PPPP Sbjct: 452 PPPPPPPPPPPVYSPPPPPPPPPPPP 477 Score = 47.2 bits (107), Expect = 2e-05 Identities = 18/26 (69%), Positives = 18/26 (69%), Gaps = 2/26 (7%) Frame = +3 Query: 870 PPPXPPPXPPP--XPPPXPPXXPPPP 941 PPP PPP PPP PPP PP PPPP Sbjct: 483 PPPSPPPPPPPVYSPPPPPPPPPPPP 508 Score = 46.4 bits (105), Expect = 3e-05 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PP PP PP PPPP Sbjct: 434 PVYSPPPPPPPPPPVYSPPPPPPPPPPP 461 Score = 45.2 bits (102), Expect = 6e-05 Identities = 18/30 (60%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXPPP--XPPPXPPXXPPPP 941 P PP PPP PPP PPP PP PPPP Sbjct: 433 PPVYSPPPPPPPPPPVYSPPPPPPPPPPPP 462 Score = 45.2 bits (102), Expect = 6e-05 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP P PP PPPP Sbjct: 468 PPPPPPPPPPPVYSPPPPSPPPPP 491 Score = 44.8 bits (101), Expect = 8e-05 Identities = 18/30 (60%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPX--PPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP PPP P PPPP Sbjct: 456 PPPPPPPVYSPPPPPPPPPPPPPVYSPPPP 485 Score = 44.8 bits (101), Expect = 8e-05 Identities = 18/31 (58%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXP---PPXPPPXPPPXPPXXPPPP 941 P PPP P PP PPP PPP P PPPP Sbjct: 485 PSPPPPPPPVYSPPPPPPPPPPPPVYSPPPP 515 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/31 (58%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPP---PXPPPXPPPXPPXXPPPP 941 P PPP PP P PPP PPP PP PPP Sbjct: 438 PPPPPPPPPPVYSPPPPPPPPPPPPVYSPPP 468 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/31 (58%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXP---PPXPPPXPPPXPPXXPPPP 941 P PPP P PP PPP PPP PP PPP Sbjct: 454 PPPPPPPPPVYSPPPPPPPPPPPPPVYSPPP 484 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/31 (58%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPP---PXPPPXPPPXPPXXPPPP 941 P PPP PP P PPP PPP PP PPP Sbjct: 484 PPSPPPPPPPVYSPPPPPPPPPPPPVYSPPP 514 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/31 (58%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXP---PPXPPPXPPPXPPXXPPPP 941 P PPP P PP PPP PPP P PPPP Sbjct: 439 PPPPPPPPPVYSPPPPPPPPPPPPVYSPPPP 469 Score = 43.2 bits (97), Expect = 3e-04 Identities = 17/27 (62%), Positives = 17/27 (62%), Gaps = 3/27 (11%) Frame = +3 Query: 870 PPPXPPPX---PPPXPPPXPPXXPPPP 941 PPP PPP PPP PPP PP PPP Sbjct: 427 PPPSPPPPVYSPPPPPPPPPPVYSPPP 453 Score = 42.7 bits (96), Expect = 3e-04 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP P PPP P PPPP Sbjct: 466 PPPPPPPPPPPPPVYSPPPPSPPPPPPP 493 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/30 (56%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPP--XPPXXPPPP 941 P PP PP PPP PPP PP PPPP Sbjct: 429 PSPPPPVYSPPPPPPPPPPVYSPPPPPPPP 458 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/33 (57%), Positives = 19/33 (57%), Gaps = 5/33 (15%) Frame = +3 Query: 858 PGXXPPPX--PPPXPPPXPPP---XPPXXPPPP 941 P PPP PPP PPP PPP PP PPPP Sbjct: 441 PPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPP 473 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PP PP PPP PP PPPP Sbjct: 453 PPPPPPPPPPVYSPPPPPPPPP--PPPP 478 Score = 41.9 bits (94), Expect = 6e-04 Identities = 27/99 (27%), Positives = 30/99 (30%) Frame = +1 Query: 643 SAPPXPFXAPXTPAXTLNPHTXXXXXXXXXXXXXXXXXXXXXXPXSXFXWXPPSPPXPXP 822 S PP P P P +P P + PP PP P P Sbjct: 450 SPPPPP--PPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPP 507 Query: 823 PXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 P P P +S P P P P P PPPH Sbjct: 508 PVYSPPPPPVYS---SPPPPPSPAPTPVYCTRPPPPPPH 543 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPP---PXPPPXPPPXPPXXPPPP 941 P PPP PP P PP PPP PP PPP Sbjct: 469 PPPPPPPPPPVYSPPPPSPPPPPPPVYSPPP 499 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXP---PPXPPXXPPPP 941 P PP P P PPP P PP PP PPPP Sbjct: 477 PPVYSPPPPSPPPPPPPVYSPPPPPPPPPPP 507 Score = 40.7 bits (91), Expect = 0.001 Identities = 27/99 (27%), Positives = 30/99 (30%), Gaps = 3/99 (3%) Frame = +1 Query: 649 PPXPFXAPXTPAXTLN-PHTXXXXXXXXXXXXXXXXXXXXXXPXSXFXWXPPSPPXPXPP 825 PP +P PA + P T P + PP PP P PP Sbjct: 403 PPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPP 462 Query: 826 XXXXXPSPXFSLXXXP--XPXPXXPPXPXXPXTXXXPPP 936 P P P P P PP P P PPP Sbjct: 463 VYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPP 501 Score = 40.7 bits (91), Expect = 0.001 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXP---PPXPPPXPPPXPPXXPPPP 941 P PPP P PP P P PPP P PPPP Sbjct: 470 PPPPPPPPPVYSPPPPSPPPPPPPVYSPPPP 500 Score = 39.1 bits (87), Expect = 0.004 Identities = 18/33 (54%), Positives = 18/33 (54%), Gaps = 5/33 (15%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXP---PPXPP--XXPPPP 941 P PP PPP PPP P PP PP PPPP Sbjct: 492 PPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPP 524 Score = 39.1 bits (87), Expect = 0.004 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP P PPP PPPP Sbjct: 498 PPPPPPPPPPPVYSPPPPPVYSSPPPPP 525 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/28 (57%), Positives = 16/28 (57%), Gaps = 4/28 (14%) Frame = +3 Query: 870 PPPXPPPXPPPX----PPPXPPXXPPPP 941 PPP P P P P PPP PP PPPP Sbjct: 521 PPPPPSPAPTPVYCTRPPPPPPHSPPPP 548 Score = 38.7 bits (86), Expect = 0.006 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PP PP PPP PPPP Sbjct: 605 PVYSPPPPPPCIEPPPPPPCIEYSPPPP 632 Score = 37.9 bits (84), Expect = 0.010 Identities = 27/100 (27%), Positives = 28/100 (28%), Gaps = 2/100 (2%) Frame = +1 Query: 643 SAPPXPFXAPXTPAXTLNPHTXXXXXXXXXXXXXXXXXXXXXXPXSXFXWXPP--SPPXP 816 S PP P P P + P P PP SPP P Sbjct: 496 SPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPP 555 Query: 817 XPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P P P S P P PP P P PPP Sbjct: 556 EPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPP 595 Score = 37.5 bits (83), Expect = 0.013 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PP P P PP PP PP PPP Sbjct: 421 PTLTSPPPPSPPPPVYSPPPPPPPPPP 447 Score = 36.7 bits (81), Expect = 0.022 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P PP PPP P PP PPPP Sbjct: 420 PPTLTSPPPPSPPPPVYSPPPPPPPPPP 447 Score = 36.3 bits (80), Expect = 0.029 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 5/33 (15%) Frame = +3 Query: 858 PGXXPPPXP-----PPXPPPXPPPXPPXXPPPP 941 P P P P PP PPP PP P PPPP Sbjct: 523 PPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPP 555 Score = 36.3 bits (80), Expect = 0.029 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PP P PPP P PPP Sbjct: 566 PHSSPPPHSPPPPHSPPPPIYPYLSPPP 593 Score = 36.3 bits (80), Expect = 0.029 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPPP 941 P PPP P PPP P PPPP Sbjct: 591 PPPPPTPVSSPPPTPVYSPPPP 612 Score = 35.9 bits (79), Expect = 0.039 Identities = 17/45 (37%), Positives = 19/45 (42%) Frame = +1 Query: 802 SPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 SPP P P P+P +S P P P P P P PPP Sbjct: 590 SPPPPPTPVSSPPPTPVYS---PPPPPPCIEPPPPPPCIEYSPPP 631 Score = 35.9 bits (79), Expect = 0.039 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P PPP P PPP PP PPP Sbjct: 593 PPPTPVSSPPPTPVYSPPPPPPCIEPPP 620 Score = 35.5 bits (78), Expect = 0.051 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP P PPP PP PP PPPP Sbjct: 563 PPPPHSSPPPHSPP-PPHSPPPP 584 Score = 35.5 bits (78), Expect = 0.051 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP P PPP PP P PPP Sbjct: 597 PVSSPPPTPVYSPPPPPPCIEPPPPPP 623 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = +1 Query: 796 PPSPPXPXPPXXXXX-PSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP P P PP P P + P P P P P P PPP Sbjct: 575 PPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPP 622 Score = 33.5 bits (73), Expect = 0.21 Identities = 26/107 (24%), Positives = 29/107 (27%), Gaps = 9/107 (8%) Frame = +1 Query: 643 SAPPXPFXAPXTPAXTLNPHTXXXXXXXXXXXXXXXXXXXXXXPXSXFXWXPPSPPX--- 813 S PP P +P P + P P + PP PP Sbjct: 600 SPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYS 659 Query: 814 ---PXPPXXXXXPSPXFSLXXXPXPXP---XXPPXPXXPXTXXXPPP 936 P PP P P P P P PP P PPP Sbjct: 660 SPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEESPPP 706 Score = 33.1 bits (72), Expect = 0.27 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 5/32 (15%) Frame = +3 Query: 858 PGXXPPPXPPPXP-----PPXPPPXPPXXPPP 938 P PPP PP P P PPP P PPP Sbjct: 572 PHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPP 603 Score = 32.7 bits (71), Expect = 0.36 Identities = 18/50 (36%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = +1 Query: 796 PP--SPPXPXPPXXXXXPSPXFS-LXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP SPP PP P P + L P P P P P + PPP Sbjct: 565 PPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPP 614 Score = 32.7 bits (71), Expect = 0.36 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 11/35 (31%) Frame = +3 Query: 870 PPPXP---PPXPPP----XPPPXPP----XXPPPP 941 PPP P PP PPP PPP PP PPPP Sbjct: 610 PPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPP 644 Score = 32.3 bits (70), Expect = 0.48 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = +1 Query: 796 PPSPPXPXP-PXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 PP PP P P P P P P P PP P PPPH Sbjct: 521 PPPPPSPAPTPVYCTRPPPP--PPHSPPPPQFSPPPPEPYYYSSPPPPH 567 Score = 31.5 bits (68), Expect = 0.84 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 8/32 (25%) Frame = +3 Query: 870 PPPXPPPXPPPXP----PPX----PPXXPPPP 941 PPP P PPP P PP PP PPPP Sbjct: 403 PPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPP 434 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPP---PXPPPXPPPXPPXXPPPP 941 P PPP P PPP PP PPPP Sbjct: 548 PQFSPPPPEPYYYSSPPPPHSSPPPHSPPPP 578 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPP--PXPPPXPPPXPPPXPPXXPPPP 941 P PP P PP PP P P PPPP Sbjct: 537 PPPPPPHSPPPPQFSPPPPEPYYYSSPPPP 566 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 9/37 (24%) Frame = +3 Query: 858 PGXXPPPXPPP---------XPPPXPPPXPPXXPPPP 941 P PP P P PPP PP P PPPP Sbjct: 405 PSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPP 441 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P PPP PPPP Sbjct: 641 PPPPPVYYSSPPPPPVYYSSPPPP 664 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 9/33 (27%) Frame = +3 Query: 870 PPPX----PPPXP-----PPXPPPXPPXXPPPP 941 PPP PPP P PP PPP PPPP Sbjct: 643 PPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPP 675 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/48 (31%), Positives = 16/48 (33%), Gaps = 2/48 (4%) Frame = +1 Query: 799 PSPPX--PXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P PP P PP P P + P PP P PPP Sbjct: 394 PRPPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPP 441 Score = 29.5 bits (63), Expect = 3.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPP 938 P PPP P PPP P PP Sbjct: 401 PLPPPSLPSPPPPAPIFSTPP 421 Score = 29.1 bits (62), Expect = 4.5 Identities = 27/106 (25%), Positives = 32/106 (30%), Gaps = 8/106 (7%) Frame = +1 Query: 643 SAPPXPFXAPXTPAXTLNPHTXXXXXXXXXXXXXXXXXXXXXXPXSXFXWXPPSP---PX 813 S+PP P +P P PH+ P + PP P P Sbjct: 561 SSPPPPHSSPP-PHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPP 619 Query: 814 PXPPXXXXXPSPXFSLXXXPXPXPXX-----PPXPXXPXTXXXPPP 936 P PP P P + P P PP P P PPP Sbjct: 620 PPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPP--PVYYSSPPP 663 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP P PPP P P PP P Sbjct: 570 PPPHSPPPPHSPPPPIYPYLSPPPPPTP 597 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 2/26 (7%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPP--XXPPPP 941 PPP PP PPP P PPPP Sbjct: 629 PPPPPPVVHYSSPPPPPVYYSSPPPP 654 Score = 29.1 bits (62), Expect = 4.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P PPP P PP Sbjct: 682 PPPSPVHYSSPPPPPSAPCEESPP 705 Score = 28.7 bits (61), Expect = 5.9 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 PPP P P PPP P PPP Sbjct: 564 PPPHSSPPPHSPPPPHSP--PPP 584 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 4/27 (14%) Frame = +3 Query: 873 PPXPPPX----PPPXPPPXPPXXPPPP 941 PP PPP PP PP PPPP Sbjct: 629 PPPPPPVVHYSSPPPPPVYYSSPPPPP 655 Score = 28.3 bits (60), Expect = 7.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P P P PPPP Sbjct: 694 PPPSAPCEESPPPAPVVHHSPPPP 717 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 46.8 bits (106), Expect = 2e-05 Identities = 17/30 (56%), Positives = 18/30 (60%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 + P PPP PP PP PPP PP PPPP Sbjct: 1099 LFPPLPPPPSQPPPPPLSPPPSPPPPPPPP 1128 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/34 (55%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = +3 Query: 846 SXVLPGXXPPPXPP--PXPPPXPPPXPPXXPPPP 941 S LP PPP PP P PPP PP PP PPP Sbjct: 1061 SPPLPQESPPPLPPLPPSPPPPSPPLPPSSLPPP 1094 Score = 41.5 bits (93), Expect = 8e-04 Identities = 19/38 (50%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPP-XPPXXPPPP 941 P SL P PP PPP P PPP PP PPPP Sbjct: 1087 PPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPP 1124 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP P P PP P P P P PP P P PPP Sbjct: 1079 PPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPP 1125 Score = 39.1 bits (87), Expect = 0.004 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP PP PPP PP P PPPP Sbjct: 1073 PPLPPSPPPPSPPLPPSSLPPPP 1095 Score = 37.9 bits (84), Expect = 0.010 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 4/33 (12%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXP----PXXPPPP 941 LP PPP PP P PPP P P PPPP Sbjct: 1075 LPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPP 1107 Score = 37.1 bits (82), Expect = 0.017 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P +L LP P PPP PP PP PP PPP Sbjct: 1095 PPAALFPPLPPPPSQPPPPPLSPPPSPPPPP--PPP 1128 Score = 35.9 bits (79), Expect = 0.039 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPP 933 PP PP P P P P SL P P PP P P PP Sbjct: 1070 PPLPPLPPSPPPPSPPLPPSSLPPPP-PAALFPPLPPPPSQPPPPP 1114 Score = 33.5 bits (73), Expect = 0.21 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 P PP P PPP PP P PP Sbjct: 1058 PEDSPPLPQESPPPLPPLPPSPP 1080 Score = 29.5 bits (63), Expect = 3.4 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP P PP PSP P P PP P PPP Sbjct: 1062 PPLPQESPPPLPPLPPSP--PPPSPPLPPSSLPPPPPAALFPPLPPP 1106 Score = 28.3 bits (60), Expect = 7.8 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 4/40 (10%) Frame = +1 Query: 796 PPSPPX----PXPPXXXXXPSPXFSLXXXPXPXPXXPPXP 903 PP PP P PP P P S P P P PP P Sbjct: 1092 PPPPPAALFPPLPPPPSQPPPPPLS----PPPSPPPPPPP 1127 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 46.0 bits (104), Expect = 4e-05 Identities = 20/38 (52%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXP-PPXPPXXPPPP 941 P RS P PPP PPP PPP P PP PP PP Sbjct: 260 PGRSAPPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPP 297 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP P P PPP PP P Sbjct: 273 PPPQPPPPPPPKPQPPPPPKIARPPPAP 300 Score = 35.1 bits (77), Expect = 0.068 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPPPXPPPX--PPPXPPXXPPP 938 S + + P PP P PPP PPP PP PPP Sbjct: 249 SAAGLPPLKLPPGRSAPPPPPAAAPPPQPPPPPPP 283 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PP PP PP P PP Sbjct: 274 PPQPPPPPPPKPQPPPPPKIARPPPAPP 301 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/45 (33%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = +1 Query: 805 PPXPXPPXXXXXPSPXFSL-XXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P P + P P P P P P PPP Sbjct: 254 PPLKLPPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPP 298 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPPPXPP-PXPPPXPPXXPPP 938 P P P PPP P PPP PP P Sbjct: 279 PPPPPKPQPPPPPKIARPPPAPPKGAAP 306 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 46.0 bits (104), Expect = 4e-05 Identities = 18/30 (60%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPPX--PPPXPPPXPPXXPPPP 941 P PPP PPP PPP PPP PP PPP Sbjct: 58 PADCPPPPPPPPCPPPPSPPPCPPPPSPPP 87 Score = 45.2 bits (102), Expect = 6e-05 Identities = 18/29 (62%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPPPXPPPXPPP-XPPPXPPXXPPPP 941 P PP PPP PPP PPP PP PPPP Sbjct: 64 PPPPPPCPPPPSPPPCPPPPSPPPSPPPP 92 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/31 (58%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPPPXPP---PXPPPXPPXXPPPP 941 P PPP PPP PP P P P PP PPPP Sbjct: 68 PPCPPPPSPPPCPPPPSPPPSPPPPQLPPPP 98 Score = 43.6 bits (98), Expect = 2e-04 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP PPP PPP P PP PPP Sbjct: 77 PPCPPPPSPPPSPPPPQLPPPPQLPPP 103 Score = 41.9 bits (94), Expect = 6e-04 Identities = 17/30 (56%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXPPP--XPPPXPPXXPPPP 941 P P PPP PPP PPP PP PPPP Sbjct: 54 PEPEPADCPPPPPPPPCPPPPSPPPCPPPP 83 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 3/38 (7%) Frame = +3 Query: 837 RSLSXVLPGXX---PPPXPPPXPPPXPPPXPPXXPPPP 941 +SL ++ G PPP P P P P P PP PPPP Sbjct: 32 KSLEIIIGGGNDNNPPPSPSPEPEPEPADCPPPPPPPP 69 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP P PP PP PP P Sbjct: 81 PPPSPPPSPPPPQLPPPPQLPPPAPPKP 108 Score = 38.3 bits (85), Expect = 0.007 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPP 933 PP PP P PP PSP S P P P P P PP Sbjct: 68 PPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPP 113 Score = 37.9 bits (84), Expect = 0.010 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P P P PPP PP PPP Sbjct: 48 PSPSPEPEPEPADCPPPPPPPPCPPPP 74 Score = 37.5 bits (83), Expect = 0.013 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P P P PPP PPP P P PP Sbjct: 50 PSPEPEPEPADCPPPPPPPPCPPPPSPP 77 Score = 36.7 bits (81), Expect = 0.022 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P P P P P PPP PP PPP Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPCPPP 73 Score = 36.3 bits (80), Expect = 0.029 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P PPP PP PP PPP Sbjct: 52 PEPEPEPADCPPPPPPPPCPPPPSPPP 78 Score = 36.3 bits (80), Expect = 0.029 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PP PPP PP P PP P Sbjct: 78 PCPPPPSPPPSPPPPQLPPPPQLPPPAP 105 Score = 35.9 bits (79), Expect = 0.039 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PP PP PPP PP P P Sbjct: 86 PPSPPPPQLPP-PPQLPPPAPPKPQPSP 112 Score = 33.1 bits (72), Expect = 0.27 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP PP PP P P PP P Sbjct: 92 PQLPPPPQLPPPAPPKPQPSPPTPDLP 118 Score = 32.7 bits (71), Expect = 0.36 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 772 PXSXFXWXPPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXP 912 P S PP P P PP P P P P P PP P P Sbjct: 73 PPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQP-SPPTPDLP 118 Score = 32.3 bits (70), Expect = 0.48 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = +1 Query: 796 PPSPPXPXP-PXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP P P P P P P P P P PP P P PPP Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPCPPPPSP--PPCPPPPSPPPSPPP 91 Score = 32.3 bits (70), Expect = 0.48 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +1 Query: 796 PPSP-PXPXP-PXXXXXPSPXFSLXXXPXPXPXXPP---XPXXPXTXXXPPP 936 PPSP P P P P P P P P P PP P P PPP Sbjct: 47 PPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPP 98 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +1 Query: 796 PPSPPX-PXPPXXXXXPSPXFSLXXXPXPXPXXPPXP-XXPXTXXXP 930 PPSPP P PP P P L P P PP P P T P Sbjct: 73 PPSPPPCPPPPSPPPSPPPP-QLPPPPQLPPPAPPKPQPSPPTPDLP 118 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 45.2 bits (102), Expect = 6e-05 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG GGG GGG Sbjct: 488 GGGGIGGGAGGGVGGGVGGGVGGG 511 Score = 42.3 bits (95), Expect = 4e-04 Identities = 35/109 (32%), Positives = 37/109 (33%), Gaps = 4/109 (3%) Frame = -2 Query: 940 GGGGXXGGXGG----GXGGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXX 773 GGGG GG GG G GGG GGG GG G + G G Sbjct: 65 GGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGV 124 Query: 772 GXGGXLGXEPPHXPRGGXEKGXXCGG*GXLRGXXGPXXGXGGRXXXXXG 626 G GG G G G GG G G G G GG+ G Sbjct: 125 GAGGGAGGSVGAGGGIGGGAGGAIGG-GASGGVGGGGKGRGGKSGGGAG 172 Score = 40.3 bits (90), Expect = 0.002 Identities = 33/106 (31%), Positives = 34/106 (32%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXGG 761 GG G G GGG GGG GGG GGG G G G G GG Sbjct: 330 GGAGGSVGAGGGVGGGVGGGVGGGVGGG-------VGGAVGGAVGGAVGGGGGGSVGGGG 382 Query: 760 XLGXEPPHXPRGGXEKGXXCGG*GXLRGXXGPXXGXGGRXXXXXGL 623 GG G G G G G G GG G+ Sbjct: 383 RGSGGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGV 428 Score = 40.3 bits (90), Expect = 0.002 Identities = 32/101 (31%), Positives = 34/101 (33%), Gaps = 3/101 (2%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXG---GGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGX 767 GGG GG GGG GG GG G GG G R G G Sbjct: 429 GGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGG 488 Query: 766 GGXLGXEPPHXPRGGXEKGXXCGG*GXLRGXXGPXXGXGGR 644 GG +G GG G G G + G G G GR Sbjct: 489 GGGIGGGAGGGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGR 529 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GG G G GGG GGG GGG GGG Sbjct: 262 GGAGGNVGAGGGLGGGVGGGVGGG 285 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GG G G GGG GGG GGG GGG Sbjct: 416 GGAGGSVGAGGGVGGGVGGGVGGG 439 Score = 38.3 bits (85), Expect = 0.007 Identities = 33/105 (31%), Positives = 35/105 (33%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXGG 761 GG G G GGG GGG GGG G G G + G G GG Sbjct: 159 GGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGGGG 218 Query: 760 XLGXEPPHXPRGGXEKGXXCGG*GXLRGXXGPXXGXGGRXXXXXG 626 +G GG G G G G G G GGR G Sbjct: 219 TVG--AGGRGSGGASGGVGVG--GGAGGSGGGSVGGGGRGSGGVG 259 Score = 37.9 bits (84), Expect = 0.010 Identities = 31/98 (31%), Positives = 32/98 (32%), Gaps = 2/98 (2%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXG--GGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXG 764 GGG GG G G GGG GGG G GG G G G R G Sbjct: 54 GGGASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGG 113 Query: 763 GXLGXEPPHXPRGGXEKGXXCGG*GXLRGXXGPXXGXG 650 G G G G G G + G G G G Sbjct: 114 GGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGG 151 Score = 37.9 bits (84), Expect = 0.010 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GGG GGG GG GG Sbjct: 271 GGGLGGGVGGGVGGGVGGSVGG 292 Score = 37.1 bits (82), Expect = 0.017 Identities = 18/30 (60%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXGGXGG--GXGGGXGGGXGGGXXPG 857 GG G GG GG G GGG GGG GGG G Sbjct: 256 GGVGASGGAGGNVGAGGGLGGGVGGGVGGG 285 Score = 36.7 bits (81), Expect = 0.022 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 G G GG GGG GGG GGG GG Sbjct: 266 GNVGAGGGLGGGVGGGVGGGVGG 288 Score = 36.7 bits (81), Expect = 0.022 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 G G GG GGG GGG GGG GG Sbjct: 420 GSVGAGGGVGGGVGGGVGGGVGG 442 Score = 36.3 bits (80), Expect = 0.029 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG G G GGG GGG GGG G Sbjct: 476 GSVGAGGGVGVGGGGGIGGGAGGGVGGG 503 Score = 35.9 bits (79), Expect = 0.039 Identities = 32/100 (32%), Positives = 33/100 (33%), Gaps = 2/100 (2%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG--GXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGX 767 GGGG GG G G GG GG GG G G G G G Sbjct: 373 GGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGV 432 Query: 766 GGXLGXEPPHXPRGGXEKGXXCGG*GXLRGXXGPXXGXGG 647 GG +G GG G GG G G G G G Sbjct: 433 GGGVGG-GVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAG 471 Score = 35.5 bits (78), Expect = 0.051 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GGG GG GG GG Sbjct: 275 GGGVGGGVGGGVGGSVGGAVGG 296 Score = 35.5 bits (78), Expect = 0.051 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G G GGG G G GGG GGG G Sbjct: 472 GGTGGSVGAGGGVGVGGGGGIGGGAGGG 499 Score = 35.1 bits (77), Expect = 0.068 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 3/31 (9%) Frame = -2 Query: 940 GGGGXXGGXG---GGXGGGXGGGXGGGXXPG 857 GGGG GG G GG GGG GG G G G Sbjct: 455 GGGGSVGGGGRGSGGAGGGTGGSVGAGGGVG 485 Score = 34.7 bits (76), Expect = 0.090 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG G G GG GGG GGG G Sbjct: 151 GASGGVGGGGKGRGGKSGGGAGGGVGGG 178 Score = 34.7 bits (76), Expect = 0.090 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGGG GG G G GG GG GG Sbjct: 305 GGGGSVGGGGRGSGGASGGASGG 327 Score = 34.7 bits (76), Expect = 0.090 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GG GG GGG GG G Sbjct: 454 GGGGGSVGGGGRGSGGAGGGTGGSVGAG 481 Score = 34.7 bits (76), Expect = 0.090 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GG GG G G G G GGG G Sbjct: 466 GSGGAGGGTGGSVGAGGGVGVGGGGGIG 493 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 G G GG GG G G GGG GGG Sbjct: 50 GAGAGGGASGGIGVGGGGGGGGG 72 Score = 34.3 bits (75), Expect = 0.12 Identities = 30/102 (29%), Positives = 31/102 (30%), Gaps = 5/102 (4%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXGGX 758 GGG G GG GG GGG GG G G G G G Sbjct: 355 GGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASGGVGG 414 Query: 757 LGXEPPHXPRGGXEKGXXCGG-----*GXLRGXXGPXXGXGG 647 G GG G GG G + G G G GG Sbjct: 415 AGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGG 456 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GG G G G G G Sbjct: 462 GGGRGSGGAGGGTGGSVGAGGGVGVGGG 489 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GG GG GG GG G Sbjct: 279 GGGVGGGVGGSVGGAVGGAVGGAVGGG 305 Score = 33.9 bits (74), Expect = 0.16 Identities = 31/100 (31%), Positives = 33/100 (33%), Gaps = 2/100 (2%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXGGX 758 GG G GG GG GGG GG G G G G GG Sbjct: 287 GGSVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGAGG-SVGAGGGVGGG 345 Query: 757 LGXEPPHXPRGGXEKGXXCGG--*GXLRGXXGPXXGXGGR 644 +G GG G GG G + G G G GGR Sbjct: 346 VGGGVGGGVGGGV--GGAVGGAVGGAVGGGGGGSVGGGGR 383 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GG GG GG GG G G G Sbjct: 316 GSGGASGGASGGASGGAGGSVGAGGGVG 343 Score = 33.9 bits (74), Expect = 0.16 Identities = 32/107 (29%), Positives = 34/107 (31%), Gaps = 4/107 (3%) Frame = -2 Query: 934 GGXXGGXGGGX--GGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXGG 761 GG GG GGG GGG G G G G G G GG Sbjct: 367 GGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGG 426 Query: 760 XLGXEPPHXPRGGXEKGXXCGG--*GXLRGXXGPXXGXGGRXXXXXG 626 +G GG G GG G + G G G GGR G Sbjct: 427 GVGGGVGGGVGGGV--GGAVGGAVGGAVGGGGGGSVGGGGRGSGGAG 471 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GG G G GG GGG GGG G Sbjct: 530 GSGGASGGAGAG--GGAGGGVGGGANVG 555 Score = 33.5 bits (73), Expect = 0.21 Identities = 29/103 (28%), Positives = 32/103 (31%), Gaps = 4/103 (3%) Frame = -2 Query: 940 GGGGXXGGXGGGXG----GGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXX 773 GG G GG GGG G GG G G G G G G Sbjct: 59 GGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGG 118 Query: 772 GXGGXLGXEPPHXPRGGXEKGXXCGG*GXLRGXXGPXXGXGGR 644 G GG +G G G G G + G G GG+ Sbjct: 119 GVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGK 161 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GG GG GG GG G Sbjct: 312 GGGRGSGGASGGASGGASGGAGGSVGAG 339 Score = 33.1 bits (72), Expect = 0.27 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GG G GG GGG GGG G G G Sbjct: 536 GGAGAGGGAGGGVGGGANVGVGVG 559 Score = 32.7 bits (71), Expect = 0.36 Identities = 29/98 (29%), Positives = 30/98 (30%), Gaps = 1/98 (1%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXG-GGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXGG 761 GGG G G G GG GG G GG G G G GG Sbjct: 249 GGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVGGAVGGAVGGAVGGGGGG 308 Query: 760 XLGXEPPHXPRGGXEKGXXCGG*GXLRGXXGPXXGXGG 647 +G GG G G G G G G GG Sbjct: 309 SVGG--GGRGSGGASGGASGGASGGAGGSVGAGGGVGG 344 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GGG GGG GGG G G Sbjct: 532 GGASGGAGAGGGAGGGVGGGANVGVGVG 559 Score = 32.3 bits (70), Expect = 0.48 Identities = 30/100 (30%), Positives = 32/100 (32%), Gaps = 2/100 (2%) Frame = -2 Query: 940 GGGGXXGGXGGGXGG--GXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGX 767 G G G GGG G G GGG GGG G + G G G Sbjct: 45 GSVGVGAGAGGGASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGG 104 Query: 766 GGXLGXEPPHXPRGGXEKGXXCGG*GXLRGXXGPXXGXGG 647 G G + GG G G G G G G GG Sbjct: 105 GKGRGRKGGGGAGGGVGGGVGAG--GGAGGSVGAGGGIGG 142 Score = 32.3 bits (70), Expect = 0.48 Identities = 18/32 (56%), Positives = 18/32 (56%), Gaps = 4/32 (12%) Frame = -2 Query: 940 GGGGXXGGXG--GGXGG--GXGGGXGGGXXPG 857 GGG GG G GG GG G GGG GGG G Sbjct: 250 GGGRGSGGVGASGGAGGNVGAGGGLGGGVGGG 281 Score = 32.3 bits (70), Expect = 0.48 Identities = 32/100 (32%), Positives = 33/100 (33%), Gaps = 3/100 (3%) Frame = -2 Query: 937 GGGXXGGXGGGXGG-GXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXGG 761 GG G GGG GG GGG G G G T G G G GG Sbjct: 445 GGAVGGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIG--GGAGGGVGG 502 Query: 760 XLGXEPPHXPRG--GXEKGXXCGG*GXLRGXXGPXXGXGG 647 +G RG G G GG G G G GG Sbjct: 503 GVGGGVGGGVRGAVGGAVGGGVGGAGRGSGGASGGAGAGG 542 Score = 32.3 bits (70), Expect = 0.48 Identities = 26/99 (26%), Positives = 27/99 (27%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXGG 761 G GG G GGG GG GG GG G R + G Sbjct: 479 GAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGRGSGGASGGA 538 Query: 760 XLGXEPPHXPRGGXEKGXXCGG*GXLRGXXGPXXGXGGR 644 G GG G G G G G G R Sbjct: 539 GAGGGAGGGVGGGANVGVGVGAGGSTGGGAAGGGGVGNR 577 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GG GG GG GG G Sbjct: 304 GGGGGSVGGGGRGSGGASGGASGGASGG 331 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GGG G G GG GG Sbjct: 453 GGGGGGSVGGGGRGSGGAGGGTGG 476 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG G G G GG GG G Sbjct: 244 GGGSVGGGGRGSGGVGASGGAGGNVGAG 271 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG G GG GGG G G G G Sbjct: 237 GGGAGGSGGGSVGGGGRGSGGVGASGG 263 Score = 28.7 bits (61), Expect = 5.9 Identities = 27/100 (27%), Positives = 27/100 (27%), Gaps = 1/100 (1%) Frame = -1 Query: 941 GWGGGXXXVXGXXGXGGXXGXGXGXXSRENXGEGXXXXXGGXGXGGEGGXQXKXLXGXXX 762 G GGG G G G G G G G G G GG G Sbjct: 435 GVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGG 494 Query: 761 XXXXXXXXXXXXXXXKG-XXVWGLRVXAGVXGAXXGXGGA 645 G G V GV GA G GGA Sbjct: 495 GAGGGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGRGSGGA 534 Score = 28.3 bits (60), Expect = 7.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GGG G G G G G Sbjct: 303 GGGGGGSVGGGGRGSGGASGGASGGASG 330 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 45.2 bits (102), Expect = 6e-05 Identities = 19/32 (59%), Positives = 19/32 (59%), Gaps = 3/32 (9%) Frame = +3 Query: 855 LPGXXPPPXPPP---XPPPXPPPXPPXXPPPP 941 LPG PPP PPP PPP P PP PPPP Sbjct: 674 LPGGGPPPPPPPPGGGPPPPPGGGPPPPPPPP 705 Score = 35.1 bits (77), Expect = 0.068 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP P PPP PPP PPPP Sbjct: 672 PPLPGGGPPPPPPPPGGGPPPPP 694 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 LP PP PPP PPP PPP Sbjct: 667 LPSARPPLPGGGPPPPPPPPGGGPPPPP 694 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 44.8 bits (101), Expect = 8e-05 Identities = 34/97 (35%), Positives = 34/97 (35%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXGGX 758 GGG GG GGG GGG GGG GGG G G P R Sbjct: 10 GGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGG--GGGGGGYMVAPGSNRSSYISRD 67 Query: 757 LGXEPPHXPRGGXEKGXXCGG*GXLRGXXGPXXGXGG 647 P GG KG GG G G G G GG Sbjct: 68 NFESDPKGGSGGGGKGGGGGG-GISGGGAGGKSGCGG 103 Score = 43.2 bits (97), Expect = 3e-04 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GG GGG G Sbjct: 17 GGGGSGGGRGGGGGGGAKGGCGGGGKSG 44 Score = 42.7 bits (96), Expect = 3e-04 Identities = 31/98 (31%), Positives = 31/98 (31%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXGG 761 G GG GG GGG GGG GGG GG G G R Sbjct: 13 GKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGGYMVAPGSNRSSYISRDNFESD 72 Query: 760 XLGXEPPHXPRGGXEKGXXCGG*GXLRGXXGPXXGXGG 647 G GG G GG G G G G GG Sbjct: 73 PKGGSGGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGG 110 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GG GGG GG GGG G Sbjct: 110 GGGGKNGGGCGGGGGGKGGKSGGGSGGG 137 Score = 36.3 bits (80), Expect = 0.029 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G G GGG GGG GGG GGG G Sbjct: 2 GGKGGSGSGGGGKGGG-GGGSGGGRGGG 28 Score = 35.9 bits (79), Expect = 0.039 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGG GG GGG GG GG GGG Sbjct: 102 GGGKSGGGGGGGKNGGGCGGGGGG 125 Score = 35.5 bits (78), Expect = 0.051 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRT 851 GGG GG GGG G G G GGG G++ Sbjct: 102 GGGKSGGGGGGGKNGGGCGGGGGGKGGKS 130 Score = 35.1 bits (77), Expect = 0.068 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 3/31 (9%) Frame = -2 Query: 940 GGGGXXGGXGG---GXGGGXGGGXGGGXXPG 857 GGGG GG G G GGG GG GGG G Sbjct: 86 GGGGISGGGAGGKSGCGGGKSGGGGGGGKNG 116 Score = 35.1 bits (77), Expect = 0.068 Identities = 17/30 (56%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGG--GXGGGXXPG 857 GGGG G GGG GGG GG G GG G Sbjct: 107 GGGGGGGKNGGGCGGGGGGKGGKSGGGSGG 136 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG G GG GGG GGG GG G Sbjct: 94 GAGGKSGCGGGKSGGGGGGGKNGGGCGG 121 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGG--XGGGXXPG 857 GG G G GGG GG GGG GGG G Sbjct: 93 GGAGGKSGCGGGKSGGGGGGGKNGGGCGGG 122 Score = 33.1 bits (72), Expect = 0.27 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G G G G GGG GG G Sbjct: 85 GGGGGISGGGAGGKSGCGGGKSGGGGGG 112 Score = 31.5 bits (68), Expect = 0.84 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -2 Query: 922 GGXGG-GXGGGXGGGXGGGXXPGR 854 GG GG G GGG GG GGG GR Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGGGR 25 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG GG GG GG G PG Sbjct: 117 GGCGGGGGGKGGKSGGGSGGGGYMVAPG 144 Score = 29.5 bits (63), Expect = 3.4 Identities = 20/59 (33%), Positives = 21/59 (35%) Frame = -3 Query: 936 GGGXXXGXGXXXXGGXXGXXXXXXXXXXXXXXXGXGXXGGGGXGGGGXPXEXAXRGGGG 760 GGG G G GG G G G GGG GGGG + G GG Sbjct: 79 GGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGG-GKNGGGCGGGGGGKGGKSGGGSGG 136 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXR 836 GGGG GG GG GG G G T R + Sbjct: 121 GGGGGKGGKSGGGSGGGGYMVAPGSNGSSTISRDK 155 Score = 28.3 bits (60), Expect = 7.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGG GGG RGGGG Sbjct: 6 GSGSGGGGKGGGGGGSGGGRGGGG 29 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 44.4 bits (100), Expect = 1e-04 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP PPP PP P P PP PPP Sbjct: 69 PTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PP P P PP PP PPPP Sbjct: 68 PPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 42.7 bits (96), Expect = 3e-04 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PP P P PP PP PPPP Sbjct: 67 PPPTSPPPPSPPPPSPPPPSPPPP 90 Score = 41.1 bits (92), Expect = 0.001 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PP PPP PP P P PP PPP Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPP 90 Score = 40.7 bits (91), Expect = 0.001 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP P P PP PPP PP PPP Sbjct: 67 PPPTSPPPPSPPPPSPPPPSPPPPSPPP 94 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXP 903 PP PP PP PSP P P P PP P Sbjct: 65 PPPPPTSPPPPSPPPPSPP-----PPSPPPPSPPPP 95 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/37 (51%), Positives = 20/37 (54%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P L + P PPP PP PP PPP PP PPPP Sbjct: 81 PPPPLPRLPPPLLPPPEEPPREPP-PPPPPPEEPPPP 116 Score = 36.3 bits (80), Expect = 0.029 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 3/27 (11%) Frame = +3 Query: 870 PPPXPPPXP---PPXPPPXPPXXPPPP 941 PPP PPP P P PPP P PP P Sbjct: 41 PPPSPPPSPSSPPRLPPPFPALFPPEP 67 Score = 35.1 bits (77), Expect = 0.068 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPX-PPPXPPXXPPPP 941 P PPP P PPP PPP P PPP Sbjct: 77 PPLFPPPPLPRLPPPLLPPPEEPPREPPP 105 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/32 (53%), Positives = 17/32 (53%), Gaps = 3/32 (9%) Frame = +3 Query: 855 LPGXXPPPXPPP-XPPP--XPPPXPPXXPPPP 941 LP PP P P PPP PP PP PPPP Sbjct: 75 LPPPLFPPPPLPRLPPPLLPPPEEPPREPPPP 106 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 5/33 (15%) Frame = +3 Query: 858 PGXXPPPXP---PPXPPP--XPPPXPPXXPPPP 941 P PPP P PP PP PP PP PPPP Sbjct: 78 PLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPP 110 Score = 32.7 bits (71), Expect = 0.36 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXP---PPXPPPXPPPXPPXXPPPP 941 P PPP P P PPP P PP P PP Sbjct: 41 PPPSPPPSPSSPPRLPPPFPALFPPEPPLPP 71 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPP 938 P PPP PPP P PP PPP Sbjct: 38 PLSPPPSPPP-SPSSPPRLPPP 58 Score = 32.3 bits (70), Expect = 0.48 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 5/33 (15%) Frame = +3 Query: 858 PGXXPPPXPP--PXPPPXPPP---XPPXXPPPP 941 P PPP P P PP PP PP PPPP Sbjct: 52 PPRLPPPFPALFPPEPPLPPRFELPPPLFPPPP 84 Score = 31.5 bits (68), Expect = 0.84 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +1 Query: 772 PXSXFXWXPPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXX-PPXPXXPXTXXXPPP 936 P F P SPP P PP PSP S P P P PP P P PPP Sbjct: 30 PPLVFPLLPLSPP-PSPP-----PSPS-SPPRLPPPFPALFPPEPPLPPRFELPPP 78 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +1 Query: 805 PPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP P P P P F P P P P P PPP Sbjct: 64 PPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPP 107 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXP--PPP 941 P P PPP PPP P P PPP Sbjct: 35 PLLPLSPPPSPPPSPSSPPRLPPP 58 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P PPP PP P P Sbjct: 29 PPPLVFPLLPLSPPPSPPPSPSSP 52 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 3/25 (12%) Frame = +3 Query: 873 PPXPP--PXPPPX-PPPXPPXXPPP 938 PP PP PPP PPP P PPP Sbjct: 67 PPLPPRFELPPPLFPPPPLPRLPPP 91 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 SL + PG PPP P P PP PPP Sbjct: 15 SLGNLPPGTTGTCCPPPLVFPLLPLSPPPSPPP 47 Score = 29.1 bits (62), Expect = 4.5 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 2/49 (4%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPP--XPXXPXTXXXPPP 936 PP PP P P P L P P PP P P PPP Sbjct: 67 PPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPP 115 >At4g16240.1 68417.m02464 hypothetical protein Length = 42 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG GGG GGG GGG GGG G Sbjct: 12 GGAGGGGGHGGGAGGGFGGGAGGGGGHG 39 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 43.2 bits (97), Expect = 3e-04 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPP 935 PPP PPP PPP PPP PP P Sbjct: 25 PPPQPPPPPPPPPPPPPPRLGP 46 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 7/31 (22%) Frame = +3 Query: 870 PPPXPPPX-------PPPXPPPXPPXXPPPP 941 PPP PP PPP PPP PP PPPP Sbjct: 10 PPPLPPRLELRRQRAPPPQPPPPPPPPPPPP 40 Score = 37.5 bits (83), Expect = 0.013 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXPPP 938 PPP PPP PPP PP PPP Sbjct: 25 PPPQPPPPPPP-PPPPPPP 42 Score = 35.9 bits (79), Expect = 0.039 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPP 923 P PPP PPP PPP PP P Sbjct: 25 PPPQPPPPPPPPPPPPPPRLGP 46 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PP P PPP Sbjct: 29 PPPPPPPPPPPPPPRLGPRLRLRLLPPP 56 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 8/30 (26%) Frame = +3 Query: 876 PXPPPXPP--------PXPPPXPPXXPPPP 941 P PPP PP PP PP PPPP Sbjct: 8 PPPPPLPPRLELRRQRAPPPQPPPPPPPPP 37 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGGG GG GGG GGG GGG GG Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGG 92 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 GGG GG GGG GGG GGG GGG Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGG 92 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG G G G Sbjct: 71 GGGGGGGGGGGGGGGGGGGGGGWGWGGG 98 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG G G G Sbjct: 73 GGGGGGGGGGGGGGGGGGGGWGWGGGGG 100 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG G G GGG G Sbjct: 75 GGGGGGGGGGGGGGGGGGWGWGGGGGGG 102 Score = 41.9 bits (94), Expect = 6e-04 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 G GG GG GGG GGG GGG GGG Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGG 91 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG G GGG G Sbjct: 76 GGGGGGGGGGGGGGGGGWGWGGGGGGGG 103 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GGG GGG GGG GGG G Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGGG 92 Score = 37.9 bits (84), Expect = 0.010 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G GGG GGG GGG GGG G Sbjct: 61 GSGSYRWGWGGGGGGGGGGGGGGGGGGG 88 Score = 35.1 bits (77), Expect = 0.068 Identities = 17/30 (56%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXX--GGXGGGXGGGXGGGXGGGXXPG 857 GG G G GGG GGG GGG GGG G Sbjct: 60 GGSGSYRWGWGGGGGGGGGGGGGGGGGGGG 89 Score = 35.1 bits (77), Expect = 0.068 Identities = 17/28 (60%), Positives = 17/28 (60%), Gaps = 4/28 (14%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGG----GXGGG 869 GGGG GG G G GGG GG G GGG Sbjct: 85 GGGGGGGGWGWGGGGGGGGWYKWGCGGG 112 Score = 33.1 bits (72), Expect = 0.27 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGG--XGGGXGGGXXPGR 854 GGGG G GGG GGG G GGG GR Sbjct: 88 GGGGGWGWGGGGGGGGWYKWGCGGGGKGKGR 118 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGG 91 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 77 GGGGGGGGGGGGGGGGWGWGGGGG 100 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG GGGG Sbjct: 79 GGGGGGGGGGGGGGWGWGGGGGGG 102 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGGX*XXNLPTXPGGGXK 715 G GGGG GGGG GGGG GGG K Sbjct: 76 GGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGK 114 Score = 28.7 bits (61), Expect = 5.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 822 GGGGXGGGGXPXEXAXRGGGG 760 GGGG GGGG GGGG Sbjct: 72 GGGGGGGGGGGGGGGGGGGGG 92 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/30 (56%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXPPP--XPPPXPPXXPPPP 941 P PPP PP PPP PPP PP PPP Sbjct: 74 PNTTPPPTPPSSPPPSITPPPSPPQPQPPP 103 Score = 35.9 bits (79), Expect = 0.039 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPP--XPPXXPPPP 941 P P PPP PP PPP PP PP P Sbjct: 70 PNQPPNTTPPPTPPSSPPPSITPPPSPPQP 99 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 6/29 (20%) Frame = +3 Query: 870 PPPX----PPPXPPPX--PPPXPPXXPPP 938 PPP PPP PP PPP PP PPP Sbjct: 60 PPPATAAQPPPNQPPNTTPPPTPPSSPPP 88 Score = 32.7 bits (71), Expect = 0.36 Identities = 16/60 (26%), Positives = 19/60 (31%) Frame = +3 Query: 753 PXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXP 932 P +PP P + P + P PP PP PP P P P P Sbjct: 48 PPSPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPSPPQPQPPPQSTP 107 Score = 31.5 bits (68), Expect = 0.84 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 3/30 (10%) Frame = +3 Query: 858 PGXXPPPXPPPX--PPPXPP-PXPPXXPPP 938 P PP PPP PPP PP P PP P Sbjct: 78 PPPTPPSSPPPSITPPPSPPQPQPPPQSTP 107 Score = 29.1 bits (62), Expect = 4.5 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PP P P PPP PPP Sbjct: 44 PATSPPSPPSPDTQTSPPPATAAQPPP 70 Score = 28.3 bits (60), Expect = 7.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PP P P P P P PPP Sbjct: 68 PPPNQPPNTTPPPTPPSSPPPSITPPP 94 Score = 28.3 bits (60), Expect = 7.8 Identities = 12/35 (34%), Positives = 13/35 (37%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPP 935 P + P PPP P P P P PP P Sbjct: 73 PPNTTPPPTPPSSPPPSITPPPSPPQPQPPPQSTP 107 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 42.3 bits (95), Expect = 4e-04 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GG GGG G Sbjct: 129 GGGGGYGGGGGGYGGGGGGYGGGGDGGG 156 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GGG GGG GG GGG G Sbjct: 122 GGGGGYSGGGGGYGGGGGGYGGGGGGYG 149 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GG GGG G G GGG G Sbjct: 123 GGGGYSGGGGGYGGGGGGYGGGGGGYGG 150 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG 875 GGGG GG GGG GGG GG G Sbjct: 136 GGGGGYGGGGGGYGGGGDGGGG 157 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 GGG G GGG G G GG GGG Sbjct: 135 GGGGGGYGGGGGGYGGGGDGGGG 157 Score = 28.7 bits (61), Expect = 5.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 822 GGGGXGGGGXPXEXAXRGGGG 760 GGGG GGGG GGGG Sbjct: 137 GGGGYGGGGGGYGGGGDGGGG 157 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 42.3 bits (95), Expect = 4e-04 Identities = 16/37 (43%), Positives = 18/37 (48%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P + + PP PPP PPP P PP PPPP Sbjct: 48 PIKCSPSCIQNPPPPSPPPPSPPPPACPPPPALPPPP 84 Score = 38.7 bits (86), Expect = 0.006 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 P P PP PPP PP P PPPP Sbjct: 62 PSPPPPSPPPPACPPPPALPPPPP 85 Score = 35.9 bits (79), Expect = 0.039 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP PPP P PP PP PPP Sbjct: 61 PPSPPPPSPPPPACPPPPALPP--PPP 85 Score = 33.1 bits (72), Expect = 0.27 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPPX--PPPXPPPXPPXXPPPP 941 P PP PPP PPP P PPPP Sbjct: 67 PSPPPPACPPPPALPPPPPKKVSSYCPPPP 96 Score = 32.7 bits (71), Expect = 0.36 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = +3 Query: 837 RSLSXVLPGXXPPPXPPPXPPPXPP---PXPPXXPPPP 941 R L V P P PPP PP P PP PPPP Sbjct: 41 RKLDEVDPIKCSPSCIQNPPPPSPPPPSPPPPACPPPP 78 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PPSPP P PP P P PP P PP Sbjct: 61 PPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPPPPANFLYITGPP 107 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 41.9 bits (94), Expect = 6e-04 Identities = 31/93 (33%), Positives = 32/93 (34%), Gaps = 1/93 (1%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXGG 761 GGGG GG GG GGG GG GGG G G G G GG Sbjct: 198 GGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGG 257 Query: 760 XLGXEPPH-XPRGGXEKGXXCGG*GXLRGXXGP 665 G + GG G GG G G P Sbjct: 258 GEGGGGSYGGEHGGGSGGGHGGGGGHGGGGYAP 290 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GG GG GGG GGG Sbjct: 107 GGGGGYGGAAGGHAGGGGGGSGGG 130 Score = 39.5 bits (88), Expect = 0.003 Identities = 34/101 (33%), Positives = 34/101 (33%), Gaps = 3/101 (2%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGG-GXGGGXXPGRTXERXR-XGXXXXXXXXXXXGPKXXRXXGX 767 GGGG G GG GGG GG G GGG G E G G Sbjct: 108 GGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGG 167 Query: 766 GGXLGXEPPHXPRGGXEKGXXC-GG*GXLRGXXGPXXGXGG 647 GG G GG G GG G G G G GG Sbjct: 168 GGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGG 208 Score = 37.1 bits (82), Expect = 0.017 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GG GG GGG GGG G Sbjct: 41 GGGGSGGVSSGGYGGESGGGYGGGSGEG 68 Score = 35.5 bits (78), Expect = 0.051 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG GGG GGG G GG G Sbjct: 185 GGSGYGGGEGGGAGGGGSHGGAGGYGGG 212 Score = 35.5 bits (78), Expect = 0.051 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG G GG GGG G Sbjct: 190 GGGEGGGAGGGGSHGGAGGYGGGGGGG 216 Score = 35.5 bits (78), Expect = 0.051 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG G GG GGG GGG G Sbjct: 194 GGGAGGGGSHGGAGGYGGGGGGGSGGG 220 Score = 35.1 bits (77), Expect = 0.068 Identities = 31/97 (31%), Positives = 31/97 (31%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXGG 761 GGG GG GG GG GGG GG G G G G GG Sbjct: 194 GGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGG 253 Query: 760 XLGXEPPHXPRGGXEKGXXCGG*GXLRGXXGPXXGXG 650 G GG G GG G G G G G Sbjct: 254 GGGG---GEGGGGSYGGEHGGGSGGGHGGGGGHGGGG 287 Score = 33.9 bits (74), Expect = 0.16 Identities = 30/98 (30%), Positives = 32/98 (32%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXGG 761 GGG GG GG G GG GG G + E G G + G G Sbjct: 36 GGGHGGGGGSGGVSSGGYGGESGGGYGGGSGEGAGGG---------YGGAEGYASGGGSG 86 Query: 760 XLGXEPPHXPRGGXEKGXXCGG*GXLRGXXGPXXGXGG 647 G GG G GG G G G G GG Sbjct: 87 HGGGGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGG 124 Score = 33.9 bits (74), Expect = 0.16 Identities = 29/99 (29%), Positives = 29/99 (29%), Gaps = 2/99 (2%) Frame = -2 Query: 937 GGGXXGGXG-GGXGGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXG-XG 764 G G GG G GG GG GG GGG G G G G Sbjct: 103 GAGEGGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGG 162 Query: 763 GXLGXEPPHXPRGGXEKGXXCGG*GXLRGXXGPXXGXGG 647 G G H GG G G G G GG Sbjct: 163 GAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGG 201 Score = 28.3 bits (60), Expect = 7.8 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = -2 Query: 940 GGGGXXGGXGGGXG-GGXGGGXGGGXXPG 857 GG G GGG G GG GG GG G Sbjct: 98 GGYASGAGEGGGGGYGGAAGGHAGGGGGG 126 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 41.9 bits (94), Expect = 6e-04 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG GG GGG Sbjct: 159 GGGGGYGGGGGGYGGGGRGGGGGG 182 Score = 41.5 bits (93), Expect = 8e-04 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GG GGG GGG GGG Sbjct: 160 GGGGYGGGGGGYGGGGRGGGGGGG 183 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/30 (63%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = -2 Query: 940 GGGGXXGGXGG-GXGGGXGGGXGGGXXPGR 854 GGGG GG GG G GGG GGG GG GR Sbjct: 147 GGGGYGGGGGGYGGGGGYGGGGGGYGGGGR 176 Score = 39.1 bits (87), Expect = 0.004 Identities = 33/98 (33%), Positives = 34/98 (34%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXGG 761 G GG GG GGG G G G G GGG GR R G + G G Sbjct: 93 GRGGFGGGRGGGRGSGGGYGGGGGGYGGR-GGGGRGGSDCYKCGEPGHMARDCSEGGGGY 151 Query: 760 XLGXEPPHXPRGGXEKGXXCGG*GXLRGXXGPXXGXGG 647 G GG G GG G G G G GG Sbjct: 152 GGGG-------GGYGGGGGYGGGGGGYGGGGRGGGGGG 182 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG GGG GG GGG GGG G Sbjct: 156 GGYGGGGGYGGGGGGYGGGGRGGGGGGG 183 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GG GGG GGG G G G Sbjct: 87 GGGSSGGRGG-FGGGRGGGRGSGGGYG 112 Score = 32.3 bits (70), Expect = 0.48 Identities = 30/95 (31%), Positives = 30/95 (31%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXGGXLG 752 G GG G GG GGG GGG G G R G Sbjct: 84 GNSGGGSSGGRGGFGGGRGGGRGSG--------GGYGGGGGGYGGRGGGGRGGSDCYKCG 135 Query: 751 XEPPHXPRGGXEKGXXCGG*GXLRGXXGPXXGXGG 647 EP H R E G GG G G G G GG Sbjct: 136 -EPGHMARDCSEGGGGYGGGGGGYGGGGGYGGGGG 169 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 41.9 bits (94), Expect = 6e-04 Identities = 21/38 (55%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = -2 Query: 940 GGGGXXGGXGG-GXGGGXGGGXGGGXXPGRTXERXRXG 830 GGGG GG GG G GGG GGG GGG G R G Sbjct: 91 GGGGSSGGRGGFGGGGGRGGGRGGGSYGGGYGGRGSGG 128 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG G GGG GGG Sbjct: 154 GGGGYSGGGGGGRYGSGGGGGGGG 177 Score = 36.7 bits (81), Expect = 0.022 Identities = 18/30 (60%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGX-GGGXGGGXXPGR 854 GG G GG GGG GGG GGG GG GR Sbjct: 100 GGFGGGGGRGGGRGGGSYGGGYGGRGSGGR 129 Score = 36.3 bits (80), Expect = 0.029 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GG GG G G G Sbjct: 104 GGGGRGGGRGGGSYGGGYGGRGSGGRGG 131 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGG G GGG GG GG GGG Sbjct: 109 GGGRGGGSYGGGYGGRGSGGRGGG 132 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG 875 GGG GG GG GG GGG G Sbjct: 113 GGGSYGGGYGGRGSGGRGGGGG 134 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGG 884 GGGG G GGG GGG GG Sbjct: 161 GGGGGRYGSGGGGGGGGGG 179 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = -2 Query: 937 GGGXXGGXGGGXGG-GXGGGXGGGXXPG 857 G GG GG GG G GGG GGG G Sbjct: 88 GNSGGGGSSGGRGGFGGGGGRGGGRGGG 115 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GG G G GG GG Sbjct: 113 GGGSYGGGYGGRGSGGRGGGGG 134 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/58 (31%), Positives = 19/58 (32%) Frame = -3 Query: 933 GGXXXGXGXXXXGGXXGXXXXXXXXXXXXXXXGXGXXGGGGXGGGGXPXEXAXRGGGG 760 GG G G GG G GGG GGGG + GGGG Sbjct: 118 GGGYGGRGSGGRGGGGGDNSCFKCGEPGHMARECSQGGGGYSGGGGGGRYGSGGGGGG 175 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG G GGG GG G G GGG G Sbjct: 154 GGG--GYSGGGGGGRYGSGGGGGGGGG 178 Score = 28.7 bits (61), Expect = 5.9 Identities = 20/63 (31%), Positives = 21/63 (33%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGGX*XXNLPTXPGGGXKRXXSXXXXXXXXXXXGXKXGR 652 G GGG GGG RGGGG G R S G + G Sbjct: 110 GGRGGGSYGGGYGGRGSGGRGGGGGDNSCFKCGEPGHMARECSQGGGGYSGGGGGGRYGS 169 Query: 651 GGG 643 GGG Sbjct: 170 GGG 172 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P PP PPP PP PPP PPPP Sbjct: 23 PPLQTQPTTPSAPPPVTPPPSPPQSPPPVVSSSPPPP 59 Score = 32.7 bits (71), Expect = 0.36 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = +1 Query: 796 PPSPPX--PXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PPSPP PP P P + P P P P P T PPP Sbjct: 71 PPSPPVITSPPPTVASSPPPPVVIASPPPSTPATTP-PAPPQTVSPPPP 118 Score = 32.3 bits (70), Expect = 0.48 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P PP P P P PP Sbjct: 133 PPPKPSPSPPGETPSPPGETPSPP 156 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPX-PPPXPPPXPPPXPPXXPPPP 941 P +S V+ PPP P P PPP PP PP Sbjct: 44 PPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPP 81 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 4/28 (14%) Frame = +3 Query: 870 PPPX--PPPXPP--PXPPPXPPXXPPPP 941 PPP PPP PP PPP PPPP Sbjct: 64 PPPSSSPPPSPPVITSPPPTVASSPPPP 91 Score = 31.5 bits (68), Expect = 0.84 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 V P PP PPP PPP PPP Sbjct: 38 VTPPPSPPQSPPPVVSSSPPPPVVSSPPP 66 Score = 31.5 bits (68), Expect = 0.84 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 2/49 (4%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXP--XPXPXXPPXPXXPXTXXXPPP 936 PPSPP PP P P P P P P P T PP Sbjct: 41 PPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVASSPP 89 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP P P PP PSP P P P P P T PPP Sbjct: 133 PPPKPSPSPPGET--PSPPGETPSPPKPSPSTPT----PTTTTSPPP 173 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 6/30 (20%) Frame = +3 Query: 870 PPPX----PPPXPPPXPPPXPP--XXPPPP 941 PPP PPP P PP PP PPPP Sbjct: 89 PPPVVIASPPPSTPATTPPAPPQTVSPPPP 118 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 PPP P PP PP PPP Sbjct: 97 PPPSTPATTPPAPPQTVSPPPPP 119 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP PP P PPP PP P Sbjct: 106 PPAPPQTVSPPPPPDASPSPPAP 128 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P S S P PP P PP P PP P P Sbjct: 119 PDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSP 155 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPX--PPPXPPXXPPPP 941 P P PP PP PPP P P PP Sbjct: 97 PPPSTPATTPPAPPQTVSPPPPPDASPSPP 126 Score = 29.1 bits (62), Expect = 4.5 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PP P PP PP P P P Sbjct: 102 PATTPPAPPQTVSPPPPPDASPSPPAP 128 Score = 29.1 bits (62), Expect = 4.5 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPP 933 PSPP P PSP P P P P P T PP Sbjct: 139 PSPPGETPSPPGETPSPPKPSPSTPTPTTTTSP-PPPPATSASPP 182 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 41.1 bits (92), Expect = 0.001 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PPP P P P PP PPPP Sbjct: 75 PAPVPPVSPPPPTPSVPSPTPPVSPPPP 102 Score = 37.9 bits (84), Expect = 0.010 Identities = 22/72 (30%), Positives = 25/72 (34%), Gaps = 2/72 (2%) Frame = +3 Query: 732 GXWGGSXPXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPP--PXPPPXPPPX 905 G GG P P P P + + +P PP P PP P Sbjct: 67 GDDGGYTPPAPVPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSV 126 Query: 906 PPPXPPXXPPPP 941 P P PP PPPP Sbjct: 127 PSPTPPVSPPPP 138 Score = 37.5 bits (83), Expect = 0.013 Identities = 24/99 (24%), Positives = 29/99 (29%), Gaps = 2/99 (2%) Frame = +1 Query: 646 APPXPFXAPXTPAXT--LNPHTXXXXXXXXXXXXXXXXXXXXXXPXSXFXWXPPSPPXPX 819 +PP P P P+ T ++P P P SPP P Sbjct: 98 SPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPT 157 Query: 820 PPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P P+P P P P P P P PP Sbjct: 158 PTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPP 196 Score = 36.7 bits (81), Expect = 0.022 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +3 Query: 855 LPGXXPP--PXPPPXPPPXPPPXPPXXPPPP 941 +P PP P PP P P P PP PPPP Sbjct: 126 VPSPTPPVSPPPPTPTPSVPSPTPPVSPPPP 156 Score = 35.9 bits (79), Expect = 0.039 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 P P PP P P P PP PPPP Sbjct: 163 PSPTPPVPTDPMPSPPPPVSPPPP 186 Score = 32.3 bits (70), Expect = 0.48 Identities = 20/65 (30%), Positives = 22/65 (33%), Gaps = 2/65 (3%) Frame = +3 Query: 753 PXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPP-PXPPPXP-PX 926 P +PP P P S+ P P P P PP PPP P P Sbjct: 132 PVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPS 191 Query: 927 XPPPP 941 P PP Sbjct: 192 VPSPP 196 Score = 31.9 bits (69), Expect = 0.63 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 +P PP PPP P P PP P P Sbjct: 174 MPSPPPPVSPPPPTPTPSVPSPPDVTPTP 202 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/47 (36%), Positives = 19/47 (40%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P SPP P P P+P S P P P P P P + P P Sbjct: 96 PVSPPPPTPTPSVPSPTPPVS-PPPPTPTPSV-PSPTPPVSPPPPTP 140 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/49 (34%), Positives = 19/49 (38%), Gaps = 3/49 (6%) Frame = +1 Query: 796 PPSP-PXPXPPXXXXXPSPXFSLXXXP--XPXPXXPPXPXXPXTXXXPP 933 P P P P PP P+P S+ P P P P P P PP Sbjct: 170 PTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPP 218 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/48 (35%), Positives = 20/48 (41%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 PP+P P PP P P S+ P P PP P T PP+ Sbjct: 202 PPTPSVPSPPDVTPTP-PTPSVPSPPDVTP-TPPTPPSVPTPSGSPPY 247 >At2g05440.2 68415.m00575 glycine-rich protein Length = 154 Score = 41.1 bits (92), Expect = 0.001 Identities = 34/100 (34%), Positives = 35/100 (35%), Gaps = 2/100 (2%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXGG 761 GG G GG GGG G G GG GGG G + G G G GG Sbjct: 45 GGHGGHGGHGGGGGHGHGGHNGGG---GHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGG 101 Query: 760 XLGXEPPHXPRGGXEK--GXXCGG*GXLRGXXGPXXGXGG 647 G H GG G GG G G G G GG Sbjct: 102 HYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGGGG 141 Score = 37.1 bits (82), Expect = 0.017 Identities = 29/91 (31%), Positives = 29/91 (31%) Frame = -2 Query: 919 GXGGGXGGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXGGXLGXEPP 740 G GGG GG G G GGG G G G G GG G Sbjct: 42 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGG 101 Query: 739 HXPRGGXEKGXXCGG*GXLRGXXGPXXGXGG 647 H GG G GG G G G GG Sbjct: 102 HYGGGGGHYGGGGGGHGGGGHYGGGGGGYGG 132 Score = 33.1 bits (72), Expect = 0.27 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 3/31 (9%) Frame = -2 Query: 940 GGGGXXGGX---GGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG G G GGG GG G Sbjct: 113 GGGGHGGGGHYGGGGGGYGGGGGHHGGGGHG 143 >At4g29030.1 68417.m04151 glycine-rich protein glycine-rich protein - Onobrychis viciifolia,PID:g2565429 Length = 115 Score = 40.7 bits (91), Expect = 0.001 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG G G GGG GGG G Sbjct: 75 GGGLGGGLGGGAGSGLGGGLGGGSGIG 101 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GG GGG GGG G G GGG G Sbjct: 70 GFGGAGGGLGGGLGGGAGSGLGGGLGGG 97 Score = 37.5 bits (83), Expect = 0.013 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG GGG GGG GGG G G G Sbjct: 67 GYGGFGGAGGGLGGGLGGGAGSGLGGG 93 Score = 35.1 bits (77), Expect = 0.068 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -2 Query: 940 GGGGXXGGXG-GGXGGGXGGGXGGGXXPG 857 G GG G G GG GGG GGG GGG G Sbjct: 61 GPGGNLGYGGFGGAGGGLGGGLGGGAGSG 89 Score = 35.1 bits (77), Expect = 0.068 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGG--GXGGGXXPGRT 851 GGG GG G G GGG GG G G G G T Sbjct: 79 GGGLGGGAGSGLGGGLGGGSGIGAGTSGGST 109 Score = 31.9 bits (69), Expect = 0.63 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXG--GGXXPG 857 GGG G GGG GGG G G G GG G Sbjct: 83 GGGAGSGLGGGLGGGSGIGAGTSGGSTGG 111 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGG--GXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG G G G G GG GGG GGG G Sbjct: 56 GGGVSGPGGNLGYGGFGGAGGGLGGGLGGG 85 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG G GG G G GG GGG G Sbjct: 54 GVGGGVSGPGGNLGYGGFGGAGGGLGGG 81 Score = 28.3 bits (60), Expect = 7.8 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGG G G G GGG GGG G G Sbjct: 79 GGGLGGGA-GSGLGGGLGGGSGIG 101 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/26 (61%), Positives = 16/26 (61%), Gaps = 2/26 (7%) Frame = +3 Query: 870 PPPXPPPXPPPX--PPPXPPXXPPPP 941 PPP PP PPP PPP PP PPP Sbjct: 413 PPPPSPPLPPPVYSPPPSPPVFSPPP 438 Score = 35.5 bits (78), Expect = 0.051 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PPSPP P PP PSP P PP P + PPP Sbjct: 415 PPSPPLP-PPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPP 460 Score = 35.5 bits (78), Expect = 0.051 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PP PP PP PPPP Sbjct: 432 PVFSPPPSPPVYSPPPPPSIHYSSPPPP 459 Score = 34.7 bits (76), Expect = 0.090 Identities = 17/28 (60%), Positives = 17/28 (60%), Gaps = 4/28 (14%) Frame = +3 Query: 870 PPPX--PPPXPPPX-PPPXPP-XXPPPP 941 PPP PPP PP PPP PP PPPP Sbjct: 421 PPPVYSPPPSPPVFSPPPSPPVYSPPPP 448 Score = 34.3 bits (75), Expect = 0.12 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 885 PPXPPPXPPPXPPXXPPPP 941 PP PPP PP PP PPP Sbjct: 411 PPPPPPSPPLPPPVYSPPP 429 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 7/35 (20%) Frame = +3 Query: 858 PGXXPPPXPPPX--PPPXP-----PPXPPXXPPPP 941 P PP PPP PPP P PP PP PPP Sbjct: 413 PPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPP 447 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +3 Query: 837 RSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 RS+ P P PPP PP PPP P PP Sbjct: 398 RSVVKPSPPIVALPPPPPPSPPLPPPVYSPPPSPP 432 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPPPXPPP-XPPPXPPPXPPXXPPPP 941 P PPP PP PPP PP P PPPP Sbjct: 423 PVYSPPPSPPVFSPPPSPPVYSP--PPPP 449 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 6/34 (17%) Frame = +3 Query: 858 PGXXPPPXPPPXPP------PXPPPXPPXXPPPP 941 P PP PP PP P PPP PPPP Sbjct: 436 PPPSPPVYSPPPPPSIHYSSPPPPPVHHSSPPPP 469 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 4/50 (8%) Frame = +1 Query: 799 PSPPX----PXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PSPP P PP P P +S P P P P P PPP Sbjct: 403 PSPPIVALPPPPPPSPPLPPPVYS---PPPSPPVFSPPPSPPVYSPPPPP 449 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PP P PPP PPP Sbjct: 431 PPVFSPPPSPPVYSPPPPPSIHYSSPPP 458 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 S + + P PP PPP PPP P P PPPP Sbjct: 16 SQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPP 49 Score = 39.5 bits (88), Expect = 0.003 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP P P PP PPPP Sbjct: 26 PPSLPPPVPPPPPSHQPYSYPPPPPPPP 53 Score = 36.3 bits (80), Expect = 0.029 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 4/32 (12%) Frame = +3 Query: 858 PGXXPPPXPPPX----PPPXPPPXPPXXPPPP 941 P P P PP PPP PP PP PPPP Sbjct: 6 PPYPPLPQPPSQNSLAPPPPPPSLPPPVPPPP 37 Score = 33.1 bits (72), Expect = 0.27 Identities = 21/54 (38%), Positives = 22/54 (40%), Gaps = 4/54 (7%) Frame = +1 Query: 790 WXPPSPPXPXPP--XXXXXPSPXFSLXXXPXPXPXXPP--XPXXPXTXXXPPPH 939 + PP PP P PP P P SL P P P PP P PPPH Sbjct: 4 YRPPYPPLPQPPSQNSLAPPPPPPSL---PPPVPPPPPSHQPYSYPPPPPPPPH 54 Score = 31.9 bits (69), Expect = 0.63 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 PPP PPP PP P PP P Sbjct: 72 PPPPPPPSAPPPLVPDPPRHQGP 94 Score = 29.1 bits (62), Expect = 4.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 888 PXPPPXPPPXPPXXPPPP 941 P PPP P PP P PP Sbjct: 72 PPPPPPPSAPPPLVPDPP 89 Score = 28.7 bits (61), Expect = 5.9 Identities = 17/53 (32%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Frame = +1 Query: 784 FXWXPPSPPXPXPPXXXXXPSPXFS-LXXXPXPXPXXPPXPXXPXTXXXPPPH 939 + + PP PP P P F+ L P P P P P P PP H Sbjct: 43 YSYPPPPPPPPHAYYQQGPHYPQFNQLQAPPPPPPPSAPPPLVP----DPPRH 91 >At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 839 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRTXER 842 GGG GG GGG GG GGG GGG G R Sbjct: 788 GGGHHGGGGGGCGGCGGGGCGGGGDGGGMTSR 819 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GG GGG GG GGG G Sbjct: 783 GGGGCGGGHHGGGGGGCGGCGGGGCGGG 810 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GG GG GGG GGG Sbjct: 794 GGGGGCGGCGG--GGCGGGGDGGG 815 Score = 33.1 bits (72), Expect = 0.27 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GG GG GGG GG GGG GG Sbjct: 779 GGHHGGGGCGGGHHGGGGGGCGG 801 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXP---PXXPPPP 941 PG P P PPP P P PPP P P PPP Sbjct: 26 PGPSPCPSPPPKPQPKPPPAPSPSPCPSPPP 56 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP P P PPP P P P PP P Sbjct: 77 PKPAPPPEPKPAPPPAPKPVPCPSPPKP 104 Score = 39.5 bits (88), Expect = 0.003 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP P P P P PPP P P PP Sbjct: 38 PQPKPPPAPSPSPCPSPPPKPQPKPVPP 65 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = +1 Query: 796 PPSP-PXPXP-PXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP P P P P P PSP P P P PP P P PPP Sbjct: 35 PPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPP 83 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 V P PP P P P P PPP P PPP Sbjct: 63 VPPPACPPTPPKPQPKPAPPPEPKPAPPP 91 Score = 37.9 bits (84), Expect = 0.010 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P P PPP P P PP P P Sbjct: 69 PPTPPKPQPKPAPPPEPKPAPPPAPKP 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 +P PPP P P P P P P P PP P Sbjct: 112 VPPHGPPPKPAPAPTPAPSPKPAPSPPKP 140 Score = 37.5 bits (83), Expect = 0.013 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P P P P P P PPP P PP P Sbjct: 48 PSPCPSPPPKPQPKPVPPPACPPTPPKP 75 Score = 37.5 bits (83), Expect = 0.013 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P P P P PPP PP PP P P Sbjct: 52 PSPPPKPQPKPVPPPACPPTPPKPQPKP 79 Score = 37.1 bits (82), Expect = 0.017 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P PPP P P P P PP P P Sbjct: 34 PPPKPQPKPPPAPSPSPCPSPPPKPQP 60 Score = 37.1 bits (82), Expect = 0.017 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P P PPP P P P P P P PP Sbjct: 46 PSPSPCPSPPPKPQPKPVPPPACPPTPP 73 Score = 37.1 bits (82), Expect = 0.017 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P PPP P P PPP P P P Sbjct: 73 PKPQPKPAPPPEPKPAPPPAPKPVPCP 99 Score = 37.1 bits (82), Expect = 0.017 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P PPP P P P P PP P P Sbjct: 81 PPPEPKPAPPPAPKPVPCPSPPKPPAP 107 Score = 37.1 bits (82), Expect = 0.017 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P PP P P P P PP PPP Sbjct: 93 PKPVPCPSPPKPPAPTPKPVPPHGPPP 119 Score = 36.7 bits (81), Expect = 0.022 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P P PPP PP PP P PPP Sbjct: 56 PKPQPKPVPPPACPPTPPKPQPKPAPPP 83 Score = 36.3 bits (80), Expect = 0.029 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P P PPP P P PP P P Sbjct: 22 PVAPPGPSPCPSPPPKPQPKPPPAPSP 48 Score = 35.9 bits (79), Expect = 0.039 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPPPXPP-PXPPPXPPXXPPP 938 P PPP PP PP P P P PP P P Sbjct: 60 PKPVPPPACPPTPPKPQPKPAPPPEPKP 87 Score = 35.1 bits (77), Expect = 0.068 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P PP PPP P P P P P Sbjct: 105 PAPTPKPVPPHGPPPKPAPAPTPAPSP 131 Score = 34.7 bits (76), Expect = 0.090 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PSPP P PSP P P P P P P T P P Sbjct: 32 PSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQP 77 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG P PP P P P P P P PP Sbjct: 16 PGPSSKPVAPPGPSPCPSPPPKPQPKPP 43 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXP--PPXPPXXPPPP 941 P PPP P P P P P PP P P PP Sbjct: 85 PKPAPPPAPKPVPCPSPPKPPAPTPKPVPP 114 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 +P PP P P P P PP PP P P Sbjct: 96 VPCPSPPKPPAPTPKPVPPHGPPPKPAP 123 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P P PP PPP P P P Sbjct: 101 PPKPPAPTPKPVPPHGPPPKPAPAPTP 127 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PP PPP P P P P P P P Sbjct: 109 PKPVPPHGPPPKPAPAPTPAPSPKPAP 135 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P P P PPP P PPP Sbjct: 18 PSSKPVAPPGPSPCPSPPPKPQPKPPP 44 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPP---XPPXXPPPP 941 P P P P P PPP P P PP PP P Sbjct: 42 PPPAPSPSPCPSPPPKPQPKPVPPPACPPTP 72 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P P P P P P P P P P PP Sbjct: 75 PQPKPAPPPEPKPAPPPAPKPVPCPSPP 102 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXP-PXXPPPP 941 P P P P P P P P P P P PP P Sbjct: 79 PAPPPEPKPAPPPAPKPVPCPSPPKPPAP 107 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXP-PPXPPXXPPPP 941 P P P P P P P P PP PP P P Sbjct: 83 PEPKPAPPPAPKPVPCPSPPKPPAPTPKP 111 Score = 32.7 bits (71), Expect = 0.36 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +1 Query: 796 PPSPPXPXP-PXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXP 930 PP PP P P P P P + P P P P P P P Sbjct: 101 PPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPPKPENKTIP 146 Score = 32.3 bits (70), Expect = 0.48 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PSP PP P P S P P P P P P PP Sbjct: 28 PSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPP 73 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 3/26 (11%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXP---PXXPPPP 941 PP P P P P PP P P PP P Sbjct: 3 PPTPDPSPKPVAPPGPSSKPVAPPGP 28 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPPPXPPPXP-PPXPPPXPPXXPPPP 941 P PP P P P PP PP P P P Sbjct: 99 PSPPKPPAPTPKPVPPHGPPPKPAPAPTP 127 Score = 29.9 bits (64), Expect = 2.6 Identities = 18/52 (34%), Positives = 20/52 (38%), Gaps = 4/52 (7%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXP----XTXXXPPPH 939 PP+ P P PP P+P P P P P P P T PPH Sbjct: 65 PPACP-PTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPH 115 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXP--PPXPPXXPPPP 941 P P P PP P P PP P P PP Sbjct: 6 PDPSPKPVAPPGPSSKPVAPPGPSPCPSPP 35 Score = 29.5 bits (63), Expect = 3.4 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 3/49 (6%) Frame = +1 Query: 796 PPSP---PXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPP 933 PP P P P P P P P P P PP P P PP Sbjct: 55 PPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAP-KPVPCPSPP 102 Score = 28.3 bits (60), Expect = 7.8 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = +1 Query: 796 PPSP-PXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP P P P PP P P P P P P P P PPP Sbjct: 25 PPGPSPCPSPP-----PKPQPKPPPAPSPSPC-PSPPPKPQPKPVPPP 66 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/44 (29%), Positives = 14/44 (31%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXP 930 P P P PP P P P P P P P + P Sbjct: 97 PCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPPKP 140 >At4g30460.1 68417.m04325 glycine-rich protein Length = 162 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG G G G Sbjct: 120 GGGGGHGGGGGG-GGGRGGGGGSGNGEG 146 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG G G GGG G G G Sbjct: 121 GGGGHGGGGGGGGGRGGGGGSGNGEGYG 148 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG G G G GGG GGG GGG Sbjct: 137 GGGGSGNGEGYGEGGGYGGGYGGG 160 Score = 37.9 bits (84), Expect = 0.010 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG GGG GGG G G GGG G Sbjct: 118 GSGGGGGHGGGGGGGGGRGGGGGSGNG 144 Score = 37.5 bits (83), Expect = 0.013 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG G G GGG GGG GGG G Sbjct: 116 GRGSGGGGGHGGGGGGGGGRGGGGGSG 142 Score = 37.5 bits (83), Expect = 0.013 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG GGG GGG G G G G G Sbjct: 123 GGHGGGGGGGGGRGGGGGSGNGEGYGEG 150 Score = 36.7 bits (81), Expect = 0.022 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG G G G G G G G Sbjct: 127 GGGGGGGGRGGGGGSGNGEGYGEGGGYG 154 Score = 36.7 bits (81), Expect = 0.022 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GGG G G G G GGG G Sbjct: 129 GGGGGGRGGGGGSGNGEGYGEGGGYGGG 156 Score = 36.7 bits (81), Expect = 0.022 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG G G G G GGG GGG G Sbjct: 133 GGRGGGGGSGNGEGYGEGGGYGGGYGGG 160 Score = 35.9 bits (79), Expect = 0.039 Identities = 27/97 (27%), Positives = 28/97 (28%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXGG 761 GGGG G G G G G GGG + G G GG Sbjct: 51 GGGGSGSGAGAGSGSG-GGGSSSSSSSSSSSSSSSGGGGGDAGSEAGSYAGSHAGSGSGG 109 Query: 760 XLGXEPPHXPRGGXEKGXXCGG*GXLRGXXGPXXGXG 650 G GG G GG G G G G G Sbjct: 110 RSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEG 146 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG G G GGG G G G G G Sbjct: 126 GGGGGGGGGRGGGGGSGNGEGYGEGGG 152 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -1 Query: 941 GWGGGXXXVXGXXGXGGXXGXGXGXXSRENXGEGXXXXXGGXGXGGEGG 795 G GGG G G G G S G G G G GG GG Sbjct: 85 GGGGGDAGSEAGSYAGSHAGSGSGGRSGSGRGRGSGGGGGHGGGGGGGG 133 >At4g08230.1 68417.m01358 glycine-rich protein Length = 113 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GG GGG GGG G Sbjct: 59 GGGMGGGGGGGGGSGGGGGGRGGGPPRG 86 Score = 37.9 bits (84), Expect = 0.010 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPGR 854 GG GG GGG GG GGG G G P R Sbjct: 59 GGGMGGGGGGGGGSGGGGGGRGGGPPR 85 Score = 35.5 bits (78), Expect = 0.051 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GG GG GG Sbjct: 64 GGGGGGGGSGGGGGGRGGGPPRGG 87 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGG 763 G GGGG GGGG RGGG Sbjct: 60 GGMGGGGGGGGGSGGGGGGRGGG 82 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 913 GGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GG GGG GGG GG GR R G Sbjct: 60 GGMGGGGGGGGGSGGGGGGRGGGPPRGG 87 >At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative similar to SP|P52597 Heterogeneous nuclear ribonucleoprotein F (hnRNP F) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 350 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/39 (51%), Positives = 21/39 (53%), Gaps = 4/39 (10%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG----GGXXPGRTXERXR 836 GGGG GG G GGG GGG G GG P R +R R Sbjct: 211 GGGGGLGGGNGSGGGGGGGGGGGRISGGSSPRRHVQRAR 249 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GGG GGG G G GGG G Sbjct: 207 GMASGGGGGLGGGNGSGGGGGGGGG 231 >At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 633 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG G G GGG GGG GG G Sbjct: 596 GGGGYGGGGGYGGGGGYGGGYGGASSGG 623 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GGG GGG G G GGG G Sbjct: 588 GGGGGGYGGGGGYGGGGGYGGGGGYGGG 615 Score = 38.3 bits (85), Expect = 0.007 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GG GGG G G GGG GGG G Sbjct: 586 GYGGGGGGYGGGGGYGGGGGYGGGGGYG 613 Score = 38.3 bits (85), Expect = 0.007 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG G G GGG GGG G G G Sbjct: 590 GGGGYGGGGGYGGGGGYGGGGGYGGGYG 617 Score = 36.7 bits (81), Expect = 0.022 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG GGG GGG G G GGG G Sbjct: 583 GRGGYGGGGGGYGGGGGYGGGGGYGGG 609 Score = 34.7 bits (76), Expect = 0.090 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -2 Query: 940 GGGGXXGGXGG-GXGGGXGGGXGGGXXPG 857 G GG GG GG G GGG GGG G G G Sbjct: 583 GRGGYGGGGGGYGGGGGYGGGGGYGGGGG 611 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GG G GG GGG GG GG GG Sbjct: 604 GGYGGGGGYGGGYGGASSGGYGG 626 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/27 (59%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = -2 Query: 934 GGXXGGXGGGXGG-GXGGGXGGGXXPG 857 G GG GGG GG G GGG GGG G Sbjct: 581 GSGRGGYGGGGGGYGGGGGYGGGGGYG 607 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG GGG GG GGG G Sbjct: 578 GSFGSGRGGYGGGGGGYGGGGGYGG 602 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = -2 Query: 937 GGGXXG-GXGGGXGGGXGGGXGGGXXPG 857 G G G G GGG GG GG GGG G Sbjct: 581 GSGRGGYGGGGGGYGGGGGYGGGGGYGG 608 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG GGG G G GGG G Sbjct: 578 GSFGSGRGGYGGGGGGYGGGGGYGGG 603 Score = 28.3 bits (60), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 822 GGGGXGGGGXPXEXAXRGGGG 760 GGGG GGGG GGGG Sbjct: 590 GGGGYGGGGGYGGGGGYGGGG 610 >At1g53625.1 68414.m06096 expressed protein Length = 89 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG G G GGG G Sbjct: 59 GGGDGGGDGGGDGGGGGCGGGGGCGGG 85 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG G G GGG GGG G Sbjct: 63 GGGDGGGDGGGGGCGGGGGCGGGGGGG 89 Score = 35.9 bits (79), Expect = 0.039 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GG G G GGG GGG G G GGG Sbjct: 64 GGDGGGDGGGGGCGGGGGCGGGGG 87 Score = 35.1 bits (77), Expect = 0.068 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 G GG GG GG GGG GG GGG Sbjct: 65 GDGGGDGGGGGCGGGGGCGGGGGG 88 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG 875 GG G GG GGG G G GGG G Sbjct: 68 GGDGGGGGCGGGGGCGGGGGGG 89 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GG GG GGG GG Sbjct: 67 GGGDGGGGGCGGGGGCGGGGGGG 89 >At1g11850.2 68414.m01364 expressed protein Length = 108 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/26 (69%), Positives = 18/26 (69%), Gaps = 2/26 (7%) Frame = -2 Query: 940 GGGGXXGGXGGG--XGGGXGGGXGGG 869 GGGG GG GGG GGG GGG GGG Sbjct: 78 GGGGGLGGGGGGLLGGGGFGGGAGGG 103 Score = 35.5 bits (78), Expect = 0.051 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG GGG GGG GG GGG G Sbjct: 71 GAGLGLGGGGGGLGGGGGGLLGGGGFGG 98 Score = 35.5 bits (78), Expect = 0.051 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGGG GG GG GGG GGG GG Sbjct: 86 GGGGLLGG--GGFGGGAGGGLGG 106 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GG GGG GG GGG GG G Sbjct: 75 GLGGGGGGLGGGGGGLLGGGGFGGGAGG 102 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXG-GGXGGGXXPG 857 GGGG G G G GGG G GG G G G Sbjct: 41 GGGGSGDGLGLGLGGGAGLGGLGIGAGIG 69 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 3/27 (11%) Frame = -2 Query: 940 GGGGXXGGXGGGXG---GGXGGGXGGG 869 GG G G G G G GG GGG GGG Sbjct: 60 GGLGIGAGIGAGAGLGLGGGGGGLGGG 86 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 G G G G G GGG GG GGG Sbjct: 65 GAGIGAGAGLGLGGGGGGLGGGG 87 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 G G G GGG GGG GGG GG Sbjct: 69 GAGAGLGLGGG-GGGLGGGGGG 89 Score = 29.1 bits (62), Expect = 4.5 Identities = 22/67 (32%), Positives = 22/67 (32%), Gaps = 1/67 (1%) Frame = -3 Query: 936 GGGXXXGXGXXXXGGXXGXXXXXXXXXXXXXXXGXGXXGGG-GXGGGGXPXEXAXRGGGG 760 GGG G G GG G G GGG G GGGG GG G Sbjct: 42 GGGSGDGLGLGLGGGAGLGGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLGGGGFGGGAG 101 Query: 759 X*XXNLP 739 LP Sbjct: 102 GGLGGLP 108 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG G G G G G G G G G Sbjct: 54 GGGAGLGGLGIGAGIGAGAGLGLGGGGG 81 Score = 29.1 bits (62), Expect = 4.5 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 4/31 (12%) Frame = -2 Query: 937 GGGXXGGXGG-GXGGG---XGGGXGGGXXPG 857 G G GG GG G GGG GGG GGG G Sbjct: 73 GLGLGGGGGGLGGGGGGLLGGGGFGGGAGGG 103 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 GGG G GGG GG GG GG Sbjct: 84 GGGGGGLLGGGGFGGGAGGGLGG 106 >At1g04800.1 68414.m00476 glycine-rich protein Length = 200 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GG GGG GGG GGG G Sbjct: 71 GGGWIGGSVGGFGGGIGGGFGGGGFGG 97 Score = 37.1 bits (82), Expect = 0.017 Identities = 17/27 (62%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGG-GXGGGXXPG 857 GG GG GGG GGG GG G GGG G Sbjct: 76 GGSVGGFGGGIGGGFGGGGFGGGAGKG 102 Score = 34.7 bits (76), Expect = 0.090 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG G G GGG GG GG G Sbjct: 58 GGGGISGGGGFGAGGGWIGGSVGGFGGG 85 Score = 34.7 bits (76), Expect = 0.090 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG GG GG GGG GGG G Sbjct: 66 GGFGAGGGWIGGSVGGFGGGIGGGFGGG 93 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGG 869 GG GG GGG G GGG GGG Sbjct: 177 GGAIGGIGGGAGKEIGGGIGGG 198 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/27 (59%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = -2 Query: 934 GGXXGGXGGG-XGGGXGGGXGGGXXPG 857 GG GG GGG GGG GGG G G G Sbjct: 80 GGFGGGIGGGFGGGGFGGGAGKGVDGG 106 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/28 (57%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -2 Query: 937 GGGXXGGXGGGX-GGGXGGGXGGGXXPG 857 GGG GG GGG GGG G G GG G Sbjct: 83 GGGIGGGFGGGGFGGGAGKGVDGGFGKG 110 Score = 33.1 bits (72), Expect = 0.27 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG G G GG G G G Sbjct: 87 GGGFGGGGFGGGAGKGVDGGFGKGVDGG 114 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG GG GGG G GGG G Sbjct: 172 GKGVDGGAIGGIGGGAGKEIGGGIGGG 198 Score = 29.1 bits (62), Expect = 4.5 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GG G G GGG GG G Sbjct: 57 GGG--GGISGGGGFGAGGGWIGGSVGG 81 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP P PPP PPP P PPPP Sbjct: 369 PRRSPPPLQTPPPPPPPPPLAP--PPPP 394 Score = 37.9 bits (84), Expect = 0.010 Identities = 18/28 (64%), Positives = 18/28 (64%), Gaps = 4/28 (14%) Frame = +3 Query: 870 PPPX--PPPX--PPPXPPPXPPXXPPPP 941 PPP PPP PPP PPP PP PPPP Sbjct: 367 PPPRRSPPPLQTPPPPPPP-PPLAPPPP 393 Score = 34.7 bits (76), Expect = 0.090 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P P PPP PPP PP PP P Sbjct: 373 PPPLQTPPPPPPPPPLAPPPPPQKRP 398 Score = 33.1 bits (72), Expect = 0.27 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPP 923 P R L PPP PPP PP PP P Sbjct: 368 PPRRSPPPLQTPPPPPPPPPLAPPPPPQKRP 398 >At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; glycine-rich protein 16 (GRP16) PMID:11431566 Length = 244 Score = 39.5 bits (88), Expect = 0.003 Identities = 29/101 (28%), Positives = 33/101 (32%), Gaps = 2/101 (1%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXGG 761 GGG GG GG GG GG GG G + GP G GG Sbjct: 139 GGGDKPGGASGGGPGGASGGASGGASGGASGGASGGASGGGPGGASGGGPGGASGGGPGG 198 Query: 760 XLGXEPPHXPRG--GXEKGXXCGG*GXLRGXXGPXXGXGGR 644 G P G G + G GG + P GG+ Sbjct: 199 ASGGASGDKPEGAPGDKPGGAWGGKPGKKPGHKPEGARGGK 239 Score = 28.3 bits (60), Expect = 7.8 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG G GG GGG PG Sbjct: 121 GEMSGAGGPSGDKPGGASGGGDKPG 145 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXPPP--XPPPXPPXXPPPP 941 P P P PPP PP PPP P PPPP Sbjct: 86 PALPPKPLPPPLSPPQTTPPPPPAITPPPP 115 Score = 39.1 bits (87), Expect = 0.004 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP P PPP P PP PPPP Sbjct: 100 PQTTPPPPPAITPPPPPAITPPLSPPPP 127 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PP PP PP P PPPP Sbjct: 108 PAITPPP-PPAITPPLSPPPPAITPPPP 134 Score = 35.9 bits (79), Expect = 0.039 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPP-XPPPXPPPXPPXXPPP 938 P L+ P P P PPP PP PP PP PP Sbjct: 131 PPPPLATTPPALPPKPLPPPLSPPQTTPPPPPAITPP 167 Score = 35.9 bits (79), Expect = 0.039 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG P PPP PP P PP PPP Sbjct: 254 PGPSPTISPPPLPPQTLKPPPPQTTPPP 281 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 4/31 (12%) Frame = +3 Query: 858 PGXXPPPXPP----PXPPPXPPPXPPXXPPP 938 P PPP PP P PP PP PP PP Sbjct: 258 PTISPPPLPPQTLKPPPPQTTPPPPPAITPP 288 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP PP P PPP PPP Sbjct: 90 PKPLPPPLSPPQTTPPPPPAITPPPPP 116 Score = 33.1 bits (72), Expect = 0.27 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 P PPP P P PP P P PP Sbjct: 42 PGPPPPQPDPQPPTPPTFQPAPP 64 Score = 33.1 bits (72), Expect = 0.27 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 2/28 (7%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPP--XPPXXPP 935 P PPP PP P PPP PP PP Sbjct: 144 PKPLPPPLSPPQTTPPPPPAITPPLSPP 171 Score = 31.9 bits (69), Expect = 0.63 Identities = 16/47 (34%), Positives = 18/47 (38%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP+ P PP P P + P P PP P T PPP Sbjct: 63 PPANDQPPPPPQSTSPPPVATTPPALPPKPLPPPL-SPPQTTPPPPP 108 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P +++ P PP PP P P P P PPPP Sbjct: 125 PPPAITPPPPLATTPPALPPKPLPPPLSPPQTTPPPP 161 Score = 31.5 bits (68), Expect = 0.84 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PP P P P P PPPP Sbjct: 80 PVATTPPALPPKPLPPPLSPPQTTPPPP 107 Score = 31.5 bits (68), Expect = 0.84 Identities = 14/46 (30%), Positives = 15/46 (32%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPP 933 PP P PP P P + P P PP P PP Sbjct: 99 PPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPP 144 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPP-PXPPXXPPP 938 LS P PPP PP PP P PP PP Sbjct: 122 LSPPPPAITPPPPLATTPPALPPKPLPPPLSPP 154 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P PP P PPP P PP PP Sbjct: 267 PQTLKPPPPQTTPPPPPAITPPLSPP 292 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPPP---XPPPXPPPXPPXXPPPP 941 P PP PPP PPP PP PP P Sbjct: 116 PAITPPLSPPPPAITPPPPLATTPPALPPKP 146 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPX---PPPXPPXXPPPP 941 + P PPP PPP PP PP PPP Sbjct: 118 ITPPLSPPPPAITPPPPLATTPPALPPKPLPPP 150 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPP--XPXXPXTXXXPPP 936 PP PP P P +L P P P PP P P PPP Sbjct: 69 PPPPPQSTSPPPVATTPP--ALPPKPLPPPLSPPQTTPPPPPAITPPPP 115 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPP---PXPPPXPPPXPPPXPPXXPPPP 941 PG PP P PP P P P PPPP Sbjct: 42 PGPPPPQPDPQPPTPPTFQPAPPANDQPPPP 72 Score = 29.5 bits (63), Expect = 3.4 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PP PP PP P Sbjct: 69 PPPPPQSTSPPPVATTPPALPPKP 92 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%) Frame = +3 Query: 870 PPPXPPPXPPPX---PPPXPPXXPPPP 941 PPP PPP PP PP PPP Sbjct: 70 PPPPQSTSPPPVATTPPALPPKPLPPP 96 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P PP PP P P + P P PP P PPP Sbjct: 92 PLPPPLSPPQTTPPPPPAIT---PPPPPAITPPLSPPPPAITPPPP 134 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 LP P PP PP PP P PP Sbjct: 265 LPPQTLKPPPPQTTPPPPPAITPPLSPP 292 Score = 28.7 bits (61), Expect = 5.9 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 5/28 (17%) Frame = +3 Query: 873 PPXPP---PXPPPX--PPPXPPXXPPPP 941 PP PP P PP PPP P PPP Sbjct: 53 PPTPPTFQPAPPANDQPPPPPQSTSPPP 80 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 39.5 bits (88), Expect = 0.003 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PPP P P P PPPP Sbjct: 71 PPPPPQSLPPPSPSPEPEHYPPPP 94 Score = 36.7 bits (81), Expect = 0.022 Identities = 18/34 (52%), Positives = 18/34 (52%), Gaps = 5/34 (14%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPP--XPPPXPPXXP---PPP 941 LP PP PPP PPP PPP P P PPP Sbjct: 60 LPLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPP 93 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXP----PPXPPPXPPXXPPPP 941 P +SL P P PPP P PPP P PPPP Sbjct: 74 PPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPPP 114 Score = 32.3 bits (70), Expect = 0.48 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P +PP P PP PSP P P P P PPP Sbjct: 66 PQTPPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPP 112 Score = 31.5 bits (68), Expect = 0.84 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 P P P P PPP P PPPP Sbjct: 52 PSPEPEDYLPLPPPPQTPPPPPPP 75 Score = 30.3 bits (65), Expect = 1.9 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 873 PPXPPPXPPPXPPP 914 PP P P PPP PPP Sbjct: 103 PPPPRPLPPPPPPP 116 Score = 29.1 bits (62), Expect = 4.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXP 920 P PPP P P PPP P Sbjct: 101 PSPPPPRPLPPPPPPP 116 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/44 (29%), Positives = 15/44 (34%) Frame = +1 Query: 808 PXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 P P P P P + P P PP P PPP+ Sbjct: 52 PSPEPEDYLPLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPPPY 95 Score = 28.7 bits (61), Expect = 5.9 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXP 903 PP P P P P + P P P PP P Sbjct: 79 PPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPPP 114 Score = 28.7 bits (61), Expect = 5.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPP 923 P PPP P PPP PP Sbjct: 101 PSPPPPRPLPPPPPPP 116 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P S P PPP PP P PPP P PPPP Sbjct: 569 PPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPP 605 Score = 37.1 bits (82), Expect = 0.017 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PP PP PP P PPPP Sbjct: 585 PSPPPPVHSPPPPPVFSPPPPVFSPPPP 612 Score = 35.9 bits (79), Expect = 0.039 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 P PP P PP P P FS P P P P P PP H Sbjct: 582 PPPPSPPPPVHSPPPPPVFS-----PPPPVFSPPPPSPVYSPPPPSH 623 Score = 35.9 bits (79), Expect = 0.039 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP P PPP P PP PPP Sbjct: 584 PPSPPPPVHSPPPPPVFSPPPPVFSPPP 611 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 5/29 (17%) Frame = +3 Query: 870 PPPXPP-PXP-PPXP---PPXPPXXPPPP 941 PPP PP P P PP P PP P PPPP Sbjct: 534 PPPQPPMPSPSPPSPIYSPPPPVHSPPPP 562 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 PPSP PP P P +S P PP P PP H Sbjct: 545 PPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVH 592 Score = 32.7 bits (71), Expect = 0.36 Identities = 17/50 (34%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXP--XPXXPPXPXXPXTXXXPPPH 939 PP PP PP P P + P P P P P T PP H Sbjct: 594 PPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPPTFSPPPTH 643 Score = 32.7 bits (71), Expect = 0.36 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP P PP PPP Sbjct: 614 PVYSPPPPSHSPPPPVYSPPPPTFSPPP 641 Score = 32.3 bits (70), Expect = 0.48 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +1 Query: 772 PXSXFXWXPPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P S PP P PP P P P P PP P P PPP Sbjct: 545 PPSPIYSPPPPVHSPPPPVYSSPPPPH---VYSPPPPVASPPPPSPPPPVHSPPP 596 Score = 32.3 bits (70), Expect = 0.48 Identities = 15/49 (30%), Positives = 16/49 (32%) Frame = +1 Query: 790 WXPPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 + PP P PP P P P PP P P PPP Sbjct: 550 YSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPP 598 Score = 32.3 bits (70), Expect = 0.48 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 7/54 (12%) Frame = +1 Query: 796 PPSPPX----PXPPXXXXXPSPXFSLXXXPXPXPXXPPXP---XXPXTXXXPPP 936 PPSPP P PP P P FS P P P P P P PPP Sbjct: 584 PPSPPPPVHSPPPPPVFSPPPPVFS---PPPPSPVYSPPPPSHSPPPPVYSPPP 634 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/50 (34%), Positives = 18/50 (36%), Gaps = 3/50 (6%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXP---XXPXTXXXPPP 936 PP PP P P SP + P P PP P P PPP Sbjct: 535 PPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPP 584 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P PP P PPP PPPP Sbjct: 543 PSPPSPIYSPPPPVHSPPPPVYSSPPPP 570 Score = 28.7 bits (61), Expect = 5.9 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP P PP P P S P P P P P PPP Sbjct: 561 PPVYSSPPPPHVYSPPPPVAS---PPPPSPPPPVHSPPPPPVFSPPP 604 >At1g29380.1 68414.m03592 hypothetical protein Length = 228 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 GGG GG GGG GGG GG GGG Sbjct: 96 GGGDVGGGGGGYGGGTPGGGGGG 118 Score = 34.7 bits (76), Expect = 0.090 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 3/31 (9%) Frame = -2 Query: 940 GGGGXXGGX---GGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GG G G GGG G Sbjct: 103 GGGGYGGGTPGGGGGGGGDTGAGAGGGGYGG 133 Score = 34.7 bits (76), Expect = 0.090 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 4/31 (12%) Frame = -2 Query: 937 GGGXXGGXGGGXG----GGXGGGXGGGXXPG 857 GGG GG GGG G G GGG GGG G Sbjct: 108 GGGTPGGGGGGGGDTGAGAGGGGYGGGGDTG 138 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG G GGG GG G G G Sbjct: 102 GGGGGYGGGTPGGGGGGGGDTGAGAGGG 129 Score = 33.1 bits (72), Expect = 0.27 Identities = 16/31 (51%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = -2 Query: 940 GGGGXX--GGXGGGXGGGXGGGXGGGXXPGR 854 GGGG G GGG GGG G GGG G+ Sbjct: 117 GGGGDTGAGAGGGGYGGGGDTGAGGGVGSGQ 147 Score = 31.5 bits (68), Expect = 0.84 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -2 Query: 940 GGGGXXGGXGGGX-GGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG G G Sbjct: 101 GGGG--GGYGGGTPGGGGGGGGDTGAGAG 127 Score = 28.7 bits (61), Expect = 5.9 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -3 Query: 822 GGGGXGGGGXPXEXAXRGGGGX*XXNLPTXPGGG 721 GGG GGGG GGGG + GGG Sbjct: 96 GGGDVGGGGGGYGGGTPGGGGGGGGDTGAGAGGG 129 Score = 28.3 bits (60), Expect = 7.8 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = -3 Query: 831 GXXGGG--GXGGGGXPXEXAXRGGGGX*XXNLPTXPGGG 721 G GGG G GGGG A GGGG T GGG Sbjct: 105 GGYGGGTPGGGGGGGGDTGAGAGGGGY-GGGGDTGAGGG 142 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPP---PXPPXXPPPP 941 P +S P PPP PP PP P P PP PPPP Sbjct: 111 PANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPP 150 Score = 36.7 bits (81), Expect = 0.022 Identities = 16/37 (43%), Positives = 18/37 (48%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P ++ P PPP PP PP P P PP P PP Sbjct: 134 PTTPITSPSPPTNPPP-PPESPPSLPAPDPPSNPLPP 169 Score = 34.3 bits (75), Expect = 0.12 Identities = 27/99 (27%), Positives = 34/99 (34%), Gaps = 1/99 (1%) Frame = +1 Query: 643 SAPPXPFXAPXTPAXTLNPHTXXXXXXXXXXXXXXXXXXXXXXPXSXFXWXPP-SPPXPX 819 S+PP P +P +P+ T P T P + PP S P P Sbjct: 69 SSPP-PEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPP 127 Query: 820 PPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP +P S P P PP P P + P P Sbjct: 128 PPTEAPPTTPITS----PSPPTNPPPPPESPPSLPAPDP 162 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P + V P P P PPP P PPP P PPP Sbjct: 85 PPPTTIPVSPPPEPSP-PPPLPTEAPPPANPVSSPPP 120 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 5/29 (17%) Frame = +3 Query: 870 PPPXPPPXPPPX-----PPPXPPXXPPPP 941 PPP P PPP PPP PPPP Sbjct: 101 PPPLPTEAPPPANPVSSPPPESSPPPPPP 129 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P PP P P PP P P P PP Sbjct: 150 PPESPPSLPAPDPPSNPLPPPKLVPP 175 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Frame = +3 Query: 870 PPPXPPPXPPPXP-PPXPPXXPPPP 941 PP P PPP P PP P PPP Sbjct: 63 PPETPLSSPPPEPSPPSPSLTGPPP 87 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPP-PXPPPXP-PPXPPXXPPPP 941 P S LP PPP P PPP PP PP PP Sbjct: 96 PEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPP 134 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P P PPP PP P PP Sbjct: 128 PPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPP 163 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P PP P P P PP PP Sbjct: 154 PPSLPAPDPPSNPLPPPKLVPPSHSPP 180 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P SL+ P P PP P PPP P PPP Sbjct: 78 PSPSLTGPPPTTIPVSPPPEPSP--PPPLPTEAPPP 111 Score = 29.5 bits (63), Expect = 3.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPP 935 PPP PP P PP P PP Sbjct: 149 PPPESPPSLPAPDPPSNPLPPP 170 Score = 28.7 bits (61), Expect = 5.9 Identities = 19/65 (29%), Positives = 20/65 (30%) Frame = +3 Query: 747 SXPXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPX 926 S P NPP P + P V P PP P P PP P Sbjct: 142 SPPTNPPPPPESPPSLPAPDPPSNPLPPP----KLVPPSHSPPRHLPSPPASEIPPPPRH 197 Query: 927 XPPPP 941 P PP Sbjct: 198 LPSPP 202 Score = 28.7 bits (61), Expect = 5.9 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PSPP P P P P S P P P P P P P Sbjct: 217 PSPPPPGHPKRREQPPPPGS--KRPTPSPPSPSDSKRPVHPSPPSP 260 Score = 28.3 bits (60), Expect = 7.8 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +3 Query: 846 SXVLPGXXPPPXPPPXPPPXPPPXP-PXXPPPP 941 S L G P P PP PP P P PPP Sbjct: 79 SPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPP 111 Score = 28.3 bits (60), Expect = 7.8 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 4/50 (8%) Frame = +1 Query: 799 PSPPXPX-PPXXXXXPSPXFSLXXXPXPXP---XXPPXPXXPXTXXXPPP 936 PSPP PP PSP S P PP P P PPP Sbjct: 184 PSPPASEIPPPPRHLPSPPASERPSTPPSDSEHPSPPPPGHPKRREQPPP 233 Score = 28.3 bits (60), Expect = 7.8 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 PPP P P P P PP PP Sbjct: 266 PPPKPSPDPLPSNSSSPPTLLPP 288 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 39.5 bits (88), Expect = 0.003 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P PP P PP PPPP Sbjct: 49 PPPPPSPPPPSCTPSPPPPSPPPP 72 Score = 37.1 bits (82), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 5/33 (15%) Frame = +3 Query: 858 PGXXPPPXPPPXPPP-----XPPPXPPXXPPPP 941 P P P PP PPP P P PP PPPP Sbjct: 58 PSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPP 90 Score = 36.3 bits (80), Expect = 0.029 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 L PPP PP P P P PP PPP Sbjct: 45 LQNQPPPPPSPPPPSCTPSPPPPSPPPP 72 Score = 35.5 bits (78), Expect = 0.051 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 4/27 (14%) Frame = +3 Query: 870 PPPXPPPXP----PPXPPPXPPXXPPP 938 PPP PPP PP P P PP PPP Sbjct: 65 PPPSPPPPKKSSCPPSPLPPPPPPPPP 91 Score = 33.1 bits (72), Expect = 0.27 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Frame = +1 Query: 796 PPSPPXP--XPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPP 933 PPSPP P P P P P P P PP P PP Sbjct: 52 PPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPPPNYVFTYPP 99 Score = 33.1 bits (72), Expect = 0.27 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 8/36 (22%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXP--------PXXPPPP 941 P PPP P PPP PP P P PPPP Sbjct: 52 PPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPP 87 Score = 32.3 bits (70), Expect = 0.48 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPP 933 PP PP P PP P P P PP P P PP Sbjct: 49 PPPPPSPPPPSCTPSPPPP---SPPPPKKSSCPPSPLPPPPPPPPP 91 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPP 938 PP P P PPP PPP PP Sbjct: 78 PPSPLPPPPPPPPPNYVFTYPP 99 >At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family protein Common family members: At5g26070, At5g19800, At1g72790 [Arabidopsis thaliana] Length = 575 Score = 37.9 bits (84), Expect = 0.010 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP PPP P PP Sbjct: 296 PPPSPPP-PPPPPPPQPLIAATPP 318 Score = 36.7 bits (81), Expect = 0.022 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = +3 Query: 870 PPPXPPPXPPPXPPP 914 PPP PPP PPP PPP Sbjct: 381 PPPSPPPPPPPPPPP 395 Score = 35.9 bits (79), Expect = 0.039 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PP PP PPP PPP P P P Sbjct: 244 PPQQPPATPPPPPPPPPVEVPQKP 267 Score = 35.9 bits (79), Expect = 0.039 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 PP PPP PPP PP PPP Sbjct: 373 PPQYQSLIPPPSPPPPPPPPPPP 395 Score = 32.7 bits (71), Expect = 0.36 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPP 938 P PP PP PPP PP PPP Sbjct: 241 PSSPPQQPPATPPPPPP--PPP 260 Score = 31.9 bits (69), Expect = 0.63 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 885 PPXPPPXPPPXPPXXPPPP 941 P PP PP PP PPPP Sbjct: 241 PSSPPQQPPATPPPPPPPP 259 Score = 31.1 bits (67), Expect(2) = 0.003 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPP 902 ++P PPP PPP PPP Sbjct: 379 LIPPPSPPPPPPPPPPP 395 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXP 932 P PP PPP PPP PP P P Sbjct: 244 PPQQPPATPPP-PPPPPPVEVPQKP 267 Score = 29.5 bits (63), Expect = 3.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPP 923 P PPP PPP P P PP Sbjct: 297 PPSPPPPPPPPPPQPLIAATPP 318 Score = 29.5 bits (63), Expect(2) = 0.38 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPP 899 P + S + P PPP PPP PP Sbjct: 373 PPQYQSLIPPPSPPPPPPPPPPP 395 Score = 28.3 bits (60), Expect = 7.8 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXP 908 P PPP PPP PPP P Sbjct: 296 PPPSPPPPPPP-PPPQP 311 Score = 27.5 bits (58), Expect(2) = 0.003 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPP 935 P PPP PPP P PP Sbjct: 421 PAPPPPPPPRYTQFDPQTPP 440 Score = 25.0 bits (52), Expect(2) = 1.4 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPP 923 PPP PPP P PP Sbjct: 423 PPPPPPPRYTQFDPQTPP 440 Score = 24.2 bits (50), Expect(2) = 1.4 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +3 Query: 900 PXPPPXPPXXPPP 938 P PPP PP PP Sbjct: 473 PPPPPPPPFRVPP 485 Score = 21.8 bits (44), Expect(2) = 0.38 Identities = 8/19 (42%), Positives = 8/19 (42%) Frame = +3 Query: 885 PPXPPPXPPPXPPXXPPPP 941 P PPP PP P P Sbjct: 421 PAPPPPPPPRYTQFDPQTP 439 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 39.1 bits (87), Expect = 0.004 Identities = 36/118 (30%), Positives = 38/118 (32%), Gaps = 3/118 (2%) Frame = -2 Query: 940 GGG--GXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGX 767 GGG G GG GG GG GGG GGG P R G + G Sbjct: 258 GGGRSGGYGGYGGEFGGYGGGGYGGGVGPYR--GEPALGYSGRYGGGGGGYNRGGYSMGG 315 Query: 766 GGXLGXEPPHXPRGG-XEKGXXCGG*GXLRGXXGPXXGXGGRXXXXXGLFXXXFXXGG 596 GG G P G E G GG G G GG G + GG Sbjct: 316 GGGYGGGPGDMYGGSYGEPGGGYGGPSGSYGGGYGSSGIGGYGGGMGGAGGGGYRGGG 373 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/27 (59%), Positives = 16/27 (59%), Gaps = 3/27 (11%) Frame = -2 Query: 940 GGGGXXGGXG---GGXGGGXGGGXGGG 869 GGGG GG G GG GGG GG G G Sbjct: 365 GGGGYRGGGGYDMGGVGGGGAGGYGAG 391 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GGG GG G G GG Sbjct: 372 GGGYDMGGVGGGGAGGYGAGGGG 394 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG G GGG GG GGG Sbjct: 391 GGGGNGGGSFYGGGGGRGGYGGGG 414 Score = 33.1 bits (72), Expect = 0.27 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GG G G GGG GGG G GGG Sbjct: 383 GGAGGYGAGGGGNGGGSFYGGGGG 406 Score = 32.3 bits (70), Expect = 0.48 Identities = 17/34 (50%), Positives = 18/34 (52%), Gaps = 5/34 (14%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXG-----GGXXPGRT 851 GGG G GGG GGG GG G GG GR+ Sbjct: 229 GGGYGDGYGGGHGGGYGGPGGPYKSGGGYGGGRS 262 Score = 32.3 bits (70), Expect = 0.48 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = -1 Query: 941 GWGGGXXXVXGXXGXGGXXGXGXGXXSRENXGE-GXXXXXGGXGXGGEGG 795 G GGG G GG G G G G G GG G GG GG Sbjct: 363 GAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGGRGGYGG 412 Score = 31.9 bits (69), Expect = 0.63 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 3/30 (10%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXG---GGXGGGXXPG 857 GGG G GGG GG G GG GGG G Sbjct: 358 GGGMGGAGGGGYRGGGGYDMGGVGGGGAGG 387 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG GG GG G G GGG GGG G Sbjct: 378 GGVGGGGAGGYGAG-GGGNGGGSFYG 402 Score = 31.9 bits (69), Expect = 0.63 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 GGG GG G G GG GG GG Sbjct: 381 GGGGAGGYGAGGGGNGGGSFYGG 403 Score = 31.5 bits (68), Expect = 0.84 Identities = 34/106 (32%), Positives = 36/106 (33%), Gaps = 8/106 (7%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGX--GGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGP-KXXRXXG 770 G GG GG GG GG GGG GGG G G GP + G Sbjct: 235 GYGGGHGGGYGGPGGPYKSGGGYGGGRSGGYGGYGGEFGGYGGGGYGGGVGPYRGEPALG 294 Query: 769 XGGXLGXEPPHXPRGGXEK---GXXCGG*GXLRG--XXGPXXGXGG 647 G G RGG G GG G + G P G GG Sbjct: 295 YSGRYGGGGGGYNRGGYSMGGGGGYGGGPGDMYGGSYGEPGGGYGG 340 Score = 31.5 bits (68), Expect = 0.84 Identities = 28/99 (28%), Positives = 30/99 (30%), Gaps = 1/99 (1%) Frame = -3 Query: 936 GGGXXXGXGXXXXGGXXGXXXXXXXXXXXXXXXGXGXXGGGGXGGG-GXPXEXAXRGGGG 760 GGG G GG G G G G GG GGG G RGGGG Sbjct: 315 GGGGYGGGPGDMYGGSYGEPGGGYGGPSGSYGGGYGSSGIGGYGGGMGGAGGGGYRGGGG 374 Query: 759 X*XXNLPTXPGGGXKRXXSXXXXXXXXXXXGXKXGRGGG 643 + GG G + G GGG Sbjct: 375 YDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGGRGGYGGG 413 Score = 31.5 bits (68), Expect = 0.84 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GG G G G GGG G Sbjct: 381 GGGGAGGYGAGGGGNGGGSFYGGGGGRG 408 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGR 854 GGG G GGG GG GGG G GR Sbjct: 396 GGGSFYGGGGGRGGYGGGGSGRYHPYGR 423 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG 875 G GG GG GG GGG GG G Sbjct: 353 GIGGYGGGMGGAGGGGYRGGGG 374 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGR 854 G GG G G GGG G G GG GR Sbjct: 389 GAGGGGNGGGSFYGGGGGRGGYGGGGSGR 417 Score = 30.3 bits (65), Expect = 1.9 Identities = 27/97 (27%), Positives = 29/97 (29%), Gaps = 2/97 (2%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXGGXL 755 G GGG G G GGG GGG + G G GG Sbjct: 222 GDSRSNFGGGYGDGYGGGHGGGYGGPGGPYKSGGGYGGGRSGGYGGYGGEFGGYGGGGYG 281 Query: 754 GXEPPH--XPRGGXEKGXXCGG*GXLRGXXGPXXGXG 650 G P+ P G GG G RG G G Sbjct: 282 GGVGPYRGEPALGYSGRYGGGGGGYNRGGYSMGGGGG 318 Score = 29.1 bits (62), Expect = 4.5 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXG--GXGGGXGGGXGGGXGGGXXPG 857 GG G G G GG GG GGG GG G Sbjct: 362 GGAGGGGYRGGGGYDMGGVGGGGAGGYGAG 391 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 39.1 bits (87), Expect = 0.004 Identities = 18/39 (46%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPP--XXPPPP 941 P + S V PPP PPP PPP PP PPPP Sbjct: 217 PNKPQSAVGANGLPPPPPPPPHQAQPPPPPPSGLFPPPP 255 Score = 37.9 bits (84), Expect = 0.010 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = +3 Query: 861 GXXPPPXPPP--XPPPXPPPXPPXXPPPP 941 G PPP PPP PP PPP PPPP Sbjct: 228 GLPPPPPPPPHQAQPPPPPPSGLFPPPPP 256 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 39.1 bits (87), Expect = 0.004 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PP PP PPP PPPP Sbjct: 514 PVYSPPPPPPVYSPPPPPPVYSPPPPPP 541 Score = 36.7 bits (81), Expect = 0.022 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 PPSP PP P P + P P P P P P PP H Sbjct: 503 PPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVH 550 Score = 36.7 bits (81), Expect = 0.022 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PP PPP P PP PPP Sbjct: 527 PPPPPPVYSPPPPPPVHSPPPPVHSPPP 554 Score = 36.7 bits (81), Expect = 0.022 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 2/26 (7%) Frame = +3 Query: 870 PPPX--PPPXPPPXPPPXPPXXPPPP 941 PPP PPP PP PP P PPPP Sbjct: 530 PPPVYSPPPPPPVHSPPPPVHSPPPP 555 Score = 36.7 bits (81), Expect = 0.022 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXP---PPXPPXXPPPP 941 P PPP PP PP P PP P PPPP Sbjct: 532 PVYSPPPPPPVHSPPPPVHSPPPPVHSPPPP 562 Score = 36.7 bits (81), Expect = 0.022 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXP---PPXPPXXPPPP 941 P PPP PP PP P PP P PPPP Sbjct: 612 PVYSPPPPPPVHSPPPPVFSPPPPVHSPPPP 642 Score = 35.9 bits (79), Expect = 0.039 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P S P PPP P PPP PP P PPP Sbjct: 497 PVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPP 532 Score = 35.5 bits (78), Expect = 0.051 Identities = 16/28 (57%), Positives = 16/28 (57%), Gaps = 4/28 (14%) Frame = +3 Query: 870 PPPXP--PPXPPPX--PPPXPPXXPPPP 941 PPP P P PPP PPP PP PPP Sbjct: 502 PPPSPIHSPPPPPVYSPPPPPPVYSPPP 529 Score = 35.5 bits (78), Expect = 0.051 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PP PP PP PPP Sbjct: 574 PPPVHSPPPPVYSPPPPPVHSPPP 597 Score = 35.5 bits (78), Expect = 0.051 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PP PP PPP P PP PPP Sbjct: 611 PPVYSPPPPPPVHSPPPPVFSPPP 634 Score = 35.1 bits (77), Expect = 0.068 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PP PP P PPPP Sbjct: 546 PPPVHSPPPPVHSPPPPVHSPPPP 569 Score = 35.1 bits (77), Expect = 0.068 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PP PP P PPPP Sbjct: 553 PPPVHSPPPPVHSPPPPVHSPPPP 576 Score = 35.1 bits (77), Expect = 0.068 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PP PP P PPPP Sbjct: 560 PPPVHSPPPPVHSPPPPVHSPPPP 583 Score = 35.1 bits (77), Expect = 0.068 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PP PP P PPPP Sbjct: 567 PPPVHSPPPPVHSPPPPVYSPPPP 590 Score = 35.1 bits (77), Expect = 0.068 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PPP P PP PPP Sbjct: 581 PPPVYSPPPPPVHSPPPPVHSPPP 604 Score = 35.1 bits (77), Expect = 0.068 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PP PP PP PP P PPPP Sbjct: 582 PPVYSPPPPPVHSPPPPVHSPPPP 605 Score = 35.1 bits (77), Expect = 0.068 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PP PP P PPPP Sbjct: 589 PPPVHSPPPPVHSPPPPVHSPPPP 612 Score = 35.1 bits (77), Expect = 0.068 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PP PP P PPPP Sbjct: 596 PPPVHSPPPPVHSPPPPVYSPPPP 619 Score = 35.1 bits (77), Expect = 0.068 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PP PP P PPPP Sbjct: 633 PPPVHSPPPPVYSPPPPVYSPPPP 656 Score = 35.1 bits (77), Expect = 0.068 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PP PP PP PPP Sbjct: 640 PPPVYSPPPPVYSPPPPPVKSPPP 663 Score = 34.7 bits (76), Expect = 0.090 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = +1 Query: 784 FXWXPPSPP--XPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 F PP PP P PP P P + P P P P P P PPP Sbjct: 489 FRRSPPPPPVHSPPPPSPIHSPPPP-PVYSPPPPPPVYSPPPPPPVYSPPPPP 540 Score = 34.7 bits (76), Expect = 0.090 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PP PP P PPP PP PPP Sbjct: 604 PPVHSPPPPVYSPPPPPPVHSPPP 627 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PP PP P PPP P PPPP Sbjct: 575 PPVHSPPPPVYSPPPPPVHSPPPP 598 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PP PP P PPPP Sbjct: 626 PPPVFSPPPPVHSPPPPVYSPPPP 649 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PP PP P PPP P PPPP Sbjct: 641 PPVYSPPPPVYSPPPPPVKSPPPP 664 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = +3 Query: 870 PPPX--PPPXPPPXPPPXPPXXPPPP 941 PPP PPP P PP PP PPP Sbjct: 495 PPPVHSPPPPSPIHSPPPPPVYSPPP 520 Score = 33.1 bits (72), Expect = 0.27 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP P P P PPP PPPP Sbjct: 496 PPVHSPPPPSPIHSPPPPPVYSPPPPPP 523 Score = 33.1 bits (72), Expect = 0.27 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = +3 Query: 870 PPPXPPPXPPP--XPPPXPPXXPPPP 941 PPP P PPP PP P PPPP Sbjct: 610 PPPVYSPPPPPPVHSPPPPVFSPPPP 635 Score = 33.1 bits (72), Expect = 0.27 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P PPP P PPP P PP PP Sbjct: 649 PVYSPPPPPVKSPPPPPVYSPPLLPP 674 Score = 32.7 bits (71), Expect = 0.36 Identities = 23/98 (23%), Positives = 25/98 (25%) Frame = +1 Query: 643 SAPPXPFXAPXTPAXTLNPHTXXXXXXXXXXXXXXXXXXXXXXPXSXFXWXPPSPPXPXP 822 S PP P +P P +P P P PP P Sbjct: 509 SPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVH--SPPPPVHSP 566 Query: 823 PXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P P P P P PP P PPP Sbjct: 567 PPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPP 604 Score = 32.7 bits (71), Expect = 0.36 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP P PP PPP Sbjct: 541 PVHSPPPPVHSPPPPVHSPPPPVHSPPP 568 Score = 32.7 bits (71), Expect = 0.36 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP P PP PPP Sbjct: 548 PVHSPPPPVHSPPPPVHSPPPPVHSPPP 575 Score = 32.7 bits (71), Expect = 0.36 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP P PP PPP Sbjct: 555 PVHSPPPPVHSPPPPVHSPPPPVHSPPP 582 Score = 32.7 bits (71), Expect = 0.36 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP P PP PPP Sbjct: 562 PVHSPPPPVHSPPPPVHSPPPPVYSPPP 589 Score = 32.7 bits (71), Expect = 0.36 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP P PP PPP Sbjct: 591 PVHSPPPPVHSPPPPVHSPPPPVYSPPP 618 Score = 32.7 bits (71), Expect = 0.36 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 PP PP PP PP PP PP Sbjct: 648 PPVYSPPPPPVKSPPPPPVYSPP 670 Score = 32.3 bits (70), Expect = 0.48 Identities = 24/97 (24%), Positives = 27/97 (27%), Gaps = 1/97 (1%) Frame = +1 Query: 652 PXPFXAPXTPAXTLNPHTXXXXXXXXXXXXXXXXXXXXXXPXSXFXWXPPSPP-XPXPPX 828 P P P P + P+ P S PP P P PP Sbjct: 463 PSPVHKPQPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPPPSPIHSPPPPPVYSPPPPP 522 Query: 829 XXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 P P + P P P P P P PP H Sbjct: 523 PVYSPPPPPPVYSPPPPPPVHSPPP--PVHSPPPPVH 557 Score = 32.3 bits (70), Expect = 0.48 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP P PP P P +S P P P P PPP Sbjct: 566 PPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPP 612 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP P PP PPP Sbjct: 628 PVFSPPPPVHSPPPPVYSPPPPVYSPPP 655 Score = 31.9 bits (69), Expect = 0.63 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPPP 941 P PPP P PPP P PPPP Sbjct: 493 PPPPPVHSP-PPPSPIHSPPPP 513 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/49 (30%), Positives = 16/49 (32%) Frame = +1 Query: 790 WXPPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 + PP PP PP P P P P PP P PP Sbjct: 585 YSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPP 633 Score = 31.9 bits (69), Expect = 0.63 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP P PP PPP Sbjct: 588 PPPPVHSPPPPVHSPPPPVHSPPP 611 Score = 31.9 bits (69), Expect = 0.63 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP P PP PPP Sbjct: 621 PVHSPPPPVFSPPPPVHSPPPPVYSPPP 648 Score = 31.5 bits (68), Expect = 0.84 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP PP P P P P P P PPP Sbjct: 617 PPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPP 663 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP P PP P P +S P PP P PPP Sbjct: 595 PPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPP 641 Score = 30.7 bits (66), Expect = 1.5 Identities = 23/98 (23%), Positives = 27/98 (27%), Gaps = 2/98 (2%) Frame = +1 Query: 649 PPXPFXAPXTPAXTLNP--HTXXXXXXXXXXXXXXXXXXXXXXPXSXFXWXPPSPPXPXP 822 PP P +P P + P H+ P + PP P P Sbjct: 538 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYS-PPPPPVHSPP 596 Query: 823 PXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P P P S P PP P PPP Sbjct: 597 PPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPP 634 Score = 30.7 bits (66), Expect = 1.5 Identities = 25/100 (25%), Positives = 30/100 (30%), Gaps = 3/100 (3%) Frame = +1 Query: 646 APPXPFXAPXTPAXTLNP---HTXXXXXXXXXXXXXXXXXXXXXXPXSXFXWXPPSPPXP 816 +PP P +P P + P H+ P PP P Sbjct: 572 SPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFS 631 Query: 817 XPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP P P +S P P PP P P PPP Sbjct: 632 PPPPVHSPPPPVYS----PPPPVYSPPPP--PVKSPPPPP 665 Score = 30.3 bits (65), Expect = 1.9 Identities = 22/99 (22%), Positives = 26/99 (26%), Gaps = 2/99 (2%) Frame = +1 Query: 646 APPXPFXAPXTPAXTLNP--HTXXXXXXXXXXXXXXXXXXXXXXPXSXFXWXPPSPPXPX 819 +PP P +P P + P H+ P PP P Sbjct: 551 SPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPP 610 Query: 820 PPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP P P P P P P PPP Sbjct: 611 PPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPP 649 Score = 30.3 bits (65), Expect = 1.9 Identities = 22/99 (22%), Positives = 26/99 (26%), Gaps = 2/99 (2%) Frame = +1 Query: 646 APPXPFXAPXTPAXTLNP--HTXXXXXXXXXXXXXXXXXXXXXXPXSXFXWXPPSPPXPX 819 +PP P +P P + P H+ P PP P Sbjct: 558 SPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPP 617 Query: 820 PPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP P P P P P P PPP Sbjct: 618 PPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPP 656 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/49 (32%), Positives = 17/49 (34%), Gaps = 3/49 (6%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPP---XPXXPXTXXXPP 933 PP P PP P P +S P P PP P P PP Sbjct: 632 PPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPPLLPPKMSSPP 680 Score = 29.1 bits (62), Expect = 4.5 Identities = 17/52 (32%), Positives = 19/52 (36%), Gaps = 3/52 (5%) Frame = +1 Query: 790 WXPPSPP--XPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXP-XTXXXPPP 936 + PP PP P PP P + P P P P P T PPP Sbjct: 651 YSPPPPPVKSPPPPPVYSPPLLPPKMSSPPTQTPVNSPPPRTPSQTVEAPPP 702 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 2/26 (7%) Frame = +3 Query: 870 PPPX--PPPXPPPXPPPXPPXXPPPP 941 PPP PPP P PP PP PP Sbjct: 655 PPPVKSPPPPPVYSPPLLPPKMSSPP 680 >At2g05440.1 68415.m00574 glycine-rich protein Length = 127 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GG GGG GG GGG G Sbjct: 84 GGGGHYGGGGGHYGGGGGGYGGGGGHHG 111 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG G GGG Sbjct: 91 GGGGHYGGGGGGYGGGGGHHGGGG 114 Score = 37.9 bits (84), Expect = 0.010 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG G GGG GG GGG GGG Sbjct: 83 GGGGGHYGGGGGHYGGGGGGYGGG 106 Score = 37.5 bits (83), Expect = 0.013 Identities = 18/30 (60%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXG--GGXGGGXXPG 857 GGGG GG GG GGG G GG GGG G Sbjct: 77 GGGGHYGGGGGHYGGGGGHYGGGGGGYGGG 106 Score = 35.5 bits (78), Expect = 0.051 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GG G GG GGG G G GG GGG Sbjct: 45 GGHGGHGGHGGGGGHGHGGHNGGG 68 Score = 34.7 bits (76), Expect = 0.090 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG G GGG GG GG GGG Sbjct: 76 GGGGGHYGGGGGHYGGGGGHYGGG 99 Score = 34.7 bits (76), Expect = 0.090 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG G GGG GG GG GGG Sbjct: 90 GGGGGHYGGGGGGYGGGGGHHGGG 113 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/30 (56%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXGGXGG-GXGGGXG-GGXGGGXXPG 857 G GG GG GG G GGG G GG GG G Sbjct: 42 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHG 71 Score = 30.7 bits (66), Expect = 1.5 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 2/61 (3%) Frame = -3 Query: 936 GGGXXXGXGXXXXGGXXGXXXXXXXXXXXXXXXGXGXXGGG--GXGGGGXPXEXAXRGGG 763 GGG G G GG G G GGG G GGGG GGG Sbjct: 54 GGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGGYGGGGGHHGGG 113 Query: 762 G 760 G Sbjct: 114 G 114 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = -2 Query: 940 GGGGXXG-GXGGGXGGGXGGGXGGG 869 GG G G G GGG GG GG GGG Sbjct: 68 GGHGLDGYGGGGGHYGGGGGHYGGG 92 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GG G G G GGG G Sbjct: 56 GGGHGHGGHNGGGGHGLDGYGGGGGHYG 83 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXG-GGXGGG 869 GGGG G G GGG G G GGG Sbjct: 54 GGGGGHGHGGHNGGGGHGLDGYGGG 78 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG G G G GGG GG GG Sbjct: 66 GGGGHGLDGYGGGGGHYGGGGG 87 Score = 28.7 bits (61), Expect = 5.9 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G G GG GGGG GGGG Sbjct: 46 GHGGHGGHGGGGGHGHGGHNGGGG 69 Score = 28.7 bits (61), Expect = 5.9 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G G GGG G G G GGG G Sbjct: 57 GGHGHGGHNGGGGHGLDGYGGGGGHYGG 84 Score = 28.7 bits (61), Expect = 5.9 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 4/32 (12%) Frame = -2 Query: 940 GGGGXX----GGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GG GGG G GGG G Sbjct: 66 GGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYG 97 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 39.1 bits (87), Expect = 0.004 Identities = 21/68 (30%), Positives = 24/68 (35%), Gaps = 7/68 (10%) Frame = +3 Query: 753 PXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPP-------XPPPXPP 911 P PP P F P ++ +P PPP PPP PP PP Sbjct: 419 PPPPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPPPPP 478 Query: 912 PXPPXXPP 935 P PP P Sbjct: 479 PLPPAVMP 486 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 12/41 (29%) Frame = +3 Query: 855 LPGXXPPPXPPPX-------PPPXPPP-----XPPXXPPPP 941 L G PPP PPP PPP PPP PP PPPP Sbjct: 503 LKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPP 543 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 5/29 (17%) Frame = +3 Query: 870 PPPXPPPX-----PPPXPPPXPPXXPPPP 941 PPP PPP PPP PPP PPPP Sbjct: 537 PPPPPPPGTAAAPPPPPPPPGTQAAPPPP 565 Score = 37.1 bits (82), Expect = 0.017 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPX------PPPXPPPXPPPXPPXXPPPP 941 P + V P PPP PPP PPP PP PPPP Sbjct: 527 PPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPP 569 Score = 36.7 bits (81), Expect = 0.022 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 8/45 (17%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPP---PXPPPXPPP-----XPPXXPPPP 941 P L + PPP PP PPP PPP PP PPPP Sbjct: 512 PPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPP 556 Score = 34.7 bits (76), Expect = 0.090 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 5/29 (17%) Frame = +3 Query: 870 PPPXPPPX-----PPPXPPPXPPXXPPPP 941 PPP PPP PPP PPP P PP Sbjct: 550 PPPPPPPGTQAAPPPPPPPPMQNRAPSPP 578 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P P P P P PP P P T PPP Sbjct: 509 PPPPPPPLPTTIAAPPPP----PPPPRAAVAPPPPPPPPGTAAAPPP 551 Score = 32.7 bits (71), Expect = 0.36 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 14/46 (30%) Frame = +3 Query: 846 SXVLPGXXPPPXPPP--------XPPPXPPPXPP------XXPPPP 941 S + P PPP PPP P P PPP PP PPPP Sbjct: 412 SQLFPPPPPPPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPP 457 Score = 31.5 bits (68), Expect = 0.84 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PP P PP PPPP Sbjct: 492 PPPPTPPAFKPLKGSAPPPPPPPP 515 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P PP P PP P F+ P P P PP P PPP Sbjct: 454 PPPPPPPPPPPAVMPLKHFA----PPPPPPLPP-AVMPLKHFAPPP 494 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 7/54 (12%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXP-------XXPPXPXXPXTXXXPPP 936 PP PP P P P P P P PP P P T PPP Sbjct: 511 PPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPP 564 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 14/38 (36%) Frame = +3 Query: 870 PPPXPP---------PXPPPXPP-----PXPPXXPPPP 941 PPP PP P PPP PP PP PPPP Sbjct: 493 PPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPP 530 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP P P Sbjct: 550 PPPPPPPGTQAAPPPPPPPPMQNRAPSP 577 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 3/47 (6%) Frame = +1 Query: 805 PPXPXPPXXXXXPSPX---FSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP P PP PSP P P PP P PPP Sbjct: 563 PPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPPPP 609 Score = 30.3 bits (65), Expect = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXPPPP 941 PPP PPP P PPPP Sbjct: 590 PPPPPPPMPLANGATPPPPP 609 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/45 (33%), Positives = 17/45 (37%) Frame = +1 Query: 802 SPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 S P P PP P ++ P P P PP P PPP Sbjct: 434 SLPLPSPP--PTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPPP 476 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 11/35 (31%) Frame = +3 Query: 870 PPPXPPPXP----PPXPPPXPP-------XXPPPP 941 PPP PPP P PPP PP PPPP Sbjct: 590 PPPPPPPMPLANGATPPPPPPPMAMANGAAGPPPP 624 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 V+P P PPP PP P PPPP Sbjct: 466 VMPLKHFAPPPPPPLPPAVMPLKHFAPPPP 495 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPP 938 G PP PPP P PP PPP Sbjct: 586 GSGGPPPPPPPMPLANGATPPPPPPP 611 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PPP PPP PP PPPP Sbjct: 602 GATPPPPPPPMAMANGAAGPP--PPPP 626 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/28 (57%), Positives = 16/28 (57%), Gaps = 4/28 (14%) Frame = +3 Query: 870 PPPX----PPPXPPPXPPPXPPXXPPPP 941 PPP PPP PP PPP P PPPP Sbjct: 514 PPPYVYSSPPPPPPSPPPPCPESSPPPP 541 Score = 35.1 bits (77), Expect = 0.068 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPX------PPPXPPXXPPPP 941 P +S + PPP P P PPP PPP PPPP Sbjct: 445 PYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPPPYVYSSPPPP 487 Score = 34.7 bits (76), Expect = 0.090 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P S + P P PPP P PPP PPPP Sbjct: 442 PPPPYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPPP 478 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP P P PP P P + P P P P PPP Sbjct: 460 PPPSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPP 506 Score = 34.3 bits (75), Expect = 0.12 Identities = 19/57 (33%), Positives = 21/57 (36%), Gaps = 2/57 (3%) Frame = +1 Query: 772 PXSXFXWXPPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXP--XXPXTXXXPPP 936 P + PP PP P PP P P + P PP P P T PPP Sbjct: 515 PPYVYSSPPPPPPSPPPPCPESSPPPPV-VYYAPVTQSPPPPSPVYYPPVTQSPPPP 570 Score = 32.3 bits (70), Expect = 0.48 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 4/51 (7%) Frame = +1 Query: 796 PPSPPX----PXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P PP P P + P P P PP P PPP Sbjct: 494 PPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPP----PCPESSPPP 540 Score = 32.3 bits (70), Expect = 0.48 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP P PPP P PP P PP Sbjct: 621 PPVTPSPPPPSPVYYPPVTPSPP 643 Score = 32.3 bits (70), Expect = 0.48 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP P PPP P PP P PP Sbjct: 636 PPVTPSPPPPSPVYYPPVTPSPP 658 Score = 31.5 bits (68), Expect = 0.84 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 4/28 (14%) Frame = +3 Query: 870 PPPXPPPXPPPX----PPPXPPXXPPPP 941 PPP PPP PP PP PPPP Sbjct: 505 PPPYVYSSPPPPYVYSSPPPPPPSPPPP 532 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/41 (36%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXP----PPXPPPXPPPXPPXXPPPP 941 P +S + PPP P P PPP PP PPP Sbjct: 428 PSSKMSPSVRAYSPPPPPYSKMSPSVRAYPPPPPPSPSPPP 468 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P PPP PPPP Sbjct: 484 PPPPPYVYSSPPPPPYVYSSPPPP 507 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 5/51 (9%) Frame = +1 Query: 799 PSPPXPXP---PXXXXXPSPXFSLXXXPXPXPXXPPXP--XXPXTXXXPPP 936 PSPP P P P P P + P PP P P T PPP Sbjct: 610 PSPPPPSPLYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPP 660 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +3 Query: 870 PPPXP---PPXPPPXPPPXPPXXPP 935 PPP P PP P PPP P PP Sbjct: 613 PPPSPLYYPPVTPSPPPPSPVYYPP 637 Score = 29.5 bits (63), Expect = 3.4 Identities = 25/104 (24%), Positives = 30/104 (28%), Gaps = 6/104 (5%) Frame = +1 Query: 643 SAPPXPFXAPXTPAXTLNPHTXXXXXXXXXXXXXXXXXXXXXXPXSXFXWXP--PSPPXP 816 S+PP P+ P +P P S + P SPP P Sbjct: 511 SSPPPPYVYSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPP 570 Query: 817 XP---PXXXXXPSPXFSLXXXPXPXPXXPPXP-XXPXTXXXPPP 936 P P P P + P PP P P PPP Sbjct: 571 SPVYYPPVTNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPP 614 Score = 29.5 bits (63), Expect = 3.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPP 938 P PPP P PP P PPP Sbjct: 610 PSPPPPSPLYYPPVTPSPPPP 630 Score = 29.1 bits (62), Expect = 4.5 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 5/50 (10%) Frame = +1 Query: 802 SPPXPXP---PXXXXXPSPXFSLXXXPXPXPXXPPXP--XXPXTXXXPPP 936 SPP P P P P P L P PP P P T PPP Sbjct: 596 SPPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPPSPVYYPPVTPSPPPP 645 Score = 28.7 bits (61), Expect = 5.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 P P PPP P PP P PP Sbjct: 606 PQVTPSPPPPSPLYYPPVTPSPP 628 Score = 28.7 bits (61), Expect = 5.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 P PPP P PP P PP P Sbjct: 625 PSPPPPSPVYYPPVTPSPPPPSP 647 Score = 28.7 bits (61), Expect = 5.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 P PPP P PP P PP P Sbjct: 640 PSPPPPSPVYYPPVTPSPPPPSP 662 Score = 28.3 bits (60), Expect = 7.8 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 P PPP P PP P PP P Sbjct: 610 PSPPPPSPLYYPPVTPSPPPPSP 632 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/32 (56%), Positives = 18/32 (56%), Gaps = 8/32 (25%) Frame = +3 Query: 870 PPPXPPPXPP----PXPPPX----PPXXPPPP 941 PPP PPP PP P PPP PP PPPP Sbjct: 310 PPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPP 341 Score = 36.7 bits (81), Expect = 0.022 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 2/26 (7%) Frame = +3 Query: 870 PPPXP--PPXPPPXPPPXPPXXPPPP 941 PPP PP PPP PPP PPPP Sbjct: 303 PPPQKSIPPPPPPPPPPLLQQPPPPP 328 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPP 897 PP PP P PP P P S+ P P P PP Sbjct: 310 PPPPPPPPPPLLQQPPPPP-SVSKAPPPPPPPPP 342 Score = 32.3 bits (70), Expect = 0.48 Identities = 17/39 (43%), Positives = 19/39 (48%), Gaps = 8/39 (20%) Frame = +3 Query: 831 PXRSLSXVLPGXXPP----PXPPPX----PPPXPPPXPP 923 P +S+ P PP P PPP PPP PPP PP Sbjct: 305 PQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXP 894 PP PP P P P P S P P P P Sbjct: 311 PPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 29.5 bits (63), Expect = 3.4 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPP 914 P P PPP PPP PP Sbjct: 27 PLPLPPPPPPPLKPP 41 Score = 29.1 bits (62), Expect = 4.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPP 923 P P P PPP PPP P Sbjct: 25 PSPLPLPPPPPPPLKP 40 Score = 28.7 bits (61), Expect = 5.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 888 PXPPPXPPPXPPXXPPP 938 P P P PPP PP PP Sbjct: 25 PSPLPLPPPPPPPLKPP 41 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GGG GG GGG GGG G Sbjct: 123 GGGGYSYGGGGGGYGGGGGGYGGGGDGG 150 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG GG GGG G Sbjct: 124 GGGYSYGGGGGGYGGGGGGYGGGGDGGG 151 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG 875 GGGG GG GGG GGG GG G Sbjct: 131 GGGGGYGGGGGGYGGGGDGGGG 152 Score = 33.1 bits (72), Expect = 0.27 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GGG G G GGG GG G Sbjct: 122 GGGGGYSYGGGGGGYGGGGGGYGGGGDG 149 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 GGG G GGG G G GG GGG Sbjct: 130 GGGGGGYGGGGGGYGGGGDGGGG 152 Score = 28.7 bits (61), Expect = 5.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 822 GGGGXGGGGXPXEXAXRGGGG 760 GGGG GGGG GGGG Sbjct: 132 GGGGYGGGGGGYGGGGDGGGG 152 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P +S P PPP PP P PPP P PP P Sbjct: 100 PPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAP 136 Score = 36.3 bits (80), Expect = 0.029 Identities = 20/65 (30%), Positives = 23/65 (35%), Gaps = 2/65 (3%) Frame = +3 Query: 753 PXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXP--PPXPPPXPPPXPPX 926 P +PP P P + + P PPP P PP P PPP P Sbjct: 79 PTSPPAPKVAPVISPATPPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPAS 138 Query: 927 XPPPP 941 PP P Sbjct: 139 PPPAP 143 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = +3 Query: 870 PPPXP--PPXPPPXPPPXPPXXPPPP 941 PPP P PP P PPP P PP P Sbjct: 125 PPPTPASPPPAPASPPPAPASPPPAP 150 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXP--PPXPPXXPPP 938 P PP P PPP P PP P PPP Sbjct: 120 PAPTSPPPTPASPPPAPASPPPAPASPPP 148 Score = 33.1 bits (72), Expect = 0.27 Identities = 17/59 (28%), Positives = 18/59 (30%) Frame = +3 Query: 762 PPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 PP P Q P + P PP P P P PP P PPP Sbjct: 97 PPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPP 155 Score = 31.5 bits (68), Expect = 0.84 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP P PPP P PP P P Sbjct: 134 PAPASPPPAPASPPPAPVSPPPVQAPSP 161 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP P PPP P P PP P Sbjct: 141 PAPASPPPAPVSPPPVQAPSPISLPPAP 168 Score = 29.5 bits (63), Expect = 3.4 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPP-PXPPPXPPPXPPXXP--PPP 941 P S V P P PP P PP P PP P PPP Sbjct: 109 PTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPP 148 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/46 (32%), Positives = 17/46 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPP 933 PP+P P P P+P P P P PP P PP Sbjct: 126 PPTPASPPPAPASPPPAP-----ASPPPAPVSPPPVQAPSPISLPP 166 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXP--PPP 941 P P P P PP P PP P PPP Sbjct: 126 PPTPASPPPAPASPPPAPASPPPAPVSPPP 155 >At1g53640.1 68414.m06100 hypothetical protein ; expression supported by MPSS Length = 290 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 GGG GG GGG GGG GGG GGG Sbjct: 269 GGGGCGG-GGGCGGGCGGGCGGG 290 Score = 34.7 bits (76), Expect = 0.090 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGG 881 GG G GG GGG GGG GGG Sbjct: 271 GGCGGGGGCGGGCGGGCGGG 290 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG G G GGG GGG GGG G Sbjct: 265 GCCCGGGGCGGGGGCGGGCGGGCGGG 290 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 38.3 bits (85), Expect = 0.007 Identities = 19/37 (51%), Positives = 19/37 (51%), Gaps = 8/37 (21%) Frame = +3 Query: 855 LPGXXPPPXPP-----PXPPPXPPP---XPPXXPPPP 941 LP PPP PP P PPP PPP P PPPP Sbjct: 23 LPPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPP 59 Score = 36.7 bits (81), Expect = 0.022 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 +S + G P P PPP PPP P PPPP Sbjct: 13 VSPPMRGRVPLPPPPPPPPPPMRRRAPLPPPPP 45 Score = 32.7 bits (71), Expect = 0.36 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 12/35 (34%) Frame = +3 Query: 870 PPPXPP-----PXPPPXPP-------PXPPXXPPP 938 PPP PP P PPP PP P PP PPP Sbjct: 42 PPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPPP 76 Score = 31.9 bits (69), Expect = 0.63 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP P PPPP Sbjct: 39 PLPPPPPPPMRRRAPLPPPPPP 60 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/46 (39%), Positives = 20/46 (43%), Gaps = 12/46 (26%) Frame = +3 Query: 831 PXRSLSXVLPGXXPP-----PXPPPXPP-------PXPPPXPPXXP 932 P R + + P PP P PPP PP P PPP PP P Sbjct: 33 PMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPPPLP 78 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P PP P P P PP P P P Sbjct: 24 PPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRP 70 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 38.3 bits (85), Expect = 0.007 Identities = 18/33 (54%), Positives = 18/33 (54%), Gaps = 5/33 (15%) Frame = +3 Query: 858 PGXXPPPXPPPX---PPPX--PPPXPPXXPPPP 941 P PPP PPP PPP PPP P PPPP Sbjct: 529 PVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPP 561 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 2/26 (7%) Frame = +3 Query: 870 PPPX--PPPXPPPXPPPXPPXXPPPP 941 PPP PPP PPP P PP PPP Sbjct: 552 PPPVYSPPPPPPPVHSPPPPVFSPPP 577 Score = 36.3 bits (80), Expect = 0.029 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP P PP PP P PPPP Sbjct: 558 PPPPPPPVHSPPPPVFSPPPPVYSPPPP 585 Score = 35.9 bits (79), Expect = 0.039 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PP PP PPP P PPPP Sbjct: 545 PPVHSPPPPPVYSPP-PPPPPVHSPPPP 571 Score = 35.9 bits (79), Expect = 0.039 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 3/27 (11%) Frame = +3 Query: 870 PPPXPPPXPPPX---PPPXPPXXPPPP 941 PPP P PPP PPP PP PPP Sbjct: 597 PPPAPVHSPPPPVHSPPPPPPVYSPPP 623 Score = 35.1 bits (77), Expect = 0.068 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PP PP PPP P PP PPP Sbjct: 607 PPVHSPPPPPPVYSPPPPVFSPPP 630 Score = 34.7 bits (76), Expect = 0.090 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 5/37 (13%) Frame = +3 Query: 846 SXVLPGXXPPPXP---PPXP--PPXPPPXPPXXPPPP 941 S V PPP P PP P P PPP P PPPP Sbjct: 510 SPVTKRRSPPPAPVNSPPPPVYSPPPPPPPVHSPPPP 546 Score = 34.7 bits (76), Expect = 0.090 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PP PP P PPPP Sbjct: 576 PPPVYSPPPPVHSPPPPVHSPPPP 599 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PP PP P PPPP Sbjct: 569 PPPVFSPPPPVYSPPPPVHSPPPP 592 Score = 33.9 bits (74), Expect = 0.16 Identities = 18/57 (31%), Positives = 20/57 (35%), Gaps = 2/57 (3%) Frame = +1 Query: 772 PXSXFXWXPPSPPX--PXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P + PP PP P PP P P +S P P PP P PP Sbjct: 527 PPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPP 583 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPP---PXPPPXPPPXPPPXPPXXPPPP 941 P PP P PP PP PP P PPPP Sbjct: 534 PPPPPPVHSPPPPVHSPPPPPVYSPPPPPPP 564 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = +3 Query: 870 PPPXPPPXPP--PXPPPXPPXXPPPP 941 PPP P PP PPP P PPPP Sbjct: 583 PPPVHSPPPPVHSPPPPAPVHSPPPP 608 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = +3 Query: 870 PPPX--PPPXPPPXPPPXPPXXPPPP 941 PPP PPP P PP P PPPP Sbjct: 590 PPPVHSPPPPAPVHSPPPPVHSPPPP 615 Score = 32.7 bits (71), Expect = 0.36 Identities = 15/48 (31%), Positives = 17/48 (35%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 PP+P PP P P + P P PP P PP H Sbjct: 519 PPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVH 566 Score = 32.3 bits (70), Expect = 0.48 Identities = 18/59 (30%), Positives = 19/59 (32%), Gaps = 3/59 (5%) Frame = +1 Query: 772 PXSXFXWXPPSPPXPXPPXXXXXPSPXFSLXXXP---XPXPXXPPXPXXPXTXXXPPPH 939 P + PP PP PP P P P P P P P P PP H Sbjct: 552 PPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVH 610 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP P PP PPP Sbjct: 571 PVFSPPPPVYSPPPPVHSPPPPVHSPPP 598 Score = 31.9 bits (69), Expect = 0.63 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PP PP P PP PP Sbjct: 608 PVHSPPPPPPVYSPPPPVFSPPPSQSPP 635 Score = 31.5 bits (68), Expect = 0.84 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP P PP PPP Sbjct: 564 PVHSPPPPVFSPPPPVYSPPPPVHSPPP 591 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPP 933 PP P PP SP + P P PP P P PP Sbjct: 526 PPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPP 571 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/49 (32%), Positives = 17/49 (34%), Gaps = 3/49 (6%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXP---XXPXTXXXPPP 936 P PP PP P P + P P PP P P PPP Sbjct: 582 PPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPP 630 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PP P P P PP P PPP Sbjct: 591 PPVHSPPPPAPVHSPPPPVHSPPPPPP 617 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP P PP P P P P PP P PPP Sbjct: 518 PPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPP 564 Score = 29.9 bits (64), Expect = 2.6 Identities = 23/98 (23%), Positives = 27/98 (27%) Frame = +1 Query: 643 SAPPXPFXAPXTPAXTLNPHTXXXXXXXXXXXXXXXXXXXXXXPXSXFXWXPPSPPXPXP 822 S PP P +P P + H+ P PP+P P Sbjct: 549 SPPPPPVYSPPPPPPPV--HSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPP 606 Query: 823 PXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P P P P P PP P PPP Sbjct: 607 PPVHSPPPPP--PVYSPPPPVFSPPPSQSPPVVYSPPP 642 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 2/29 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPP--PXPPXXPPP 938 P PP PPP P PP PP PP Sbjct: 607 PPVHSPPPPPPVYSPPPPVFSPPPSQSPP 635 Score = 28.7 bits (61), Expect = 5.9 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP PP P P S P P P P P P Sbjct: 613 PPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPPKINSPPVQSPPPAP 659 Score = 28.7 bits (61), Expect = 5.9 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP P PPP PP PP Sbjct: 624 PVFSPPPSQSPPVVYSPPPRPPKINSPP 651 Score = 28.3 bits (60), Expect = 7.8 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 5/29 (17%) Frame = +3 Query: 870 PPPXPPPX---PPPXPPPX--PPXXPPPP 941 PP PP PPP PP PP PPP Sbjct: 629 PPSQSPPVVYSPPPRPPKINSPPVQSPPP 657 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 V P P P PP P P PP P PPPP Sbjct: 119 VKPPPPPTPYTPPPPTPYTPPPPTVKPPPP 148 Score = 37.5 bits (83), Expect = 0.013 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXP--PPXPPPXPPPXPPXXPPPP 941 P PPP P PP P PPP P PPPP Sbjct: 127 PYTPPPPTPYTPPPPTVKPPPPPVVTPPPP 156 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 2/26 (7%) Frame = +3 Query: 870 PPPXPPPXPPPX--PPPXPPXXPPPP 941 PPP P PPP PPP P PPPP Sbjct: 99 PPPTVKPPPPPYVKPPPPPTVKPPPP 124 Score = 37.1 bits (82), Expect = 0.017 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP P P PPP P PPPP Sbjct: 149 PVVTPPPPTPTPEAPCPPPPPTPYPPPP 176 Score = 36.7 bits (81), Expect = 0.022 Identities = 19/59 (32%), Positives = 22/59 (37%), Gaps = 4/59 (6%) Frame = +1 Query: 772 PXSXFXWXPPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXP----XXPXTXXXPPP 936 P + PP P PP P P ++ P P P PP P P T PPP Sbjct: 90 PPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPP 148 Score = 36.7 bits (81), Expect = 0.022 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPP-XPPPXPPXXPPPP 941 V P P PPP P P PPP P PPPP Sbjct: 111 VKPPPPPTVKPPPPPTPYTPPPPTPYTPPPP 141 Score = 36.3 bits (80), Expect = 0.029 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 2/26 (7%) Frame = +3 Query: 870 PPPX--PPPXPPPXPPPXPPXXPPPP 941 PPP PPP P PPP P PPPP Sbjct: 91 PPPYVKPPPPPTVKPPPPPYVKPPPP 116 Score = 35.9 bits (79), Expect = 0.039 Identities = 19/57 (33%), Positives = 20/57 (35%), Gaps = 2/57 (3%) Frame = +1 Query: 772 PXSXFXWXPPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPP--XPXXPXTXXXPPP 936 P + PP P P PP P P P P PP P P T PPP Sbjct: 68 PPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPP 124 Score = 35.9 bits (79), Expect = 0.039 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPPPXPP-PXPPPXPPPXPPXXPPPP 941 P PPP P PPP P P P PPPP Sbjct: 141 PTVKPPPPPVVTPPPPTPTPEAPCPPPPP 169 Score = 35.5 bits (78), Expect = 0.051 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PP PP PP PPP Sbjct: 76 PPPPYTPKPPTVKPPPPPYVKPPP 99 Score = 35.5 bits (78), Expect = 0.051 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PP PP PP PP PP PPP Sbjct: 84 PPTVKPPPPPYVKPPPPPTVKPPP 107 Score = 35.1 bits (77), Expect = 0.068 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP P PPP P PP PPP Sbjct: 64 PTVKPPPPYIPCPPPPYTPKPPTVKPPP 91 Score = 35.1 bits (77), Expect = 0.068 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P PPP P PPPP Sbjct: 77 PPPYTPKPPTVKPPPPPYVKPPPP 100 Score = 35.1 bits (77), Expect = 0.068 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 PP PP PP P P P PP P P T P P+ Sbjct: 89 PPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPY 136 Score = 35.1 bits (77), Expect = 0.068 Identities = 22/94 (23%), Positives = 25/94 (26%) Frame = +1 Query: 649 PPXPFXAPXTPAXTLNPHTXXXXXXXXXXXXXXXXXXXXXXPXSXFXWXPPSPPXPXPPX 828 PP P+ P P T+ P P + PP P PP Sbjct: 90 PPPPYVKPPPPP-TVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPP 148 Query: 829 XXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXP 930 P P P P P P P P P Sbjct: 149 PVVTPPPPTPTPEAPCPPPPPTPYPPPPKPETCP 182 Score = 34.7 bits (76), Expect = 0.090 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PPP P P PPPP Sbjct: 69 PPPYIPCPPPPYTPKPPTVKPPPP 92 Score = 34.7 bits (76), Expect = 0.090 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXPPP--XPPPXPPXXPPPP 941 P PP P PPP PPP P PPPP Sbjct: 79 PYTPKPPTVKPPPPPYVKPPPPPTVKPPPP 108 Score = 34.7 bits (76), Expect = 0.090 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP P PP P P P P P P P P T PPP Sbjct: 131 PPPTPYTPPPPTVKPPPPPVVTPPPPTPTP-EAPCPPPPPTPYPPPP 176 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = +3 Query: 870 PPPXPPPXPP-PXPPPXPPXXPPPP 941 PPP P P P P PPP P PP P Sbjct: 154 PPPTPTPEAPCPPPPPTPYPPPPKP 178 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +3 Query: 831 PXRSLSXVLPGXXP--PPXPPPXPPPXPPPXPPXXPPPP 941 P S V P P PP PP PP P PP PPP Sbjct: 32 PKPSPHPVKPPKHPAKPPKPPTVKPPTHTPKPPTVKPPP 70 Score = 32.7 bits (71), Expect = 0.36 Identities = 16/48 (33%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = +1 Query: 796 PPSPPXP-XPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P PP P ++ P P PP P PPP Sbjct: 121 PPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPP 168 Score = 31.9 bits (69), Expect = 0.63 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 PP PP PP P P P P P P P PPP+ Sbjct: 48 PPKPPTVKPPTHTPKP-PTVKPPPPYIPCPPPPYTPKPPTVKPPPPPY 94 Score = 31.5 bits (68), Expect = 0.84 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP P PP P P PP P PP Sbjct: 63 PPTVKPPPPYIPCPPPPYTPKPP 85 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +1 Query: 796 PPSPPX---PXPPXXXXXPSPXFSLXXXPXPXPXXPP--XPXXPXTXXXPPP 936 PP PP P PP P P P P PP P P PPP Sbjct: 105 PPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPP 156 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPP 935 P PPP P P PPP P P Sbjct: 163 PCPPPPPTPYPPPPKPETCP 182 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PP P P PP P P PPPP Sbjct: 70 PPYIPCPPPPYTPKPPTVKPPPPP 93 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP P PPP P PP P P Sbjct: 133 PTPYTPPPPTVKPPPPPVVTPPPPTPTP 160 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P PPP P PPP PP P Sbjct: 131 PPPTPYTPPPPTVKPPPPPVVTPPPPTP 158 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 2/29 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXP--PXXPPP 938 P PP P PP PP P P PPP Sbjct: 51 PPTVKPPTHTPKPPTVKPPPPYIPCPPPP 79 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP P P PPP PPPP Sbjct: 52 PTVKPPTHTPKPPTVKPPPPYIPCPPPP 79 Score = 29.1 bits (62), Expect = 4.5 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 2/48 (4%) Frame = +1 Query: 799 PSPPX--PXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P PP P PP P P P P P P T PPP Sbjct: 61 PKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPP 108 Score = 28.3 bits (60), Expect = 7.8 Identities = 17/51 (33%), Positives = 19/51 (37%), Gaps = 5/51 (9%) Frame = +1 Query: 799 PSPPXP-XPPXXXXXPSPXFSLXXXPXPXPXXPP----XPXXPXTXXXPPP 936 P PP PP P P ++ P P PP P P T PPP Sbjct: 82 PKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPP 132 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 38.3 bits (85), Expect = 0.007 Identities = 19/66 (28%), Positives = 20/66 (30%) Frame = +3 Query: 744 GSXPXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPPXPP 923 GS P P P + P P PPP PP PP P Sbjct: 601 GSPPLESPVPNDPYDASPIKKRRPQPPSPSTEETKTTSPQSPPVHSPPPPPPVHSPPPPV 660 Query: 924 XXPPPP 941 PPPP Sbjct: 661 FSPPPP 666 Score = 36.7 bits (81), Expect = 0.022 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXP---PPXPPXXPPPP 941 P PPP PP PP P PP P PPPP Sbjct: 643 PVHSPPPPPPVHSPPPPVFSPPPPMHSPPPP 673 Score = 35.9 bits (79), Expect = 0.039 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 3/27 (11%) Frame = +3 Query: 870 PPPXP---PPXPPPXPPPXPPXXPPPP 941 PPP P PP PP PP P PPPP Sbjct: 743 PPPAPIYSPPPPPVHSPPPPVHSPPPP 769 Score = 35.9 bits (79), Expect = 0.039 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPX---PPPXPPXXPPPP 941 P PPP P PPP PPP P PPPP Sbjct: 747 PIYSPPPPPVHSPPPPVHSPPPPPVHSPPPP 777 Score = 35.5 bits (78), Expect = 0.051 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PPP P PP PPP Sbjct: 678 PPPVHSPPPPPVHSPPPPVHSPPP 701 Score = 35.5 bits (78), Expect = 0.051 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PP PP PP PPP Sbjct: 721 PPPVHSPPPPVQSPPPPPVFSPPP 744 Score = 35.5 bits (78), Expect = 0.051 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PPP P PP PPP Sbjct: 760 PPPVHSPPPPPVHSPPPPVHSPPP 783 Score = 35.1 bits (77), Expect = 0.068 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PP PP P PPPP Sbjct: 664 PPPMHSPPPPVYSPPPPVHSPPPP 687 Score = 35.1 bits (77), Expect = 0.068 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PP PP PP PPP Sbjct: 671 PPPVYSPPPPVHSPPPPPVHSPPP 694 Score = 35.1 bits (77), Expect = 0.068 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PP PP PP PP P PPPP Sbjct: 679 PPVHSPPPPPVHSPPPPVHSPPPP 702 Score = 35.1 bits (77), Expect = 0.068 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PP PP P PPPP Sbjct: 686 PPPVHSPPPPVHSPPPPVHSPPPP 709 Score = 35.1 bits (77), Expect = 0.068 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PP PP P PPPP Sbjct: 693 PPPVHSPPPPVHSPPPPVHSPPPP 716 Score = 35.1 bits (77), Expect = 0.068 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PP PP P PPPP Sbjct: 700 PPPVHSPPPPVHSPPPPVHSPPPP 723 Score = 35.1 bits (77), Expect = 0.068 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PP PP P PPPP Sbjct: 707 PPPVHSPPPPVHSPPPPVHSPPPP 730 Score = 35.1 bits (77), Expect = 0.068 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PP PP P PPPP Sbjct: 714 PPPVHSPPPPVHSPPPPVQSPPPP 737 Score = 35.1 bits (77), Expect = 0.068 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PP PP P PPP P PPPP Sbjct: 722 PPVHSPPPPVQSPPPPPVFSPPPP 745 Score = 35.1 bits (77), Expect = 0.068 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PP PP PP PP P PPPP Sbjct: 761 PPVHSPPPPPVHSPPPPVHSPPPP 784 Score = 35.1 bits (77), Expect = 0.068 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PP PP P PPPP Sbjct: 768 PPPVHSPPPPVHSPPPPVHSPPPP 791 Score = 35.1 bits (77), Expect = 0.068 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PP PP P PPPP Sbjct: 775 PPPVHSPPPPVHSPPPPVHSPPPP 798 Score = 35.1 bits (77), Expect = 0.068 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PP PP P PPPP Sbjct: 782 PPPVHSPPPPVHSPPPPVHSPPPP 805 Score = 34.7 bits (76), Expect = 0.090 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PP PP P PPP P PPPP Sbjct: 672 PPVYSPPPPVHSPPPPPVHSPPPP 695 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PP PP P PPPP Sbjct: 657 PPPVFSPPPPMHSPPPPVYSPPPP 680 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPX--PPPXPPPXPPPXPPXXPPPP 941 P S + PPP PPP P PP PP PPP Sbjct: 723 PVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPP 761 Score = 33.1 bits (72), Expect = 0.27 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = +3 Query: 870 PPPXPPPXPP--PXPPPXPPXXPPPP 941 PPP P PP PPP P PPPP Sbjct: 789 PPPVHSPPPPVHSPPPPSPIYSPPPP 814 Score = 32.7 bits (71), Expect = 0.36 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP P PP PPP Sbjct: 688 PVHSPPPPVHSPPPPVHSPPPPVHSPPP 715 Score = 32.7 bits (71), Expect = 0.36 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP P PP PPP Sbjct: 695 PVHSPPPPVHSPPPPVHSPPPPVHSPPP 722 Score = 32.7 bits (71), Expect = 0.36 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP P PP PPP Sbjct: 702 PVHSPPPPVHSPPPPVHSPPPPVHSPPP 729 Score = 32.7 bits (71), Expect = 0.36 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP P PP PPP Sbjct: 709 PVHSPPPPVHSPPPPVHSPPPPVQSPPP 736 Score = 32.7 bits (71), Expect = 0.36 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP P PP PPP Sbjct: 770 PVHSPPPPVHSPPPPVHSPPPPVHSPPP 797 Score = 32.7 bits (71), Expect = 0.36 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP P PP PPP Sbjct: 777 PVHSPPPPVHSPPPPVHSPPPPVHSPPP 804 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP P PP PPP Sbjct: 659 PVFSPPPPMHSPPPPVYSPPPPVHSPPP 686 Score = 32.3 bits (70), Expect = 0.48 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP PP P P P P P P PPP Sbjct: 684 PPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 730 Score = 32.3 bits (70), Expect = 0.48 Identities = 24/100 (24%), Positives = 27/100 (27%), Gaps = 3/100 (3%) Frame = +1 Query: 643 SAPPXPFXAPXTPAXTLNPHTXXXXXXXXXXXXXXXXXXXXXXPXSXFXWXP---PSPPX 813 S PP P +P PA +P P P P PP Sbjct: 733 SPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPV 792 Query: 814 PXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPP 933 PP P P + P P PP P P P Sbjct: 793 HSPPPPVHSPPPPSPIYSPPPPVFSPPPKPVTPLPPATSP 832 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP PP P P P P P P PPP Sbjct: 648 PPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPP 694 Score = 31.9 bits (69), Expect = 0.63 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP P PP PPP Sbjct: 652 PVHSPPPPVFSPPPPMHSPPPPVYSPPP 679 Score = 31.9 bits (69), Expect = 0.63 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP P PP P P +S P P PP P PPP Sbjct: 656 PPPPVFSPPPPMHSPPPPVYS-PPPPVHSPPPPPVHSPPPPVHSPPP 701 Score = 31.9 bits (69), Expect = 0.63 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP P PP PPP Sbjct: 685 PPPPVHSPPPPVHSPPPPVHSPPP 708 Score = 31.9 bits (69), Expect = 0.63 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP P PP P P FS P P P P P P PPP Sbjct: 721 PPPVHSPPPPVQSPPPPPVFS---PPPPAPIYSPPP--PPVHSPPPP 762 Score = 31.9 bits (69), Expect = 0.63 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP P PP PPP Sbjct: 767 PPPPVHSPPPPVHSPPPPVHSPPP 790 Score = 31.9 bits (69), Expect = 0.63 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PP PP P P P PP PPP Sbjct: 797 PPVHSPPPPSPIYSPPPPVFSPPP 820 Score = 31.5 bits (68), Expect = 0.84 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PP PP P PPP PPPP Sbjct: 715 PPVHSPPPPVHSPPPPVQSPPPPP 738 Score = 31.5 bits (68), Expect = 0.84 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 1/56 (1%) Frame = +1 Query: 772 PXSXFXWXPPSPP-XPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P F PP+P P PP P P S P P P P PPP Sbjct: 736 PPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPP 791 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 3/50 (6%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFS---LXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP P PP P P S P P P P P P PPP Sbjct: 706 PPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPP 755 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP P PP P P S P P P P PPP Sbjct: 663 PPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPP 709 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PP PP P PPP PPPP Sbjct: 665 PPMHSPPPPVYSPPPPVHSPPPPP 688 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/50 (32%), Positives = 17/50 (34%), Gaps = 3/50 (6%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXP---XXPXTXXXPPP 936 PP P PP P P + P P PP P P PPP Sbjct: 727 PPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPP 776 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 1/48 (2%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXP-PXPXXPXTXXXPPP 936 PP PP PP P P P P P P P PPP Sbjct: 766 PPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPP 813 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/49 (30%), Positives = 16/49 (32%) Frame = +1 Query: 790 WXPPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 + PP PP PP P P P PP P PPP Sbjct: 749 YSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 797 Score = 29.9 bits (64), Expect = 2.6 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +1 Query: 796 PPSPPX---PXPPXXXXXPSPXFSLXXXPXPXPXXPPXP--XXPXTXXXPPP 936 P SPP P PP P P FS P P PP P P PPP Sbjct: 639 PQSPPVHSPPPPPPVHSPPPPVFS----PPPPMHSPPPPVYSPPPPVHSPPP 686 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP P PP P P FS P P P P PPP Sbjct: 642 PPVHSPPPPPPVHSPPPPVFS-PPPPMHSPPPPVYSPPPPVHSPPPP 687 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPP---PXPPPXPPPXPPXXPPPP 941 P PPP P P PP PP P P PP Sbjct: 798 PVHSPPPPSPIYSPPPPVFSPPPKPVTPLPP 828 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/49 (28%), Positives = 15/49 (30%) Frame = +1 Query: 790 WXPPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 + PP P PP P P P P P P PPP Sbjct: 675 YSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 723 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P PP PP P P P P P P PPP Sbjct: 692 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPP 737 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/55 (27%), Positives = 16/55 (29%) Frame = +1 Query: 772 PXSXFXWXPPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P + PP P PP P P P P P P PPP Sbjct: 744 PPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 798 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP P PP P P P P P P PPP Sbjct: 670 PPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 716 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P PP PP P P P P P P PPP Sbjct: 699 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPP 744 Score = 29.1 bits (62), Expect = 4.5 Identities = 15/47 (31%), Positives = 17/47 (36%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 P PP PP P P + P P PP P + PP H Sbjct: 713 PPPPVHSPPPPVHSPPPP--VQSPPPPPVFSPPPPAPIYSPPPPPVH 757 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP P PP P P P P P P PPP Sbjct: 759 PPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 805 >At2g04170.1 68415.m00402 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to NtN2 [Medicago truncatula] GI:3776084; contains Pfam profile PF00917: MATH domain Length = 420 Score = 38.3 bits (85), Expect = 0.007 Identities = 33/97 (34%), Positives = 34/97 (35%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXGGX 758 GG GG GGG G G GG G PG G G + R G G Sbjct: 13 GGRGFGGRGGGPGFGPGGPGFGPGGPG-----FGPGGPGFGPGGPGFGGRGPRGPGF-GP 66 Query: 757 LGXEPPHXPRGGXEKGXXCGG*GXLRGXXGPXXGXGG 647 G P PRG G G G G GP G GG Sbjct: 67 RGPGPWSGPRGPRPGGGGGPGPGPWSGPRGPRPGGGG 103 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 G G G GGG G G G G GGG Sbjct: 93 GPRGPRPGGGGGPGSGCGSGTGGG 116 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG 875 GGGG G G G GGG G G Sbjct: 101 GGGGPGSGCGSGTGGGNQGQGG 122 >At5g59270.1 68418.m07427 lectin protein kinase family protein contains Pfam domains PF00139: Legume lectins beta domain and PF00069: Protein kinase domain Length = 668 Score = 37.9 bits (84), Expect = 0.010 Identities = 16/28 (57%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = +3 Query: 843 LSXVL-PGXXPPPXPPPXPPPXPPPXPP 923 LS +L P PPP P PPP PPP PP Sbjct: 256 LSKILDPPNRPPPPSSPPPPPPPPPTPP 283 Score = 36.7 bits (81), Expect = 0.022 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPP 935 PP PPP P PPP PP PP Sbjct: 262 PPNRPPPPSSPPPPPPPPPTPP 283 Score = 35.5 bits (78), Expect = 0.051 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP PP PP PPP PP P PP Sbjct: 262 PPNRPP-PPSSPPPPPPPPPTPP 283 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 37.9 bits (84), Expect = 0.010 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG G GGG GG G Sbjct: 89 GGGGGRGGSGGGYRSGGGGGYSGGGGGG 116 Score = 36.3 bits (80), Expect = 0.029 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG G GGG GG GGG GG G Sbjct: 98 GGGYRSGGGGGYSGGGGGGYSGGGGGG 124 Score = 35.9 bits (79), Expect = 0.039 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGG 881 GGGG GG GGG GG GGG Sbjct: 105 GGGGYSGGGGGGYSGGGGGG 124 Score = 35.1 bits (77), Expect = 0.068 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GG GGG GG GGG G Sbjct: 98 GGGYRSGGGGGYSGGGGGGYSGGGGGGG 125 Score = 32.3 bits (70), Expect = 0.48 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG GG GGG G GGG G Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGG 112 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 37.9 bits (84), Expect = 0.010 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG G GGG GG G Sbjct: 89 GGGGGRGGSGGGYRSGGGGGYSGGGGGG 116 Score = 36.3 bits (80), Expect = 0.029 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG G GGG GG GGG GG G Sbjct: 98 GGGYRSGGGGGYSGGGGGGYSGGGGGG 124 Score = 35.9 bits (79), Expect = 0.039 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGG 881 GGGG GG GGG GG GGG Sbjct: 105 GGGGYSGGGGGGYSGGGGGG 124 Score = 35.1 bits (77), Expect = 0.068 Identities = 16/25 (64%), Positives = 16/25 (64%), Gaps = 2/25 (8%) Frame = -2 Query: 940 GGGGXX--GGXGGGXGGGXGGGXGG 872 GGGG GG GGG GG GGG GG Sbjct: 144 GGGGRREGGGYGGGDGGSYGGGGGG 168 Score = 34.7 bits (76), Expect = 0.090 Identities = 17/30 (56%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXGGXGGGX--GGGXGGGXGGGXXPG 857 GGGG G GGG GGG GGG GG G Sbjct: 136 GGGGGRGYGGGGRREGGGYGGGDGGSYGGG 165 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGG GG GG GGG GG GGG Sbjct: 98 GGGYRSGGGGGYSGGGGGGYSGGG 121 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/27 (59%), Positives = 16/27 (59%), Gaps = 3/27 (11%) Frame = -2 Query: 940 GGGGXXGGXGGG---XGGGXGGGXGGG 869 GGGG GG GGG GG G G GGG Sbjct: 113 GGGGYSGGGGGGYERRSGGYGSGGGGG 139 Score = 32.3 bits (70), Expect = 0.48 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG GG GGG G GGG G Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGG 112 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = -2 Query: 940 GGGGXXGGXG-GGXGGGXGGGXGGG 869 G GG GG G GG G GGG GGG Sbjct: 133 GSGGGGGGRGYGGGGRREGGGYGGG 157 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGG GG GG GG GG GGG Sbjct: 145 GGGRREGGGYGGGDGGSYGGGGGG 168 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 5/29 (17%) Frame = -2 Query: 940 GGGGXXGGX---GGGXGGGXGG--GXGGG 869 GG G GG GGG GGG GG G GGG Sbjct: 139 GGRGYGGGGRREGGGYGGGDGGSYGGGGG 167 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGR 854 GGGG GG G G GGG G GR Sbjct: 120 GGGGGYERRSGGYGSGGGGGGRGYGGGGR 148 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG GG GGG G G GG GG G Sbjct: 130 GGYGSGGGGGGRGYGGGGRREGGGYGG 156 Score = 28.7 bits (61), Expect = 5.9 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = -2 Query: 940 GGGGXXGGX--GGGXGGGXGGGXGGGXXPGRTXERXRXG 830 G GG GG GGG G GGG G G ER G Sbjct: 93 GRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGG 131 >At3g50140.1 68416.m05481 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 508 Score = 37.9 bits (84), Expect = 0.010 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXP--PPXPPXXPPPP 941 P PP PPP PP PP PP PPPP Sbjct: 4 PSKRRPPPPPPPPPRLLVLPPLPPPPPPPP 33 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/28 (60%), Positives = 17/28 (60%), Gaps = 5/28 (17%) Frame = +3 Query: 870 PPPXPPPXP-----PPXPPPXPPXXPPP 938 PPP PPP P PP PPP PP PPP Sbjct: 9 PPPPPPPPPRLLVLPPLPPPPPP--PPP 34 Score = 32.7 bits (71), Expect = 0.36 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 PS P PP P P L P P P PP P P P PH Sbjct: 4 PSKRRPPPPP----PPPPRLLVLPPLPPPPPPPPPQLPFGPKLPFPH 46 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 PP PPP PPP P P P P Sbjct: 23 PPLPPPPPPPPPQLPFGPKLPFP 45 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXP 920 VLP PPP PPP P P P Sbjct: 21 VLPPLPPPPPPPPPQLPFGPKLP 43 >At3g16350.1 68416.m02068 myb family transcription factor ; contains Pfam profile: PF00249 Myb-like DNA-binding domain Length = 387 Score = 37.9 bits (84), Expect = 0.010 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXG 875 GGG GG GGG GGG GGG G Sbjct: 22 GGGTCGGSGGGGGGGGGGGSG 42 Score = 32.7 bits (71), Expect = 0.36 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 922 GGXGGGXGGGXGGGXGGG 869 GG GG GGG GGG GGG Sbjct: 23 GGTCGGSGGGGGGGGGGG 40 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 913 GGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG G Sbjct: 22 GGGTCGGSGGGGGGGGGGG 40 >At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ boundaries domain protein 18 (LBD18) identical to LOB DOMAIN 18 [Arabidopsis thaliana] GI:17227164; supported by full-length cDNA gi:17227163 Length = 262 Score = 37.9 bits (84), Expect = 0.010 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG G GGG GG GGG Sbjct: 13 GGGGGCGGGGSSGGGGSSGGGGGG 36 Score = 34.7 bits (76), Expect = 0.090 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GG GGG G GGG G Sbjct: 12 GGGGGGCGGGGSSGGGGSSGGGGGGPCG 39 Score = 31.5 bits (68), Expect = 0.84 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = -2 Query: 940 GGGGXXGGXGGGXGG-GXGGGXGGGXXPG 857 GGG GGG GG G GG GGG G Sbjct: 3 GGGNTITAVGGGGGGCGGGGSSGGGGSSG 31 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 822 GGGGXGGGGXPXEXAXRGGGG 760 GGGG GGGG GGGG Sbjct: 14 GGGGCGGGGSSGGGGSSGGGG 34 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 37.9 bits (84), Expect = 0.010 Identities = 19/40 (47%), Positives = 20/40 (50%), Gaps = 7/40 (17%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPP----XPPPXPPPXPP---XXPPPP 941 L + P PPP PPP PPP PP PP PPPP Sbjct: 88 LQNIPPPSPPPPSPPPPSQACPPPPLPPSPPKKSYCPPPP 127 Score = 28.7 bits (61), Expect = 5.9 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPP 933 PPSPP P PP P L P PP P PP Sbjct: 93 PPSPPPPSPPPPSQACPPP-PLPPSPPKKSYCPPPPSTYIYMTGPP 137 >At1g62240.1 68414.m07021 expressed protein Length = 227 Score = 37.9 bits (84), Expect = 0.010 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GG G G G G G Sbjct: 192 GGGGGGGGGGGGGGGVDGSGSGSGSGSG 219 Score = 36.3 bits (80), Expect = 0.029 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 GG GG GGG GGG GGG GG Sbjct: 90 GGIVVGGGGGGGGGGGGGGGSGG 112 Score = 35.5 bits (78), Expect = 0.051 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXG 875 GGG GG GGG GGG GG G Sbjct: 95 GGGGGGGGGGGGGGGSGGSNG 115 Score = 35.5 bits (78), Expect = 0.051 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GG G G G G G G G Sbjct: 196 GGGGGGGGGGGVDGSGSGSGSGSGGGSG 223 Score = 35.1 bits (77), Expect = 0.068 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GGG GGG GGG G G G Sbjct: 90 GGIVVGGGGGGGGGGGGGGGSGGSNG 115 Score = 35.1 bits (77), Expect = 0.068 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GG GG GGG GGG GGG GG Sbjct: 90 GGIVVGGGGGGGGGGGGGGGSGG 112 Score = 35.1 bits (77), Expect = 0.068 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GGG G G G G Sbjct: 191 GGGGGGGGGGGGGGGGVDGSGSGSGSG 217 Score = 34.7 bits (76), Expect = 0.090 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG G G G G G G Sbjct: 194 GGGGGGGGGGGGGVDGSGSGSGSGSGGG 221 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GG G G Sbjct: 95 GGGG--GGGGGGGGGGGSGGSNGSFFNG 120 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G G G G G G G G G G Sbjct: 155 GGGGGDGSSGSGSGSGSGSGSGTGTASG 182 Score = 33.1 bits (72), Expect = 0.27 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GG G G G Sbjct: 97 GGGGGGGGGGGGGSGGSNGSFFNGSGSG 124 Score = 33.1 bits (72), Expect = 0.27 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GGG GG G G G G Sbjct: 145 GGGGSGEGSGGGGGGDGSSGSGSGSGSG 172 Score = 31.5 bits (68), Expect = 0.84 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGR 854 GGGG GG G G G G G G GR Sbjct: 105 GGGGGSGGSNGSFFNGSGSGTGYGSGDGR 133 Score = 31.5 bits (68), Expect = 0.84 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G G GGG G G G G G G Sbjct: 147 GGSGEGSGGGGGGDGSSGSGSGSGSGSG 174 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG G GGG GGG GGG G Sbjct: 84 GRADCPGGIVVGGGGGGGGGGGGGGGSG 111 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXP 860 GGG G G G G G G G G P Sbjct: 157 GGGDGSSGSGSGSGSGSGSGTGTASGP 183 Score = 28.7 bits (61), Expect = 5.9 Identities = 17/58 (29%), Positives = 19/58 (32%) Frame = -3 Query: 936 GGGXXXGXGXXXXGGXXGXXXXXXXXXXXXXXXGXGXXGGGGXGGGGXPXEXAXRGGG 763 GG G G G G G GGGG GGGG + + G G Sbjct: 158 GGDGSSGSGSGSGSGSGSGTGTASGPDVYMHVEGGGGGGGGGGGGGGGGVDGSGSGSG 215 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 37.9 bits (84), Expect = 0.010 Identities = 20/47 (42%), Positives = 22/47 (46%), Gaps = 10/47 (21%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXP------PP----XPPPXPPXXPPPP 941 P +L + PPP PPP P PP PPP PP PPPP Sbjct: 560 PLTTLHQPINKTPPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPP 606 Score = 37.9 bits (84), Expect = 0.010 Identities = 20/44 (45%), Positives = 21/44 (47%), Gaps = 7/44 (15%) Frame = +3 Query: 831 PXRSLSXVL---PGXXPPPXPPPXPP----PXPPPXPPXXPPPP 941 P RS+ L P PPP PPP P P P PP PPPP Sbjct: 583 PSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPP 626 Score = 37.1 bits (82), Expect = 0.017 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXP---XXPXTXXXPPP 936 PP PP P PP P + P P P PP P P PPP Sbjct: 572 PPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPP 621 Score = 36.7 bits (81), Expect = 0.022 Identities = 25/77 (32%), Positives = 25/77 (32%), Gaps = 14/77 (18%) Frame = +3 Query: 753 PXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXP---------PPX 905 P PP P R V P PPP PPP P PP Sbjct: 641 PPPPPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPPA 700 Query: 906 PPPXPP-----XXPPPP 941 PPP PP PPPP Sbjct: 701 PPPLPPSSTRLGAPPPP 717 Score = 36.7 bits (81), Expect = 0.022 Identities = 22/67 (32%), Positives = 22/67 (32%), Gaps = 4/67 (5%) Frame = +3 Query: 753 PXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPP----PXPPPXPPPXP 920 P PP P P S L PPP PP P PPP P Sbjct: 677 PSTPPPPPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKT 736 Query: 921 PXXPPPP 941 P PPPP Sbjct: 737 PVPPPPP 743 Score = 35.9 bits (79), Expect = 0.039 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 3/27 (11%) Frame = +3 Query: 870 PPPXPPPXPP---PXPPPXPPXXPPPP 941 PPP PPP PP P PP PPPP Sbjct: 639 PPPPPPPPPPTRIPAAKCAPPPPPPPP 665 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 6/30 (20%) Frame = +3 Query: 870 PPPXPPPXPP------PXPPPXPPXXPPPP 941 PPP PPP PP P PP PPPP Sbjct: 482 PPPPPPPPPPLFTSTTSFSPSQPPPPPPPP 511 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PS P P PP S P P P PP P PPP Sbjct: 615 PSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPP 660 Score = 33.1 bits (72), Expect = 0.27 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 8/31 (25%) Frame = +3 Query: 873 PPXPPPXPPPX--------PPPXPPXXPPPP 941 PP PPP PPP P PP PPPP Sbjct: 482 PPPPPPPPPPLFTSTTSFSPSQPPPPPPPPP 512 Score = 33.1 bits (72), Expect = 0.27 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 8/45 (17%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPX--------PPPXPPXXPPPP 941 P S +P PP PPP PP P PP PPPP Sbjct: 604 PPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPPP 648 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 9/33 (27%) Frame = +3 Query: 852 VLPGXXPPPXPP---------PXPPPXPPPXPP 923 +LP PPP PP P PP PPP PP Sbjct: 480 LLPPPPPPPPPPLFTSTTSFSPSQPPPPPPPPP 512 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 3/50 (6%) Frame = +1 Query: 796 PPSPPXP---XPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P PP P P P P P P P PPP Sbjct: 577 PPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPP 626 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPP 933 P PP P P P P P PP P P PP Sbjct: 546 PPPPPPLPSFSNRDPLTTLHQPINKTPPPPPPPPPPLPSRSIPPP 590 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP P PPPP Sbjct: 522 PSQPPPPPPPPPLFTSTTSFSPSQPPPP 549 Score = 29.1 bits (62), Expect = 4.5 Identities = 20/71 (28%), Positives = 20/71 (28%), Gaps = 8/71 (11%) Frame = +3 Query: 753 PXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPX--------P 908 P PP P F P L P PPP PPP Sbjct: 483 PPPPPPPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPPPLFTSTTSFS 542 Query: 909 PPXPPXXPPPP 941 P PP PP P Sbjct: 543 PSQPPPPPPLP 553 Score = 28.7 bits (61), Expect = 5.9 Identities = 16/51 (31%), Positives = 17/51 (33%), Gaps = 4/51 (7%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXP----PXPXXPXTXXXPPP 936 P PP P PP + FS P P P P P PPP Sbjct: 501 PSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPPPLFTSTTSFSPSQPPPPPP 551 Score = 28.3 bits (60), Expect = 7.8 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 4/51 (7%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXP----PXPXXPXTXXXPPP 936 PP PP P PP S FS P P P P P PPP Sbjct: 482 PPPPPPPPPPLFTSTTS--FSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPP 530 >At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 473 Score = 29.5 bits (63), Expect = 3.4 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 876 PXPPPXPPPXPPPXP 920 P PPP PPP PPP P Sbjct: 280 PSPPPPPPP-PPPLP 293 Score = 28.3 bits (60), Expect = 7.8 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 888 PXPPPXPPPXPP 923 P PPP PPP PP Sbjct: 280 PSPPPPPPPPPP 291 Score = 28.3 bits (60), Expect(2) = 0.012 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 873 PPXPPPXPPPXP 908 PP PPP PPP P Sbjct: 282 PPPPPPPPPPLP 293 Score = 28.3 bits (60), Expect(2) = 0.012 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 885 PPXPPPXPPPXPPXXPPP 938 PP PPP PPP PP Sbjct: 329 PPPPPPPPPPVEYYKSPP 346 >At5g62210.1 68418.m07811 embryo-specific protein-related contains weak similarity to embryo-specific protein 3 (GI:3335171) [Arabidopsis thaliana] Length = 223 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 2/26 (7%) Frame = +3 Query: 870 PPPXP--PPXPPPXPPPXPPXXPPPP 941 PPP P PP P PPP PP PP P Sbjct: 158 PPPSPDFPPFSPSIPPPSPPYFPPEP 183 Score = 37.5 bits (83), Expect = 0.013 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXP---PPXPPXXPPPP 941 P PP P PPP P PP PP PPPP Sbjct: 160 PSPDFPPFSPSIPPPSPPYFPPEPPSIPPPP 190 Score = 35.9 bits (79), Expect = 0.039 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PP PP P PPPP Sbjct: 169 PSIPPPSPPYFPPEPPSIPPPPP 191 Score = 35.5 bits (78), Expect = 0.051 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP PP PP PP PP PP P Sbjct: 172 PPPSPPYFPPEPPSIPPPPPPSP 194 Score = 34.7 bits (76), Expect = 0.090 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 3/24 (12%) Frame = +3 Query: 870 PPPXPP---PXPPPXPPPXPPXXP 932 PPP PP P PP PPP PP P Sbjct: 172 PPPSPPYFPPEPPSIPPPPPPSPP 195 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/28 (46%), Positives = 14/28 (50%), Gaps = 2/28 (7%) Frame = +3 Query: 846 SXVLPGXXPPPXPPPXPP--PXPPPXPP 923 S +P PP PP P P PPP PP Sbjct: 168 SPSIPPPSPPYFPPEPPSIPPPPPPSPP 195 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 37.5 bits (83), Expect = 0.013 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPPPX---PPPXPPPXPPXXPPPP 941 P PPP PPP P P PPP P PPP Sbjct: 385 PPRPPPPAPPPGSGGPKPPPPPGPKGPRPPP 415 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 +P PP PPP P P P P PPPP Sbjct: 379 MPSSAGPPRPPP-PAPPPGSGGPKPPPPP 406 Score = 32.3 bits (70), Expect = 0.48 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPP-PXPPPXPPPXPPXXPPP 938 P PPP P PPP P P P PPP Sbjct: 389 PPPAPPPGSGGPKPPPPPGPKGPRPPPP 416 Score = 31.5 bits (68), Expect = 0.84 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Frame = +3 Query: 870 PPPXPPPXPPPXP-PPXPPXXPPPP 941 PPP P P P PP PP PPP Sbjct: 371 PPPVPAPQMPSSAGPPRPPPPAPPP 395 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PP P PPP PP PPP Sbjct: 159 GPPRPPTRPKSPPPRKSSFPPSRSPPP 185 Score = 30.3 bits (65), Expect(2) = 0.28 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P PP P P P P PP P PP Sbjct: 385 PPRPPPPAPPPGSGGPKP----PPPPGPKGPRPPPPMSLGPKAPRPP 427 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP P PP P P P PP Sbjct: 400 PKPPPPPGPKGPRPPPPMSLGPKAPRPP 427 Score = 28.3 bits (60), Expect = 7.8 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 4/40 (10%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPP----PXPPPXPPXXPPP 938 P R+L+ PG P P P P P PP P PPP Sbjct: 134 PRRNLA-TKPGSSPSPSPSRPPKRSRGPPRPPTRPKSPPP 172 Score = 21.4 bits (43), Expect(2) = 0.28 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +1 Query: 643 SAPPXPFXAPXTPA 684 SAPP P AP P+ Sbjct: 368 SAPPPPVPAPQMPS 381 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 37.5 bits (83), Expect = 0.013 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPPPX---PPPXPPPXPPXXPPPP 941 P PPP PPP P P PPP P PPP Sbjct: 385 PPRPPPPAPPPGSGGPKPPPPPGPKGPRPPP 415 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 +P PP PPP P P P P PPPP Sbjct: 379 MPSSAGPPRPPP-PAPPPGSGGPKPPPPP 406 Score = 32.3 bits (70), Expect = 0.48 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPP-PXPPPXPPPXPPXXPPP 938 P PPP P PPP P P P PPP Sbjct: 389 PPPAPPPGSGGPKPPPPPGPKGPRPPPP 416 Score = 31.5 bits (68), Expect = 0.84 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Frame = +3 Query: 870 PPPXPPPXPPPXP-PPXPPXXPPPP 941 PPP P P P PP PP PPP Sbjct: 371 PPPVPAPQMPSSAGPPRPPPPAPPP 395 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G PP P PPP PP PPP Sbjct: 159 GPPRPPTRPKSPPPRKSSFPPSRSPPP 185 Score = 30.3 bits (65), Expect(2) = 0.28 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P PP P P P P PP P PP Sbjct: 385 PPRPPPPAPPPGSGGPKP----PPPPGPKGPRPPPPMSLGPKAPRPP 427 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP P PP P P P PP Sbjct: 400 PKPPPPPGPKGPRPPPPMSLGPKAPRPP 427 Score = 28.3 bits (60), Expect = 7.8 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 4/40 (10%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPP----PXPPPXPPXXPPP 938 P R+L+ PG P P P P P PP P PPP Sbjct: 134 PRRNLA-TKPGSSPSPSPSRPPKRSRGPPRPPTRPKSPPP 172 Score = 21.4 bits (43), Expect(2) = 0.28 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +1 Query: 643 SAPPXPFXAPXTPA 684 SAPP P AP P+ Sbjct: 368 SAPPPPVPAPQMPS 381 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 37.5 bits (83), Expect = 0.013 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LP PPP P PP PP PP PPPP Sbjct: 20 LPSPVPPP-PSHISPPPPPFSPPHHPPPP 47 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/30 (56%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXP-PPXPPPXP-PXXPPPP 941 P PPP P P P PP P P P P PPPP Sbjct: 51 PPHQPPPSPYPHPHPPPPSPYPHPHQPPPP 80 Score = 35.5 bits (78), Expect = 0.051 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP P P PPP P PPPP Sbjct: 61 PHPHPPPPSPYPHPHQPPPPPHVLPPPP 88 Score = 34.7 bits (76), Expect = 0.090 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 PPP PP PP P PP PPP Sbjct: 35 PPPFSPPHHPPPPHFSPPHQPPP 57 Score = 34.7 bits (76), Expect = 0.090 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PPP P P P P PP P P Sbjct: 47 PHFSPPHQPPPSPYPHPHPPPPSPYPHP 74 Score = 34.3 bits (75), Expect = 0.12 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPP--XPXXPXTXXXPPP 936 P P P PP P P FS P P PP P P PPP Sbjct: 19 PLPSPVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPP 67 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPPPXPP-PXPPPXPPPXPPXXPPPP 941 P P P PP P P P PP PP PPP Sbjct: 59 PYPHPHPPPPSPYPHPHQPPPPPHVLPPP 87 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPP--XXPPPP 941 PP P P P P PP PP PPPP Sbjct: 65 PPPPSPYPHPHQPPPPPHVLPPPPP 89 Score = 33.5 bits (73), Expect = 0.21 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 5/42 (11%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPX---PP--PXPPPXPPXXPPPP 941 P +S P PP PPP PP P P P P PPPP Sbjct: 27 PPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPP 68 Score = 33.1 bits (72), Expect = 0.27 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP P P P PPP PPPP Sbjct: 9 PYYSPPSHQHPLPSPVPPPPSHISPPPP 36 Score = 32.3 bits (70), Expect = 0.48 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Frame = +1 Query: 799 PSPPXPXPPXXXXXP--SPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P PP PP P SP P P P PP P PPP Sbjct: 33 PPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPP 80 Score = 31.9 bits (69), Expect = 0.63 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P P PP P PPP P PPP Sbjct: 19 PLPSPVPPPPSHISPPPPPFSPPHHPPP 46 Score = 31.5 bits (68), Expect = 0.84 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 P P P P PP PP P PP P Sbjct: 68 PSPYPHPHQPPPPPHVLPPPPPTP 91 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 802 SPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 SPP P P P FS P P P P P P P PH Sbjct: 32 SPPPPPFSPPHHPPPPHFSPPHQPPPSPY--PHPHPPPPSPYPHPH 75 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P P P PP PP PP PP P Sbjct: 68 PSPYPHPHQPPPPPHVLPPPPPTPAP 93 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 3/26 (11%) Frame = +3 Query: 870 PPPXP---PPXPPPXPPPXPPXXPPP 938 PPP P P PPP P PP P P Sbjct: 66 PPPSPYPHPHQPPPPPHVLPPPPPTP 91 Score = 28.7 bits (61), Expect = 5.9 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +1 Query: 796 PPSP-PXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXP 912 PPSP P P PP P P P P PP P P Sbjct: 56 PPSPYPHPHPPPPSPYPHPH----QPPPPPHVLPPPPPTP 91 >At5g04970.1 68418.m00526 pectinesterase, putative contains similarity to pectinesterase from Vitis vinifera GI:15081598, Prunus persica SP|Q43062; contains Pfam profile PF01095 pectinesterase Length = 624 Score = 37.5 bits (83), Expect = 0.013 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PP PP PP PP PP P Sbjct: 43 PPTQPPSQPPTQPPTQPPSHPPTQPPTP 70 Score = 36.7 bits (81), Expect = 0.022 Identities = 15/32 (46%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPP--PP 941 + P PP PP PP PP PP PP PP Sbjct: 37 IQPSSQPPTQPPSQPPTQPPTQPPSHPPTQPP 68 Score = 35.1 bits (77), Expect = 0.068 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P PP PP PP PP PP PP Sbjct: 47 PPSQPPTQPPTQPPSHPPTQPPTPPP 72 Score = 33.5 bits (73), Expect = 0.21 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPP 938 PP PP PP PP P PPP Sbjct: 51 PPTQPPTQPPSHPPTQPPTPPP 72 Score = 32.3 bits (70), Expect = 0.48 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPXPPXXPP--PP 941 +S P PP PP P PP PP PP PP Sbjct: 22 VSPTRPPSQPPSHPPIQPSSQPPTQPPSQPPTQPP 56 Score = 32.3 bits (70), Expect = 0.48 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP--PP 941 P P PP PP PP PP PP PP Sbjct: 35 PPIQPSSQPPTQPPSQPPTQPPTQPPSHPP 64 Score = 31.9 bits (69), Expect = 0.63 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P PP PP PP PP PP P Sbjct: 51 PPTQPPTQPPSHPPTQPPTPPPSQSP 76 Score = 31.5 bits (68), Expect = 0.84 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PP PP PP PP P P P Sbjct: 55 PPTQPPSHPPTQPPTPPPSQSPSQPSP 81 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP PP PP PPP P P Sbjct: 59 PPSHPPTQPPTPPPSQSPSQPSP 81 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPP 938 PP PP PPP P P PP Sbjct: 63 PPTQPPTPPPSQSPSQPSPLPP 84 Score = 28.7 bits (61), Expect = 5.9 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P PP PP PP P P PP Sbjct: 59 PPSHPPTQPPTPPPSQSPSQPSPLPP 84 >At3g26400.1 68416.m03292 eukaryotic translation initiation factor 4B, putative/ eIF-4B, putative similar to eukaryotic initiation factor 4B [Arabidopsis thaliana] GI:6739518 Length = 532 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 G GG GG G G GGG GGG GG Sbjct: 194 GDGGGFGGGGSGFGGGGGGGGGG 216 Score = 32.7 bits (71), Expect = 0.36 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXG 830 G GG GGG G GGG GGG R + G Sbjct: 194 GDGGGFGGGGSGFGGGGGGGGGGLSRADDVDNWG 227 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G GGG GGG G GGG G Sbjct: 187 GRQGRYSGDGGGFGGGGSGFGGGGGGGG 214 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 37.5 bits (83), Expect = 0.013 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPX---PPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP P P PPPP Sbjct: 384 PPPPPPPSAAAPPPPPPPKKGPAAPPPPPPP 414 Score = 34.7 bits (76), Expect = 0.090 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 5/29 (17%) Frame = +3 Query: 870 PPPXPPPX-----PPPXPPPXPPXXPPPP 941 PPP PPP PPP PPP PPP Sbjct: 395 PPPPPPPKKGPAAPPPPPPPGKKGAGPPP 423 Score = 33.5 bits (73), Expect = 0.21 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P P PPP PPP PPPP Sbjct: 372 PPAPPGPANQTSPPPPPPPSAAAPPPPP 399 Score = 33.1 bits (72), Expect = 0.27 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 8/36 (22%) Frame = +3 Query: 858 PGXXPPPXPPPXPPP---XPPPXP-----PXXPPPP 941 PG PPP PPP PPP P P PPPP Sbjct: 376 PGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPP 411 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPPPXP---PPXPPPXPPXXPPPP 941 P PPP PP PP PPP PP P Sbjct: 405 PAAPPPPPPPGKKGAGPPPPPPMSKKGPPKP 435 Score = 31.5 bits (68), Expect = 0.84 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 5/29 (17%) Frame = +3 Query: 870 PPPXPPPX-----PPPXPPPXPPXXPPPP 941 PPP PPP PPP PP P PP Sbjct: 408 PPPPPPPGKKGAGPPPPPPMSKKGPPKPP 436 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 802 SPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 SPP P PP P P P P PP P PPP Sbjct: 383 SPPPPPPPSAAAPPPPPPPKKGPAAPPP--PPPPGKKGAGPPPPP 425 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/51 (31%), Positives = 18/51 (35%), Gaps = 4/51 (7%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXP----XPXXPPXPXXPXTXXXPPP 936 PP+PP P P P + P P P PP P P PP Sbjct: 372 PPAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPP 422 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P PPP PPP P PPP Sbjct: 400 PPKKGPAAPPPPPPPGKKGAGPPPPPP 426 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 6/29 (20%) Frame = +3 Query: 873 PPXPP------PXPPPXPPPXPPXXPPPP 941 PP PP PPP PP PPPP Sbjct: 372 PPAPPGPANQTSPPPPPPPSAAAPPPPPP 400 >At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 302 Score = 37.1 bits (82), Expect = 0.017 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP P P PP PPPP Sbjct: 98 PPPQPPPPPQPLNLFSPPPPPPPP 121 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/27 (48%), Positives = 14/27 (51%), Gaps = 4/27 (14%) Frame = +3 Query: 855 LPGXXPPPXPPPX----PPPXPPPXPP 923 +P PPP P P PPP PPP P Sbjct: 97 IPPPQPPPPPQPLNLFSPPPPPPPPDP 123 >At5g19750.1 68418.m02348 peroxisomal membrane 22 kDa family protein similar to SP|P42925 22 kDa peroxisomal membrane protein {Mus musculus}; contains Pfam profile PF04117: Mpv17 / PMP22 family Length = 288 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGR 854 GG G GG GGG GG GGG G G+ Sbjct: 82 GGSGGLGGSGGGGGGSGGGGGDGSDGKGK 110 Score = 35.5 bits (78), Expect = 0.051 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 G G GG GG GGG G G GGG Sbjct: 79 GNSGGSGGLGGSGGGGGGSGGGGG 102 Score = 34.7 bits (76), Expect = 0.090 Identities = 16/27 (59%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = -2 Query: 934 GGXXGGXGG-GXGGGXGGGXGGGXXPG 857 GG GG GG G GG GGG GGG G Sbjct: 78 GGNSGGSGGLGGSGGGGGGSGGGGGDG 104 >At5g19090.1 68418.m02269 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 587 Score = 37.1 bits (82), Expect = 0.017 Identities = 28/92 (30%), Positives = 34/92 (36%) Frame = -2 Query: 922 GGXGGGXGGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXGGXLGXEP 743 GG GGG GG GG GGG G + + G P + G GG Sbjct: 313 GGGGGGPGGKKGGPGGGG---GNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGGGG----- 364 Query: 742 PHXPRGGXEKGXXCGG*GXLRGXXGPXXGXGG 647 P+ +GG G G +G G G GG Sbjct: 365 PNGNKGGGGVQMNGGPNGGKKGGGGGGGGGGG 396 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/36 (52%), Positives = 19/36 (52%), Gaps = 9/36 (25%) Frame = -2 Query: 940 GGGGXXGGX---------GGGXGGGXGGGXGGGXXP 860 GGGG GG GGG GGG GGG GGG P Sbjct: 105 GGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGGP 140 Score = 34.7 bits (76), Expect = 0.090 Identities = 30/101 (29%), Positives = 34/101 (33%), Gaps = 3/101 (2%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGG-GXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXG 764 GGGG GG GG GGG G G G+ + G G G G Sbjct: 314 GGGGGPGGKKGGPGGGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGGGGPNGNKGGGG 373 Query: 763 GXLGXEPPHXPRGGXEKGXXCGG--*GXLRGXXGPXXGXGG 647 + P +GG G GG G L P G GG Sbjct: 374 VQMNGGPNGGKKGGGGGGGGGGGPMSGGLPPGFRPMGGGGG 414 Score = 33.5 bits (73), Expect = 0.21 Identities = 30/99 (30%), Positives = 32/99 (32%), Gaps = 7/99 (7%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG-----XXPGRTXERXRXGXXXXXXXXXXXGPKXXRX 776 GGG G GG GGG G GGG P + G P R Sbjct: 349 GGGHPLDGKMGGGGGGPNGNKGGGGVQMNGGPNGGKKGGGGGGGGGGGPMSGGLPPGFRP 408 Query: 775 XGXGGXLGXEPP--HXPRGGXEKGXXCGG*GXLRGXXGP 665 G GG G P P GG G G + G GP Sbjct: 409 MGGGGGGGGGPQSMSMPMGG-AMGGPMGSLPQMGGGPGP 446 Score = 31.9 bits (69), Expect = 0.63 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 3/31 (9%) Frame = -2 Query: 940 GGGGXXGGXGG---GXGGGXGGGXGGGXXPG 857 GGGG G G GGG GGG GGG G Sbjct: 109 GGGGPANNNKGQKIGGGGGGGGGGGGGGGGG 139 >At5g08230.1 68418.m00965 PWWP domain-containing protein putative transcription factor (HUA2) - Arabidopsis thaliana, EMBL:AF116556 Length = 1445 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 3/26 (11%) Frame = +3 Query: 873 PPXPPPXP---PPXPPPXPPXXPPPP 941 P PP P PP PPP PP PPPP Sbjct: 1122 PAGSPPLPHESPPSPPPQPPSSPPPP 1147 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP PP P PPP PPP Sbjct: 1141 PSSPPPPSSPPQLAPAPPPSDHCLPPP 1167 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 3/26 (11%) Frame = +3 Query: 873 PPXP---PPXPPPXPPPXPPXXPPPP 941 PP P PP PPP PP PP PP Sbjct: 1126 PPLPHESPPSPPPQPPSSPPPPSSPP 1151 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PP PPP P P P PP Sbjct: 1136 PPPQPPSSPPP-PSSPPQLAPAPP 1158 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +3 Query: 846 SXVLPGXXPPPXPP-PXPPPXPPPXPPXXPPPP 941 S LP PP PP P P PP PP P P Sbjct: 1125 SPPLPHESPPSPPPQPPSSPPPPSSPPQLAPAP 1157 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXP 912 PPSPP P PP PS L P P P P P Sbjct: 1133 PPSPP-PQPPSSPPPPSSPPQLAPAPPPSDHCLPPPTAP 1170 Score = 29.5 bits (63), Expect = 3.4 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P P P P PP PP P PP Sbjct: 1134 PSPPPQPPSSPPPPSSPPQLAPAPPP 1159 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 37.1 bits (82), Expect = 0.017 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LS ++ PP PPP PPP P P PP P P Sbjct: 151 LSVIVLWSSDPPLPPP-PPPYPSPLPPPPSPSP 182 Score = 36.3 bits (80), Expect = 0.029 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP PPP P P PPP P P P Sbjct: 164 PPPPPPYPSPLPPPPSPSPTPGP 186 Score = 34.7 bits (76), Expect = 0.090 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 VL PP PPP P P P P PP P P Sbjct: 155 VLWSSDPPLPPPPPPYPSPLPPPPSPSPTP 184 Score = 32.3 bits (70), Expect = 0.48 Identities = 20/69 (28%), Positives = 21/69 (30%), Gaps = 1/69 (1%) Frame = +3 Query: 738 WGGSXPXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLP-GXXPPPXPPPXPPPXPPP 914 W P PP P + P L P P P PPP P P P P Sbjct: 157 WSSDPPLPPPPPP--YPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGP 214 Query: 915 XPPXXPPPP 941 P P P Sbjct: 215 DSPLPSPGP 223 Score = 32.3 bits (70), Expect = 0.48 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 P P PPP P P P P P P P Sbjct: 247 PSPGPPPSPSPTPGPDSPLPSPGP 270 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +3 Query: 855 LPGXXPPPXPPPXP-PPXPPPXPPXXPPP 938 LPG P P P P P P P PP P P Sbjct: 229 LPGPPPSSSPTPGPDSPLPSPGPPPSPSP 257 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 LP PPP P P P P P PP P Sbjct: 227 LPLPGPPPSSSPTPGPDSPLPSPGPPPSP 255 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPP-PXPPXXPPPP 941 LP PPP P P P P P P P P P Sbjct: 246 LPSPGPPPSPSPTPGPDSPLPSPGPDSPLP 275 Score = 30.3 bits (65), Expect = 1.9 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = +1 Query: 796 PPSP-PXPXPPXXXXXPSPXFSLXXXPXPXPX--XPPXPXXPXTXXXPPP 936 PPSP P P P P P L P P P P P P PPP Sbjct: 205 PPSPSPTPGPDSPLPSPGPDSPLPL-PGPPPSSSPTPGPDSPLPSPGPPP 253 Score = 29.5 bits (63), Expect = 3.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPPP 941 P P P PPP P P P P P Sbjct: 245 PLPSPGPPPSPSPTPGPDSPLP 266 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPP-PXPPXXPPPP 941 LP PPP P P P P P P P P P Sbjct: 199 LPLPGPPPSPSPTPGPDSPLPSPGPDSPLP 228 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPP-PXPPPXPPPXPPPXPPXXPPPP 941 PG P P P P P P P P P P P Sbjct: 240 PGPDSPLPSPGPPPSPSPTPGPDSPLPSP 268 Score = 28.3 bits (60), Expect = 7.8 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 4/33 (12%) Frame = +3 Query: 855 LPGXXPPPXPPPXPP-PXPPPXPPX---XPPPP 941 LPG P P P P P P P P P P PP Sbjct: 201 LPGPPPSPSPTPGPDSPLPSPGPDSPLPLPGPP 233 >At2g34670.1 68415.m04259 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 561 Score = 37.1 bits (82), Expect = 0.017 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXP 932 PP PPP PP PPP PP P Sbjct: 75 PPSPPPTLPPSPPPPPPFSP 94 Score = 33.1 bits (72), Expect = 0.27 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 885 PPXPPPXPPPXPPXXPPPP 941 PP PPP PP PP PPPP Sbjct: 75 PPSPPPTLPPSPP--PPPP 91 Score = 32.7 bits (71), Expect = 0.36 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPXPPXXPP 935 LS LP PPP PP PPP PP P P Sbjct: 70 LSLPLP-PSPPPTLPPSPPPPPPFSPDLRNP 99 Score = 32.3 bits (70), Expect = 0.48 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 888 PXPPPXPPPXPPXXPPPP 941 P PP PP PP PPPP Sbjct: 73 PLPPSPPPTLPPSPPPPP 90 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPP 938 P PP PP PP PP PPP Sbjct: 73 PLPPSPPPTLPPSPPP--PPP 91 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG G GGG GG Sbjct: 91 GGGGHRGGGGGGYRSGGGGGYSGG 114 Score = 36.7 bits (81), Expect = 0.022 Identities = 18/32 (56%), Positives = 18/32 (56%), Gaps = 4/32 (12%) Frame = -2 Query: 940 GGGGXXGGX----GGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG GG G Sbjct: 143 GGGGSYGGGRREGGGGYGGGEGGGYGGSGGGG 174 Score = 35.1 bits (77), Expect = 0.068 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GG GGG G GGG G Sbjct: 106 GGGGGYSGGGGSYGGGGGRREGGGGYSG 133 Score = 34.7 bits (76), Expect = 0.090 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGG-GXGGGXXPG 857 GGGG G GGG GG G G GGG G Sbjct: 99 GGGGYRSGGGGGYSGGGGSYGGGGGRREG 127 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -2 Query: 940 GGGGXXGGXGG-GXGGGXGGGXGGGXXPG 857 GGGG GG GG GG GG GGG G Sbjct: 127 GGGGYSGGGGGYSSRGGGGGSYGGGRREG 155 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GGG GG GG GG GG GGG G R G Sbjct: 92 GGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGG 128 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGR 854 GGGG GG GG GG G GGG R Sbjct: 113 GGGGSYGGGGGRREGGGGYSGGGGGYSSR 141 Score = 32.3 bits (70), Expect = 0.48 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG GG GGG G GGG G Sbjct: 88 GSGGGGGHRGGGGGGYRSGGGGGYSGG 114 Score = 31.9 bits (69), Expect = 0.63 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 4/33 (12%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXG----GGXGGGXXPGR 854 GGGG G GG GGG G GG GG GR Sbjct: 120 GGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGR 152 Score = 31.5 bits (68), Expect = 0.84 Identities = 18/34 (52%), Positives = 18/34 (52%), Gaps = 6/34 (17%) Frame = -2 Query: 940 GGGGXX---GGXGGGXGGG---XGGGXGGGXXPG 857 GGGG GG GG GGG GGG GGG G Sbjct: 133 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGG 166 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 G GG G GGG GG GG GG Sbjct: 88 GSGGGGGHRGGGGGGYRSGGGGG 110 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXG 875 GGG GG GG GG GGG G Sbjct: 155 GGGGYGGGEGGGYGGSGGGGG 175 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 4/36 (11%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGG----GXGGGXXPGRTXE 845 GGGG GGG GG GG G GGG G E Sbjct: 119 GGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRRE 154 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G G GGG GG GG G Sbjct: 142 GGGGGSYGGGRREGGGGYGGGEGGGYGG 169 >At1g53620.1 68414.m06094 glycine-rich protein Length = 143 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGGG GG G GGG GGG GG Sbjct: 73 GGGGDGGGCDGDAGGGDGGGCGG 95 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 GG GG GGG G GGG GGG Sbjct: 70 GGCGGGGDGGGCDGDAGGGDGGG 92 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 GGG G GGG GGG GG G G Sbjct: 78 GGGCDGDAGGGDGGGCGGCGGCG 100 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 37.1 bits (82), Expect = 0.017 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG GG GG GGG G Sbjct: 173 GGGVIIGGGGGGCGGSCSGGGGGGGGYG 200 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GGG GGG G G GGG Sbjct: 122 GGGGGGVVIGGGFGGGAGYGSGGG 145 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG G GG GGG G G GGG G Sbjct: 141 GSGGGLGWDGGNGGGGPGYGSGGGGIGG 168 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGGG G GG GGG G G GG Sbjct: 181 GGGGCGGSCSGGGGGGGGYGHGG 203 Score = 33.9 bits (74), Expect = 0.16 Identities = 31/98 (31%), Positives = 31/98 (31%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXGG 761 GGG GG G G GGG GG GG G G G GG Sbjct: 109 GGGPGYGGGGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGG 168 Query: 760 XLGXEPPHXPRGGXEKGXXCGG*GXLRGXXGPXXGXGG 647 G GG G CGG G G G GG Sbjct: 169 GGGIGGGVIIGGG---GGGCGGSCSGGGGGGGGYGHGG 203 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 3/30 (10%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGG---XGGGXXPG 857 GGG G GGG G G GGG GGG G Sbjct: 108 GGGGPGYGGGGYGPGGGGGGVVIGGGFGGG 137 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGG 869 GG GG G GGG G G GGG Sbjct: 105 GGYGGGGPGYGGGGYGPGGGGG 126 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 37.1 bits (82), Expect = 0.017 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GGG G G GGG GG G Sbjct: 400 GGGGGGGDGGGGQGTGIGGGGGGEQGTG 427 Score = 35.5 bits (78), Expect = 0.051 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG G GGG GG G G GGG Sbjct: 408 GGGGQGTGIGGGGGGEQGTGVGGG 431 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG G G GGG GG G G G Sbjct: 404 GGGDGGGGQGTGIGGGGGGEQGTGVGGG 431 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 G GG GG GG GGG G G GGG Sbjct: 398 GCGG--GGGGGDGGGGQGTGIGGG 419 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G G GGG G G GGG G Sbjct: 451 GGGGGEQGVTGSDGGG-GRGRGGGKVAG 477 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GG G G GGG GGG GGG Sbjct: 387 GGAGAVTQVMQGCGGGGGGGDGGG 410 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 36.7 bits (81), Expect = 0.022 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 8/45 (17%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPP--------PXPPPXPPXXPPPP 941 P S V PPP PP PP P PPP PP P PP Sbjct: 696 PPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPP 740 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 7/44 (15%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPP-------PXPPPXPPXXPPPP 941 P S S P PP PPP PP PPP PP P PP Sbjct: 675 PPISNSDKKPALPRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPP 718 Score = 36.3 bits (80), Expect = 0.029 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 5/33 (15%) Frame = +3 Query: 858 PGXXPPPXPPPX-----PPPXPPPXPPXXPPPP 941 P PP P P PPP PPP PP PP P Sbjct: 710 PPPAPPAPPTPIVHTSSPPPPPPPPPPPAPPTP 742 Score = 33.1 bits (72), Expect = 0.27 Identities = 16/46 (34%), Positives = 18/46 (39%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P PP P PP S + P P P PP P + PPP Sbjct: 687 PRPPPPPPPPPMQH-STVTKVPPPPPPAPPAPPTPIVHTSSPPPPP 731 Score = 32.7 bits (71), Expect = 0.36 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P PP S S P P P P P PPP Sbjct: 728 PPPPPPPPPPAPPTPQSNGISAMKSSPPAP--PAPPRLPTHSASPPP 772 Score = 32.7 bits (71), Expect = 0.36 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP PP P P PP PPPP Sbjct: 757 PPAPPRLPTHSASPPPPTAPPPP 779 Score = 32.7 bits (71), Expect = 0.36 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PPP P PPPP Sbjct: 770 PPPPTAPPPPPLGQTRAPSAPPPP 793 Score = 31.9 bits (69), Expect = 0.63 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXP----PXXPPPP 941 P RS + P P P PPP PPP PPPP Sbjct: 670 PARSPPPISNSDKKPALPRPPPPPPPPPMQHSTVTKVPPPP 710 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/55 (30%), Positives = 19/55 (34%) Frame = +1 Query: 772 PXSXFXWXPPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P S P P P PP P ++ P P P PP P P PP Sbjct: 676 PISNSDKKPALPRPPPPP--PPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPP 728 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXT 918 P PP P PP P+P P P P PP P P T Sbjct: 707 PPPPPPAPPAP---PTPIVHTSSPPPPPP--PPPPPAPPT 741 Score = 29.5 bits (63), Expect = 3.4 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 6/35 (17%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXP------PPXPPXXPPPP 941 LP P PP PPP P P PP PPPP Sbjct: 763 LPTHSASPPPPTAPPPPPLGQTRAPSAPP--PPPP 795 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 36.7 bits (81), Expect = 0.022 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPP 938 PP PP PP PP PP PPP Sbjct: 37 PPPPPVYSPPISPPPPPPPPPP 58 Score = 36.3 bits (80), Expect = 0.029 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PP PPP PP PPPP Sbjct: 37 PPPPPVYSPPISPPPPPP--PPPP 58 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 6/34 (17%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPP------XPPXXPPPP 941 P PP PP PPP PPP PPPP Sbjct: 40 PPVYSPPISPPPPPPPPPPQSHAAAYKRYSPPPP 73 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 36.7 bits (81), Expect = 0.022 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXP 932 P P PPP PPP PPP PP P Sbjct: 69 PSPSPPPPPPPRPPP-PPLSP 88 Score = 36.3 bits (80), Expect = 0.029 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 846 SXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 S VLP PPP PPP P P PPPP Sbjct: 101 SSVLPPPPPPPPPPPPPSSTWDFWDPFIPPPP 132 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 19/47 (40%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXP-------------------PPXPPXXPPPP 941 P PPP PPP PPP P PP PP PPPP Sbjct: 69 PSPSPPPPPPPRPPPPPLSPGSETTTWTTTTTSSVLPPPPPPPPPPP 115 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 885 PPXPPPXPPPXPPXXPPPP 941 PP P P PPP PP PPPP Sbjct: 68 PPSPSPPPPP-PPRPPPPP 85 Score = 33.9 bits (74), Expect = 0.16 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPP 935 PP P P PPP P P PP P Sbjct: 68 PPSPSPPPPPPPRPPPPPLSP 88 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P PP P + PP P P PPP Sbjct: 73 PPPPPPPRPPPPPLSPGSETTTWTTTTTSSVLPPPP--PPPPPPPPP 117 >At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1 predicted transmembrane domain; Length = 175 Score = 36.7 bits (81), Expect = 0.022 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG G GG GGG GGG GGG G Sbjct: 144 GGGSHGHGCGGGGGGGGGGLGGGGCGG 170 Score = 36.3 bits (80), Expect = 0.029 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG GGG GG GGG GGG G Sbjct: 149 GHGCGGGGGGGGGGLGGGGCGGGGCGG 175 Score = 35.1 bits (77), Expect = 0.068 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGGG GG G G GG GGG GG Sbjct: 153 GGGGGGGGGGLGGGGCGGGGCGG 175 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 G GG GG GGG GGG GG G G Sbjct: 151 GCGGGGGGGGGGLGGGGCGGGGCG 174 >At3g08640.1 68416.m01003 alphavirus core protein family contains Pfam profile: PF00944 alphavirus core protein Length = 337 Score = 36.7 bits (81), Expect = 0.022 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG G GGG G G GGG GG Sbjct: 63 GGGGSTGNNGGGSGSGGGGGGFGG 86 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXE 845 GGGG GG G GGG G G GGG G E Sbjct: 61 GGGG--GGSTGNNGGGSGSGGGGGGFGGSGGE 90 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXE 845 GGGG G GG G GGG G G G E Sbjct: 62 GGGGGSTGNNGGGSGSGGGGGGFGGSGGEASE 93 >At3g08630.1 68416.m01002 expressed protein Length = 339 Score = 36.7 bits (81), Expect = 0.022 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG G GGG G G GGG GG Sbjct: 63 GGGGSIGNHGGGSGSGGGGGGYGG 86 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXE 845 GGGG GG G GGG G G GGG G E Sbjct: 61 GGGG--GGSIGNHGGGSGSGGGGGGYGGSEEE 90 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 36.7 bits (81), Expect = 0.022 Identities = 18/32 (56%), Positives = 18/32 (56%), Gaps = 4/32 (12%) Frame = -2 Query: 940 GGGGXXGGX----GGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG GG G Sbjct: 126 GGGGSYGGGRREGGGGYGGGEGGGYGGSGGGG 157 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -2 Query: 940 GGGGXXGGXGG-GXGGGXGGGXGGGXXPG 857 GGGG GG GG GG GG GGG G Sbjct: 110 GGGGYSGGGGGYSSRGGGGGSYGGGRREG 138 Score = 31.9 bits (69), Expect = 0.63 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 4/33 (12%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXG----GGXGGGXXPGR 854 GGGG G GG GGG G GG GG GR Sbjct: 103 GGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGR 135 Score = 31.5 bits (68), Expect = 0.84 Identities = 18/34 (52%), Positives = 18/34 (52%), Gaps = 6/34 (17%) Frame = -2 Query: 940 GGGGXX---GGXGGGXGGG---XGGGXGGGXXPG 857 GGGG GG GG GGG GGG GGG G Sbjct: 116 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGG 149 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGR 854 GGG GG GG GG G GGG R Sbjct: 97 GGGSYGGGGGRREGGGGYSGGGGGYSSR 124 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXG 875 GGG GG GG GG GGG G Sbjct: 138 GGGGYGGGEGGGYGGSGGGGG 158 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 3/27 (11%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGG---XGGGXGGG 869 GGGG GG G GGG GGG GG Sbjct: 91 GGGGHRGGGSYGGGGGRREGGGGYSGG 117 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 4/36 (11%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGG----GXGGGXXPGRTXE 845 GGGG GGG GG GG G GGG G E Sbjct: 102 GGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRRE 137 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GG GGG G GGG G Sbjct: 90 GGGGGHRG-GGSYGGGGGRREGGGGYSG 116 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGG GG G GGG G GGG Sbjct: 97 GGGSYGGGGGRREGGGGYSGGGGG 120 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 G GG G GGG GG GG GG Sbjct: 88 GSGGGGGHRGGGSYGGGGGRREGG 111 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G G GGG GG GG G Sbjct: 125 GGGGGSYGGGRREGGGGYGGGEGGGYGG 152 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 36.7 bits (81), Expect = 0.022 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP PP PP PPP P PPP Sbjct: 81 PDLTPPPSSPP-PPDAPPPIPIVFPPP 106 Score = 35.1 bits (77), Expect = 0.068 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 PPP P PPP PP PP PPP Sbjct: 77 PPPPPDLTPPPSSPP-PPDAPPP 98 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXPPP--XPPPXPPXXPPPP 941 P PPP P PPP PPP PPPP Sbjct: 92 PPDAPPPIPIVFPPPIDSPPPESTNSPPPP 121 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPP---XPPXXPPPP 941 P PP PP P PPP PP PPPP Sbjct: 63 PTVSSPPPPPLDSSPPPPPDLTPPPSSPPPP 93 Score = 33.1 bits (72), Expect = 0.27 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXP----PPXPPXXPPPP 941 P +L + P PP PPP P PP PP PPP Sbjct: 47 PPPALPSLPPAVFSPPPTVSSPPPPPLDSSPPPPPDLTPPP 87 Score = 31.5 bits (68), Expect = 0.84 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +3 Query: 855 LPGXXPPPX--PPPXPPPXPPPXPPXXPPPP 941 +P PPP PPP PPP PPPP Sbjct: 99 IPIVFPPPIDSPPPESTNSPPPPEVFEPPPP 129 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 5/29 (17%) Frame = +3 Query: 870 PPPX--PPPXPPPXPPPXPPXXP---PPP 941 PPP PPP PP PP PP P PPP Sbjct: 79 PPPDLTPPPSSPP-PPDAPPPIPIVFPPP 106 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPP-PXPPXXPPPP 941 P + S P PP PP PP P PP PPP Sbjct: 112 PESTNSPPPPEVFEPPPPPADEDESPPAPPPPEQLPPP 149 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 2/26 (7%) Frame = +3 Query: 870 PPPXPPPX--PPPXPPPXPPXXPPPP 941 PPP PP PPP P PP PP Sbjct: 37 PPPSPPADSSPPPALPSLPPAVFSPP 62 Score = 28.3 bits (60), Expect = 7.8 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP P P P P P PPP Sbjct: 86 PPSSPPPPDAPPPIPIVFPPPIDSPPP 112 >At1g61750.1 68414.m06964 expressed protein contains Pfam profile: PF01657 domain of unknown function Length = 352 Score = 36.7 bits (81), Expect = 0.022 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = +3 Query: 870 PPPXPPPXPPPXPPP 914 PPP PPP PPP PPP Sbjct: 247 PPPPPPPPPPPPPPP 261 Score = 33.9 bits (74), Expect = 0.16 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = +3 Query: 882 PPPXPPPXPPPXPP 923 PPP PPP PPP PP Sbjct: 247 PPPPPPPPPPPPPP 260 Score = 33.9 bits (74), Expect = 0.16 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = +3 Query: 882 PPPXPPPXPPPXPP 923 PPP PPP PPP PP Sbjct: 248 PPPPPPPPPPPPPP 261 Score = 33.5 bits (73), Expect = 0.21 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 876 PXPPPXPPPXPPPXP 920 P PPP PPP PPP P Sbjct: 247 PPPPPPPPPPPPPPP 261 Score = 33.5 bits (73), Expect = 0.21 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 894 PPPXPPPXPPXXPPP 938 PPP PPP PP PPP Sbjct: 247 PPPPPPPPPPPPPPP 261 Score = 33.5 bits (73), Expect = 0.21 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 897 PPXPPPXPPXXPPPP 941 PP PPP PP PPPP Sbjct: 247 PPPPPPPPPPPPPPP 261 Score = 29.9 bits (64), Expect = 2.6 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 858 PGXXPPPXPPPXPPP 902 P PPP PPP PPP Sbjct: 247 PPPPPPPPPPPPPPP 261 >At1g27750.1 68414.m03391 ubiquitin system component Cue domain-containing protein very low similarity to ASC-1 complex subunit P100 [Homo sapiens] GI:12061187; contains Pfam profile PF02845: CUE domain Length = 1973 Score = 36.7 bits (81), Expect = 0.022 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP P PPP P PP PPPP Sbjct: 873 PPEMMPPPPQALPPPLPHSHPPLVPPPP 900 Score = 35.1 bits (77), Expect = 0.068 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 SL VL P PP PPP P PP PPP Sbjct: 854 SLPSVLQPPLQPQSQPPEPPPEMMPPPPQALPPP 887 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P L LP PP P PP PP P PPPP Sbjct: 847 PPPPLGHSLPSVLQPPLQPQSQPPEPP--PEMMPPPP 881 >At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1696 Score = 36.7 bits (81), Expect = 0.022 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PP P P PPP PPP PP P Sbjct: 19 PHLHPPSAPLPPPPPLPPPPPPRQSHP 45 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 P P PP P P PP PPPP Sbjct: 16 PYSPHLHPPSAPLPPPPPLPPPP 38 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 36.3 bits (80), Expect = 0.029 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG GG GG GGG GG G Sbjct: 151 GGSGGYGGGAGGYGGNSGGGYGGNAAGG 178 Score = 35.9 bits (79), Expect = 0.039 Identities = 16/24 (66%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -2 Query: 940 GGGGXXGGXGG-GXGGGXGGGXGG 872 GGGG GG GG G GG GGG GG Sbjct: 126 GGGGYGGGGGGYGGSGGYGGGAGG 149 Score = 34.7 bits (76), Expect = 0.090 Identities = 16/25 (64%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = -2 Query: 940 GGGGXXGGXGGGXGG-GXGGGXGGG 869 GGG GG GGG GG G GG GGG Sbjct: 122 GGGFGGGGYGGGGGGYGGSGGYGGG 146 Score = 34.7 bits (76), Expect = 0.090 Identities = 16/25 (64%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = -2 Query: 940 GGGGXXGGXGGGXGG-GXGGGXGGG 869 GG G GG GGG GG G GG GGG Sbjct: 135 GGYGGSGGYGGGAGGYGGSGGYGGG 159 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GG GGG GG G G G Sbjct: 122 GGGFGGGGYGGGGGGYGGSGGYGGGAG 148 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GG GGG GG G G G Sbjct: 131 GGGGGGYGGSGGYGGGAGGYGGSGGYGG 158 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GG GG G G GG G Sbjct: 132 GGGGGYGGSGGYGGGAGGYGGSGGYGGG 159 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG G GGG GG GG GG G Sbjct: 159 GAGGYGGNSGGGYGGNAAGGYGGSGAGG 186 Score = 33.1 bits (72), Expect = 0.27 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRT 851 GG G GG GG GG G G G G G + Sbjct: 138 GGSGGYGGGAGGYGGSGGYGGGAGGYGGNS 167 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = -2 Query: 940 GGGGXXGGXGGGXG-GGXGGGXGGGXXPG 857 G GG GG GG G GG GG GG G Sbjct: 142 GYGGGAGGYGGSGGYGGGAGGYGGNSGGG 170 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXG-GGXGGGXXPG 857 GG G GG GG GG G GG GG G Sbjct: 145 GGAGGYGGSGGYGGGAGGYGGNSGGGYGG 173 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG G GG GG GG GG Sbjct: 168 GGGYGGNAAGGYGGSGAGGYGG 189 >At5g19090.2 68418.m02270 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 465 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/36 (52%), Positives = 19/36 (52%), Gaps = 9/36 (25%) Frame = -2 Query: 940 GGGGXXGGX---------GGGXGGGXGGGXGGGXXP 860 GGGG GG GGG GGG GGG GGG P Sbjct: 105 GGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGGP 140 Score = 31.9 bits (69), Expect = 0.63 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 3/31 (9%) Frame = -2 Query: 940 GGGGXXGGXGG---GXGGGXGGGXGGGXXPG 857 GGGG G G GGG GGG GGG G Sbjct: 109 GGGGPANNNKGQKIGGGGGGGGGGGGGGGGG 139 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 36.3 bits (80), Expect = 0.029 Identities = 17/32 (53%), Positives = 17/32 (53%), Gaps = 4/32 (12%) Frame = +3 Query: 858 PGXXPPPXPPPX--PPPX--PPPXPPXXPPPP 941 PG P PPP PP PPP PP PPPP Sbjct: 13 PGNYPQGPPPPVGVPPQYYPPPPPPPPPPPPP 44 Score = 32.7 bits (71), Expect = 0.36 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXP 908 V P PPP PPP PPP P Sbjct: 26 VPPQYYPPPPPPPPPPPPP 44 Score = 31.5 bits (68), Expect = 0.84 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPP 911 +P PP PPP PPP PP Sbjct: 26 VPPQYYPPPPPPPPPPPPP 44 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 7/35 (20%) Frame = +3 Query: 858 PGXXPPPXPPPXPPP-------XPPPXPPXXPPPP 941 P P P PPP PPP PP PPPP Sbjct: 9 PYPAPGNYPQGPPPPVGVPPQYYPPPPPPPPPPPP 43 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 36.3 bits (80), Expect = 0.029 Identities = 20/63 (31%), Positives = 23/63 (36%), Gaps = 2/63 (3%) Frame = +3 Query: 759 NPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXP--PPXPPPXPPXXP 932 +PP P + P +S S PPP P P P PPP P P Sbjct: 98 SPPPPTPKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPPAPKKSPSTPSLPPPTPKKSP 157 Query: 933 PPP 941 PPP Sbjct: 158 PPP 160 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 1/48 (2%) Frame = +1 Query: 796 PPSPPX-PXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP+P P PP PSP P P P P P P T PPP Sbjct: 92 PPAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSP--PPTPSLPPP 137 Score = 31.5 bits (68), Expect = 0.84 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPPPXPPPX--PPPXPPXXPPPP 941 S S +P P PPP P PPP P P PP Sbjct: 76 SPSTPIPSTPSTPSPPPPAPKKSPPPPTPKKSPSPP 111 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/48 (31%), Positives = 16/48 (33%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 P PP P P SP P P PP P + PPH Sbjct: 126 PSPPPTPSLPPPAPKKSPSTPSLPPPTPKKSPPPPPSHHSSSPSNPPH 173 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 36.3 bits (80), Expect = 0.029 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PP PPP PP P PP PPP Sbjct: 464 PTYSPPIKPPPVKPPTPTYSPPVQPPP 490 Score = 36.3 bits (80), Expect = 0.029 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PP PPP PP P PP PPP Sbjct: 514 PTYSPPIKPPPVKPPTPTYSPPIKPPP 540 Score = 35.5 bits (78), Expect = 0.051 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PP PPP PP P PP PPP Sbjct: 330 PTYSPPIKPPPVKPPTPIYSPPVKPPP 356 Score = 33.1 bits (72), Expect = 0.27 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPPPXP-PPXPPPXPPXXPPP 938 P PP PPP PP P PP PPP Sbjct: 144 PSYSPPVKPPPVQMPPTPTYSPPIKPPP 171 Score = 33.1 bits (72), Expect = 0.27 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PP P PP PP PP Sbjct: 468 PPIKPPPVKPPTPTYSPPVQPPPVQKPP 495 Score = 32.3 bits (70), Expect = 0.48 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPPP-XPPPXPPPXPPXXPPP 938 P PP PPP PP P PP PPP Sbjct: 480 PTYSPPVQPPPVQKPPTPTYSPPVKPPP 507 Score = 32.3 bits (70), Expect = 0.48 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPPP-XPPPXPPPXPPXXPPP 938 P PP PPP PP P PP PPP Sbjct: 497 PTYSPPVKPPPIQKPPTPTYSPPIKPPP 524 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PP P PP PP PP Sbjct: 518 PPIKPPPVKPPTPTYSPPIKPPPVHKPP 545 Score = 32.3 bits (70), Expect = 0.48 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPPPXP-PPXPPPXPPXXPPP 938 P PP PPP PP P PP PPP Sbjct: 666 PTYSPPVKPPPVQLPPTPTYSPPVKPPP 693 Score = 32.3 bits (70), Expect = 0.48 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPPPXP-PPXPPPXPPXXPPP 938 P PP PPP PP P PP PPP Sbjct: 683 PTYSPPVKPPPVQVPPTPTYSPPVKPPP 710 Score = 32.3 bits (70), Expect = 0.48 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPPPXP-PPXPPPXPPXXPPP 938 P PP PPP PP P PP PPP Sbjct: 700 PTYSPPVKPPPVQVPPTPTYSPPIKPPP 727 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPPP-XPPPXPPPXPPXXPPP 938 P PP PPP PP P PP PPP Sbjct: 76 PTYSPPIYPPPIQKPPTPTYSPPIYPPP 103 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPPP-XPPPXPPPXPPXXPPP 938 P PP PPP PP P PP PPP Sbjct: 93 PTYSPPIYPPPIQKPPTPTYSPPIYPPP 120 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPPP-XPPPXPPPXPPXXPPP 938 P PP PPP PP P PP PPP Sbjct: 110 PTYSPPIYPPPIQKPPTPTYSPPIYPPP 137 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPPP-XPPPXPPPXPPXXPPP 938 P PP PPP PP P PP PPP Sbjct: 127 PTYSPPIYPPPIQKPPTPSYSPPVKPPP 154 Score = 31.9 bits (69), Expect = 0.63 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PP PP PP P PP PPP Sbjct: 178 PTYSPPIKPPVHKPPTPIYSPPIKPPP 204 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPPP-XPPPXPPPXPPXXPPP 938 P PP PPP PP P PP PPP Sbjct: 313 PTYSPPIKPPPVQKPPTPTYSPPIKPPP 340 Score = 31.9 bits (69), Expect = 0.63 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PP P PP PP PP Sbjct: 334 PPIKPPPVKPPTPIYSPPVKPPPVHKPP 361 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPPP-XPPPXPPPXPPXXPPP 938 P PP PPP PP P PP PPP Sbjct: 530 PTYSPPIKPPPVHKPPTPTYSPPIKPPP 557 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPPP-XPPPXPPPXPPXXPPP 938 P PP PPP PP P PP PPP Sbjct: 547 PTYSPPIKPPPIHKPPTPTYSPPIKPPP 574 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPPP-XPPPXPPPXPPXXPPP 938 P PP PPP PP P PP PPP Sbjct: 564 PTYSPPIKPPPVHKPPTPTYSPPIKPPP 591 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPPP-XPPPXPPPXPPXXPPP 938 P PP PPP PP P PP PPP Sbjct: 581 PTYSPPIKPPPVHKPPTPTYSPPIKPPP 608 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPPP-XPPPXPPPXPPXXPPP 938 P PP PPP PP P PP PPP Sbjct: 598 PTYSPPIKPPPVHKPPTPTYSPPIKPPP 625 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPPP-XPPPXPPPXPPXXPPP 938 P PP PPP PP P PP PPP Sbjct: 615 PTYSPPIKPPPVHKPPTPTYSPPIKPPP 642 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPPP-XPPPXPPPXPPXXPPP 938 P PP PPP PP P PP PPP Sbjct: 632 PTYSPPIKPPPVHKPPTPTYSPPIKPPP 659 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPPP-XPPPXPPPXPPXXPPP 938 P PP PPP PP P PP PPP Sbjct: 649 PTYSPPIKPPPVQKPPTPTYSPPVKPPP 676 Score = 31.5 bits (68), Expect = 0.84 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPPP-XPPPXPPPXPPXXPPP 938 P PP PPP PP P PP PPP Sbjct: 228 PTYSPPVKPPPVHKPPTPIYSPPIKPPP 255 Score = 31.5 bits (68), Expect = 0.84 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPPP-XPPPXPPPXPPXXPPP 938 P PP PPP PP P PP PPP Sbjct: 380 PIYSPPVKPPPIQKPPTPTYSPPIKPPP 407 Score = 31.5 bits (68), Expect = 0.84 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PP PP PP P PP PPP Sbjct: 414 PTYSPPIKLPPVKPPTPIYSPPVKPPP 440 Score = 31.5 bits (68), Expect = 0.84 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPPP-XPPPXPPPXPPXXPPP 938 P PP PPP PP P PP PPP Sbjct: 447 PIYSPPVKPPPVHKPPTPTYSPPIKPPP 474 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPPP-XPPPXPPPXPPXXPPP 938 P PP PPP PP P PP PPP Sbjct: 211 PIYSPPIKPPPVHKPPTPTYSPPVKPPP 238 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPPP-XPPPXPPPXPPXXPPP 938 P PP PPP PP P PP PPP Sbjct: 262 PIYSPPVKPPPVQTPPTPIYSPPVKPPP 289 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPPP-XPPPXPPPXPPXXPPP 938 P PP PPP PP P PP PPP Sbjct: 346 PIYSPPVKPPPVHKPPTPIYSPPVKPPP 373 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPPP-XPPPXPPPXPPXXPPP 938 P PP PPP PP P PP PPP Sbjct: 363 PIYSPPVKPPPVHKPPTPIYSPPVKPPP 390 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPPP-XPPPXPPPXPPXXPPP 938 P PP PPP PP P PP PPP Sbjct: 430 PIYSPPVKPPPVHKPPTPIYSPPVKPPP 457 Score = 30.7 bits (66), Expect = 1.5 Identities = 25/101 (24%), Positives = 29/101 (28%), Gaps = 4/101 (3%) Frame = +1 Query: 649 PPXP-FXAPXTPAXTLNPHTXXXXXXXXXXXXXXXXXXXXXXPXSXFXWXPPSP---PXP 816 PP P + P P P T P PP+P P Sbjct: 477 PPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPI 536 Query: 817 XPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 PP P+P +S P P PP P PP H Sbjct: 537 KPPPVHKPPTPTYSPPIKPPPI-HKPPTPTYSPPIKPPPVH 576 Score = 30.3 bits (65), Expect = 1.9 Identities = 25/101 (24%), Positives = 29/101 (28%), Gaps = 4/101 (3%) Frame = +1 Query: 649 PPXP-FXAPXTPAXTLNPHTXXXXXXXXXXXXXXXXXXXXXXPXSXFXWXPPSP---PXP 816 PP P + P P P T P PP+P P Sbjct: 141 PPTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPI 200 Query: 817 XPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 PP P+P +S P P PP P PP H Sbjct: 201 KPPPVHKPPTPIYSPPIKPPPV-HKPPTPTYSPPVKPPPVH 240 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPPP-XPPPXPPPXPPXXPPP 938 P PP PPP PP P PP PPP Sbjct: 194 PIYSPPIKPPPVHKPPTPIYSPPIKPPP 221 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPPP-XPPPXPPPXPPXXPPP 938 P PP PPP PP P PP PPP Sbjct: 245 PIYSPPIKPPPVHKPPTPIYSPPVKPPP 272 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/51 (33%), Positives = 20/51 (39%), Gaps = 3/51 (5%) Frame = +1 Query: 796 PPSP---PXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 PP+P P PP P+P +S P P PP P PP H Sbjct: 124 PPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPV-QMPPTPTYSPPIKPPPVH 173 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/51 (33%), Positives = 20/51 (39%), Gaps = 3/51 (5%) Frame = +1 Query: 796 PPSP---PXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 PP+P P PP P+P +S P P PP P PP H Sbjct: 208 PPTPIYSPPIKPPPVHKPPTPTYSPPVKPPPV-HKPPTPIYSPPIKPPPVH 257 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/51 (33%), Positives = 20/51 (39%), Gaps = 3/51 (5%) Frame = +1 Query: 796 PPSP---PXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 PP+P P PP P+P +S P P PP P PP H Sbjct: 242 PPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPV-QTPPTPIYSPPVKPPPVH 291 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/51 (33%), Positives = 20/51 (39%), Gaps = 3/51 (5%) Frame = +1 Query: 796 PPSP---PXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 PP+P P PP P+P +S P P PP P PP H Sbjct: 544 PPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPV-HKPPTPTYSPPIKPPPVH 593 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/51 (33%), Positives = 20/51 (39%), Gaps = 3/51 (5%) Frame = +1 Query: 796 PPSP---PXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 PP+P P PP P+P +S P P PP P PP H Sbjct: 561 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPV-HKPPTPTYSPPIKPPPVH 610 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/51 (33%), Positives = 20/51 (39%), Gaps = 3/51 (5%) Frame = +1 Query: 796 PPSP---PXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 PP+P P PP P+P +S P P PP P PP H Sbjct: 578 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPV-HKPPTPTYSPPIKPPPVH 627 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/51 (33%), Positives = 20/51 (39%), Gaps = 3/51 (5%) Frame = +1 Query: 796 PPSP---PXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 PP+P P PP P+P +S P P PP P PP H Sbjct: 595 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPV-HKPPTPTYSPPIKPPPVH 644 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 1/27 (3%) Frame = +3 Query: 858 PGXXPPPXPPP-XPPPXPPPXPPXXPP 935 P PP PPP PP P PP PP Sbjct: 161 PTYSPPIKPPPVHKPPTPTYSPPIKPP 187 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPP--XPPXXPPPP 941 P PPP P P PP PP PP P Sbjct: 317 PPIKPPPVQKPPTPTYSPPIKPPPVKPPTP 346 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPP--XPPXXPPPP 941 P PPP P P PP PP PP P Sbjct: 401 PPIKPPPLQKPPTPTYSPPIKLPPVKPPTP 430 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PP PP P PP PP PP Sbjct: 452 PVKPPPVHKPPTPTYSPPIKPPPVKPP 478 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PP P PP PP PP Sbjct: 485 PVQPPPVQKPPTPTYSPPVKPPPIQKPP 512 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPP--XPPXXPPPP 941 P PPP P P PP PP PP P Sbjct: 501 PPVKPPPIQKPPTPTYSPPIKPPPVKPPTP 530 Score = 29.1 bits (62), Expect = 4.5 Identities = 17/52 (32%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +1 Query: 796 PPSP---PXPXPPXXXXXPSPXFSLXXXPXP--XPXXPPXPXXPXTXXXPPP 936 PP+P P PP P+P +S P P P P P P PP Sbjct: 697 PPTPTYSPPVKPPPVQVPPTPTYSPPIKPPPVQVPPTPTTPSPPQGGYGTPP 748 Score = 28.7 bits (61), Expect = 5.9 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PP PP P PP PP PP Sbjct: 166 PIKPPPVHKPPTPTYSPPIKPPVHKPP 192 Score = 28.7 bits (61), Expect = 5.9 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PP P PP PP PP Sbjct: 301 PVKSPPVQKPPTPTYSPPIKPPPVQKPP 328 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPP--XPPXXPPPP 941 P PPP P P PP PP PP P Sbjct: 451 PPVKPPPVHKPPTPTYSPPIKPPPVKPPTP 480 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PP PPP P P PP PPP Sbjct: 61 PIYSPPIYPPPIQKP-PTYSPPIYPPP 86 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPPPX-PPPXPPPXPPPXPPXXPPPP 941 P PPP PP P PP PP PP Sbjct: 80 PPIYPPPIQKPPTPTYSPPIYPPPIQKPP 108 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPPPX-PPPXPPPXPPPXPPXXPPPP 941 P PPP PP P PP PP PP Sbjct: 97 PPIYPPPIQKPPTPTYSPPIYPPPIQKPP 125 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPPPX-PPPXPPPXPPPXPPXXPPPP 941 P PPP PP P PP PP PP Sbjct: 114 PPIYPPPIQKPPTPTYSPPIYPPPIQKPP 142 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPPPX-PPPXPPPXPPPXPPXXPPPP 941 P PPP PP P PP PP PP Sbjct: 131 PPIYPPPIQKPPTPSYSPPVKPPPVQMPP 159 Score = 28.3 bits (60), Expect = 7.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PP P PP PP PP Sbjct: 216 PIKPPPVHKPPTPTYSPPVKPPPVHKPP 243 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPPP-XPPPXPPPXPPXXPPP 938 P PP PPP PP P PP PP Sbjct: 279 PIYSPPVKPPPVHKPPTPTYSPPVKSPP 306 Score = 28.3 bits (60), Expect = 7.8 Identities = 16/50 (32%), Positives = 19/50 (38%), Gaps = 2/50 (4%) Frame = +1 Query: 796 PPSPPXPXP--PXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 PP+P P P P+P +S P P PP P PP H Sbjct: 327 PPTPTYSPPIKPPPVKPPTPIYSPPVKPPPV-HKPPTPIYSPPVKPPPVH 375 Score = 28.3 bits (60), Expect = 7.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PP P PP PP PP Sbjct: 368 PVKPPPVHKPPTPIYSPPVKPPPIQKPP 395 Score = 28.3 bits (60), Expect = 7.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PP P PP PP PP Sbjct: 385 PVKPPPIQKPPTPTYSPPIKPPPLQKPP 412 Score = 28.3 bits (60), Expect = 7.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PP P PP PP PP Sbjct: 637 PIKPPPVHKPPTPTYSPPIKPPPVQKPP 664 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPPPXP-PPXPPPXPPPXPPXXPPPP 941 P PPP PP P PP PP PP Sbjct: 670 PPVKPPPVQLPPTPTYSPPVKPPPVQVPP 698 Score = 28.3 bits (60), Expect = 7.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PP P PP PP PP Sbjct: 688 PVKPPPVQVPPTPTYSPPVKPPPVQVPP 715 >At1g74720.1 68414.m08658 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 1081 Score = 36.3 bits (80), Expect = 0.029 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -2 Query: 919 GXGGGXGGGXGGGXGGGXXPGR 854 G GGG GGG GGG GGG GR Sbjct: 611 GGGGGGGGGPGGGGGGGPYCGR 632 Score = 32.7 bits (71), Expect = 0.36 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -2 Query: 919 GXGGGXGGGXGGGXGGGXXP 860 G GGG GGG G G GGG P Sbjct: 609 GEGGGGGGGGGPGGGGGGGP 628 Score = 32.7 bits (71), Expect = 0.36 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGG 881 G G GG GGG GGG GGG Sbjct: 609 GEGGGGGGGGGPGGGGGGG 627 Score = 31.5 bits (68), Expect = 0.84 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGG 893 GGGG GG GGG GGG Sbjct: 612 GGGGGGGGPGGGGGGG 627 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXG 875 G GG GGG G G GGG G Sbjct: 609 GEGGGGGGGGGPGGGGGGG 627 Score = 28.3 bits (60), Expect = 7.8 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGG 893 GGGG GG GG GGG Sbjct: 611 GGGGGGGGGPGGGGGG 626 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 36.3 bits (80), Expect = 0.029 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = +1 Query: 796 PPSPPX--PXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P PP SP P P PP P P PPP Sbjct: 503 PPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPP 551 Score = 35.9 bits (79), Expect = 0.039 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P +S + PPP P PP PPP PPPP Sbjct: 516 PSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPP 552 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P PP P PP P P P PP P T PPP Sbjct: 535 PPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPPVVNCPPTTQSPPP 580 Score = 33.9 bits (74), Expect = 0.16 Identities = 19/50 (38%), Positives = 21/50 (42%), Gaps = 13/50 (26%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPP---PXPPPXP----------PPXPPXXPPPP 941 P +S + PPP PP P PPP PP PP PPPP Sbjct: 489 PSSKMSPSVKAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPP 538 Score = 32.7 bits (71), Expect = 0.36 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +1 Query: 805 PPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 PP P PP P P S P PP P P PPP+ Sbjct: 501 PPPPPPPEYEPSPPPPSS-EMSPSVRAYPPPPPLSPPPPSPPPPY 544 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 6/34 (17%) Frame = +3 Query: 858 PGXXPPPX------PPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PP PP PPPP Sbjct: 618 PPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPP 651 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPX---PPPXPPPXPPPXPPXXPPPP 941 P PPP PP P P PPP PPP Sbjct: 537 PPSPPPPYIYSSPPPPSPSPPPPYIYSSPPP 567 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +3 Query: 870 PPPXPPPXPPPX---PPPXPPXXPP 935 PPP PP PP PPP P PP Sbjct: 675 PPPPPPVYYPPVTQSPPPSPVYYPP 699 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/55 (25%), Positives = 17/55 (30%) Frame = +1 Query: 772 PXSXFXWXPPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P + + P P PP P P + P P P T PPP Sbjct: 556 PPPPYIYSSPPPVVNCPPTTQSPPPPKYEQTPSPREYYPSPSPPYYQYTSSPPPP 610 Score = 28.7 bits (61), Expect = 5.9 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 6/43 (13%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXP------PPXPPPXPPPXPPXXPPPP 941 P +S PPP PPP PPP PPPP Sbjct: 474 PSSKMSPSFRATPPPPSSKMSPSVKAYPPPPPPPEYEPSPPPP 516 Score = 28.7 bits (61), Expect = 5.9 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 8/32 (25%) Frame = +3 Query: 870 PPPXPPPXPP---PXPPPX---PPX--XPPPP 941 PPP P P PP PPP PP PPPP Sbjct: 550 PPPSPSPPPPYIYSSPPPVVNCPPTTQSPPPP 581 >At1g13020.1 68414.m01510 eukaryotic translation initiation factor, putative (EIF4B5) eukaryotic initiation factor 4B (GI:6739522) {Arabidopsis thaliana}; EST gb|T22808 comes from this gene Length = 549 Score = 36.3 bits (80), Expect = 0.029 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG G GGG G G Sbjct: 187 GGGGSFGGGGGGGAGSYGGGGAGAGSGG 214 Score = 35.1 bits (77), Expect = 0.068 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG G GGG G G G Sbjct: 188 GGGSFGGGGGGGAGSYGGGGAGAGSGGG 215 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G GGG G G GG G G G Sbjct: 186 GGGGGSFGGGGGGGAGSYGGGGAGAGSG 213 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG G GG G G G G GGG Sbjct: 194 GGGGGGAGSYGGGGAGAGSGGGGG 217 Score = 31.5 bits (68), Expect = 0.84 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 2/28 (7%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXG--GGXXPG 857 G GG GG GGG GGG G GG G Sbjct: 182 GSRYGGGGGSFGGGGGGGAGSYGGGGAG 209 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGG 869 G G GG GG GGG GGG Sbjct: 179 GRQGSRYGGGGGSFGGGGGGG 199 >At5g56140.1 68418.m07003 KH domain-containing protein Length = 315 Score = 35.9 bits (79), Expect = 0.039 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG GG GGG GGG GGG GG Sbjct: 8 GGG--GGGGGGSGGGIGGGGGG 27 Score = 35.9 bits (79), Expect = 0.039 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGG 884 GGGG GG GGG GGG GG Sbjct: 9 GGGGGGGGSGGGIGGGGGG 27 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = -2 Query: 919 GXGGGXGGGXGGGXGGG 869 G GGG GGG GGG GGG Sbjct: 8 GGGGGGGGGSGGGIGGG 24 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 922 GGXGGGXGGGXGGGXGGG 869 GG GGG G G G G GGG Sbjct: 9 GGGGGGGGSGGGIGGGGG 26 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 922 GGXGGGXGGGXGGGXGGG 869 GG GGG GG GG GGG Sbjct: 10 GGGGGGGSGGGIGGGGGG 27 Score = 28.3 bits (60), Expect = 7.8 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 913 GGGXGGGXGGGXGGGXXPGR 854 GGG GGG GG GG GR Sbjct: 9 GGGGGGGGSGGGIGGGGGGR 28 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 35.9 bits (79), Expect = 0.039 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPPPXPPP-XPPPXPPXXPPP 938 P PP PP PPP PP PP PPP Sbjct: 70 PPIYSPPPPPIYPPPIYSPPPPPIYPPP 97 Score = 35.5 bits (78), Expect = 0.051 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP PP P P +S P P PP P T PPP Sbjct: 67 PPPPPIYSPPPPPIYPPPIYS---PPPPPIYPPPIYSPPPTPISPPP 110 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP P PPP P PP PPP Sbjct: 63 PVAFPPPPPIYSPPPPPIYPPPIYSPPP 90 Score = 33.1 bits (72), Expect = 0.27 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PPP PP P PPPP Sbjct: 69 PPPIYSPPPPPIYPP-PIYSPPPP 91 Score = 31.9 bits (69), Expect = 0.63 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXP-XPXP--XXPPXPXXPXTXXXPPP 936 PP PP P P P +S P P P PP P P PPP Sbjct: 54 PPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPP 103 Score = 31.5 bits (68), Expect = 0.84 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 5/33 (15%) Frame = +3 Query: 858 PGXXPPPX-PPPXPPPXPPP--XPPXXP--PPP 941 P PPP PP PP PPP PP P PPP Sbjct: 78 PPIYPPPIYSPPPPPIYPPPIYSPPPTPISPPP 110 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/42 (45%), Positives = 20/42 (47%), Gaps = 6/42 (14%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPX---PPPXPPPXP---PPXPPXXPPP 938 P RS + P PPP P PPP P PP PP PPP Sbjct: 46 PYRSPVTIPP---PPPVYSRPVAFPPPPPIYSPPPPPIYPPP 84 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPPPXPP-PXPPPXPPPXPPXXPPPP 941 P PPP P P PPP P PPPP Sbjct: 50 PVTIPPPPPVYSRPVAFPPPPPIYSPPPP 78 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/37 (35%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +1 Query: 790 WXPPSPPXPXPPXXXXXPSPXF-SLXXXPXPXPXXPP 897 + PP PP PP P P + P P P PP Sbjct: 73 YSPPPPPIYPPPIYSPPPPPIYPPPIYSPPPTPISPP 109 >At5g10550.1 68418.m01221 DNA-binding bromodomain-containing protein low similarity to kinase [Gallus gallus] GI:1370092; contains Pfam profile PF00439: Bromodomain Length = 678 Score = 35.9 bits (79), Expect = 0.039 Identities = 17/40 (42%), Positives = 19/40 (47%), Gaps = 6/40 (15%) Frame = +3 Query: 840 SLSXVLPGXXPPPX------PPPXPPPXPPPXPPXXPPPP 941 S+ +LP PPP P P P P PP PP PP P Sbjct: 401 SVKPLLPTLPPPPVIEITRDPSPPPSPVQPPPPPSPPPQP 440 >At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, putative strong similarity to L-galactono-1,4-lactone dehydrogenase, Brassica oleracea, Z97060 [gi:2760543], and gi:3986289 from Ipomea batatas Length = 610 Score = 35.9 bits (79), Expect = 0.039 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPP 911 P R+L PPP PPP PPP PP Sbjct: 31 PHRTLCTTGQTLTPPPPPPPRPPPPPP 57 Score = 33.9 bits (74), Expect = 0.16 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = +3 Query: 882 PPPXPPPXPPPXPP 923 PPP PPP PPP PP Sbjct: 44 PPPPPPPRPPPPPP 57 Score = 31.9 bits (69), Expect = 0.63 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = +3 Query: 894 PPPXPPPXPPXXPPPP 941 PPP PPP PP PPPP Sbjct: 44 PPPPPPPRPP--PPPP 57 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 35.9 bits (79), Expect = 0.039 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 P P PPP P P PP P P PP Sbjct: 160 PTPCPPPTPTPTPPVVTPPTPTPP 183 Score = 34.3 bits (75), Expect = 0.12 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPP 938 P P P PPP P P PP PP Sbjct: 158 PPPTPCPPPTPTPTPPVVTPP 178 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PP PP PP P PP PPP Sbjct: 110 PHPKPPIVKPPTKPPPSTPKPPTKPPP 136 Score = 33.5 bits (73), Expect = 0.21 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP PP PP PP P P PP Sbjct: 46 PPKPPAVKPPKPPAVKPPTPKPP 68 Score = 33.5 bits (73), Expect = 0.21 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PPP P P PP P PP Sbjct: 115 PIVKPPTKPPPSTPKPPTKPPPSTPKPP 142 Score = 33.1 bits (72), Expect = 0.27 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +3 Query: 852 VLPGXXPPPX--PPPXPPPXPPPXPPXXPPPP 941 V P PPP PP PP P PP PPP Sbjct: 117 VKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPP 148 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXPP--PXPPPXPPXXPPP 938 P PPP P P PP P P PP PP Sbjct: 160 PTPCPPPTPTPTPPVVTPPTPTPPVITPP 188 Score = 32.3 bits (70), Expect = 0.48 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPP--PXPPPXPPPXPPPXPPXXPPPP 941 P PP P PP PP P PP PPP Sbjct: 131 PTKPPPSTPKPPTTKPPPSTPKPPHHKPPP 160 Score = 32.3 bits (70), Expect = 0.48 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P PP P P P PPP P PP Sbjct: 148 PSTPKPPHHKPPPTPCPPPTPTPTPP 173 Score = 31.5 bits (68), Expect = 0.84 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +3 Query: 870 PPPXP--PPXPPPXPPPXPPXXPPP 938 PP P PP PP PP PP PP Sbjct: 39 PPKHPVKPPKPPAVKPPKPPAVKPP 63 Score = 31.5 bits (68), Expect = 0.84 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPP 933 P P P PP PS P P P PP P PP Sbjct: 134 PPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPP 178 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PP P P P P P PP PP Sbjct: 94 PPTVKPPHPKPPTKPHPHPKPPIVKPP 120 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PP P PP PP P P Sbjct: 114 PPIVKPPTKPPPSTPKPPTKPPPSTPKP 141 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP P PP PP P PP P Sbjct: 141 PPTTKPPPSTPKPPHHKPPPTPCPPPTP 168 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P P PP P PP P PP P Sbjct: 30 PKPSPAPHKPPKHPVKPPKPPAVKPPKP 57 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 4/31 (12%) Frame = +3 Query: 858 PGXXPP-PXPPPXPPPXPPPX---PPXXPPP 938 P PP P PP P P P P PP PPP Sbjct: 95 PTVKPPHPKPPTKPHPHPKPPIVKPPTKPPP 125 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXP-XTXXXPPP 936 P P P PP P+P P P PP P P T P P Sbjct: 146 PPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTP 192 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = +1 Query: 796 PPSPPXPXPPXXXXX-PSPXFSLXXXPXPXPXXPPXPXXP-XTXXXPPP 936 PP P P PP P+P P P PP P P T P P Sbjct: 164 PPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVITPPTPTP 212 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXP-PPXPPXXPPPP 941 P + P PP PP PP P PP P PP Sbjct: 40 PKHPVKPPKPPAVKPPKPPAVKPPTPKPPTVKPHPKPP 77 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PP PPP P P PP P P Sbjct: 130 PPTKPPPSTPKPPTTKPPPSTPKP 153 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 4/32 (12%) Frame = +3 Query: 858 PGXXPPPXPPPXP----PPXPPPXPPXXPPPP 941 P PPP P P PP P P P P PP Sbjct: 142 PTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPP 173 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPPPXPPPXPP-PXPPPXPPXXPPPP 941 P P P PP P P PP P P PP Sbjct: 77 PTVKPHPKPPTVKPHPKPPTVKPPHPKPP 105 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXP-PPXPPXXPPPP 941 P P P PP PP P PP P P P Sbjct: 86 PTVKPHPKPPTVKPPHPKPPTKPHPHPKP 114 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPP 935 V P PP PP P P P P PP Sbjct: 88 VKPHPKPPTVKPPHPKPPTKPHPHPKPP 115 Score = 29.1 bits (62), Expect = 4.5 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 4/32 (12%) Frame = +3 Query: 858 PGXXPP--PXPPPXPPPXPPPX--PPXXPPPP 941 P PP P P P PP PP PP P PP Sbjct: 100 PHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPP 131 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 3/27 (11%) Frame = +3 Query: 870 PPPXPP-PXPPPXPPPXPPXXP--PPP 941 P P PP PP PPP P P PPP Sbjct: 110 PHPKPPIVKPPTKPPPSTPKPPTKPPP 136 Score = 29.1 bits (62), Expect = 4.5 Identities = 15/48 (31%), Positives = 16/48 (33%), Gaps = 1/48 (2%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXP-XXPXTXXXPPP 936 PP+ P P P P P P P P P P PPP Sbjct: 119 PPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPP 166 Score = 29.1 bits (62), Expect = 4.5 Identities = 16/50 (32%), Positives = 17/50 (34%), Gaps = 3/50 (6%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXP---XXPPXPXXPXTXXXPPP 936 PPS P P P P + P P PP P P T PP Sbjct: 124 PPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPP 173 Score = 29.1 bits (62), Expect = 4.5 Identities = 18/51 (35%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = +1 Query: 796 PP--SPPXPXPPXXXXX-PSPXFSLXXXPXPXPXXPPXPXXP-XTXXXPPP 936 PP +PP P PP P+P P P PP P P T P P Sbjct: 182 PPVITPPTPTPPVVTPPTPTPPVITPPTPTPPVITPPTPTPPVVTPPTPTP 232 Score = 29.1 bits (62), Expect = 4.5 Identities = 18/51 (35%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = +1 Query: 796 PP--SPPXPXPPXXXXX-PSPXFSLXXXPXPXPXXPPXPXXP-XTXXXPPP 936 PP +PP P PP P+P P P PP P P T P P Sbjct: 192 PPVVTPPTPTPPVITPPTPTPPVITPPTPTPPVVTPPTPTPPVVTPPTPTP 242 Score = 28.7 bits (61), Expect = 5.9 Identities = 15/48 (31%), Positives = 15/48 (31%), Gaps = 1/48 (2%) Frame = +1 Query: 796 PPSP-PXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP P P P P P P P PP P P P P Sbjct: 29 PPKPSPAPHKPPKHPVKPPKPPAVKPPKPPAVKPPTPKPPTVKPHPKP 76 Score = 28.7 bits (61), Expect = 5.9 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +1 Query: 805 PPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXP-XTXXXPPP 936 PP P PP P+P P P PP P P T P P Sbjct: 159 PPTPCPPPTPT-PTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTP 202 Score = 28.3 bits (60), Expect = 7.8 Identities = 18/50 (36%), Positives = 21/50 (42%), Gaps = 2/50 (4%) Frame = +1 Query: 796 PPS--PPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 PP+ PP P PP P P ++ P P P P P P PPH Sbjct: 57 PPAVKPPTPKPPTVKPHPKPP-TVKPHPKP-PTVKPHPKPPTV---KPPH 101 Score = 28.3 bits (60), Expect = 7.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 P P PP PP P P P PP P Sbjct: 178 PTPTPPVITPPTPTP-PVVTPPTP 200 Score = 28.3 bits (60), Expect = 7.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 P P PP PP P P P PP P Sbjct: 198 PTPTPPVITPPTPTP-PVITPPTP 220 Score = 28.3 bits (60), Expect = 7.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 P P PP PP P P P PP P Sbjct: 208 PTPTPPVITPPTPTP-PVVTPPTP 230 >At2g39750.1 68415.m04881 dehydration-responsive family protein similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 694 Score = 35.9 bits (79), Expect = 0.039 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXP 920 PPP PPP P P PPP P Sbjct: 107 PPPPPPPSPSPPPPPGP 123 Score = 32.7 bits (71), Expect = 0.36 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXP 932 PPP PPP P P PP P Sbjct: 107 PPPPPPPSPSPPPPPGP 123 Score = 30.3 bits (65), Expect = 1.9 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 894 PPPXPPPXPPXXPPP 938 PPP PPP P PPP Sbjct: 107 PPPPPPPSPSPPPPP 121 Score = 30.3 bits (65), Expect = 1.9 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 897 PPXPPPXPPXXPPPP 941 PP PPP P PPPP Sbjct: 107 PPPPPPPSPSPPPPP 121 Score = 29.1 bits (62), Expect = 4.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXP 908 P PPP P P PPP P Sbjct: 107 PPPPPPPSPSPPPPPGP 123 Score = 29.1 bits (62), Expect = 4.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPP 923 PP PPP P PPP P Sbjct: 107 PPPPPPPSPSPPPPPGP 123 Score = 29.1 bits (62), Expect = 4.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 888 PXPPPXPPPXPPXXPPP 938 P PPP P P PP P P Sbjct: 107 PPPPPPPSPSPPPPPGP 123 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 35.9 bits (79), Expect = 0.039 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPP--XPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PP P P PPPP Sbjct: 67 PANPPPPVSSPPPASPPPATPPPVASPPPP 96 Score = 35.1 bits (77), Expect = 0.068 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPX--PPPXPPPXPPPXPPXXPPPP 941 P PPP PP PPP P PP PPP Sbjct: 73 PVSSPPPASPPPATPPPVASPPPPVASPPP 102 Score = 34.7 bits (76), Expect = 0.090 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPP-PXPPXXPPPP 941 P +S P PP PPP P PP PP PPP Sbjct: 70 PPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPP 107 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPX-PPXXPPPP 941 PPP PP P PPP PP PPP Sbjct: 65 PPPANPPPPVSSPPPASPPPATPPP 89 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 5/33 (15%) Frame = +3 Query: 858 PGXXPPPX--PPPX---PPPXPPPXPPXXPPPP 941 P PPP PPP PPP PP PPPP Sbjct: 41 PAATPPPVSAPPPVTTSPPPVTTAPPPANPPPP 73 Score = 32.3 bits (70), Expect = 0.48 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPP--XPPXXPPPP 941 P PP PP P PPP PP PPP Sbjct: 84 PATPPPVASPPPPVASPPPATPPPVATPPP 113 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P PPP P P PPP Sbjct: 27 PTATPAPPTPTTPPPAATPPPVSAPPP 53 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 6/33 (18%) Frame = +3 Query: 858 PGXXPPPX---PPPX---PPPXPPPXPPXXPPP 938 P PPP PPP PPP PP P PPP Sbjct: 47 PVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPP 79 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP P PPP PP PP P Sbjct: 88 PPVASPPPPVASPPPATPPPVATPPPAP 115 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/47 (29%), Positives = 15/47 (31%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P +PP P P P P P P P P PPP Sbjct: 67 PANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPP 113 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 2/26 (7%) Frame = +3 Query: 870 PPPXPPPX--PPPXPPPXPPXXPPPP 941 PP PPP PPP P PP P P Sbjct: 101 PPATPPPVATPPPAPLASPPAQVPAP 126 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPP--XPPPXPPPXPPXXPPPP 941 P P PPP PPP P P PPP Sbjct: 31 PAPPTPTTPPPAATPPPVSAPPPVTTSPPP 60 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P PPP PP P PPP P PP Sbjct: 96 PVASPPPATPP-PVATPPPAPLASPP 120 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P P PP P P P P PP P PPP Sbjct: 51 PPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPP 96 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPP---XPPXXPPPP 941 P P P P P PPP PP PPP Sbjct: 23 PTSPPTATPAPPTPTTPPPAATPPPVSAPPP 53 Score = 28.3 bits (60), Expect = 7.8 Identities = 16/62 (25%), Positives = 18/62 (29%) Frame = +3 Query: 753 PXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXP 932 P NPP P P ++ P PP PP P PP P Sbjct: 67 PANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAP 126 Query: 933 PP 938 P Sbjct: 127 AP 128 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 35.9 bits (79), Expect = 0.039 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPP--XPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PP P P PPPP Sbjct: 67 PANPPPPVSSPPPASPPPATPPPVASPPPP 96 Score = 35.1 bits (77), Expect = 0.068 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPX--PPPXPPPXPPPXPPXXPPPP 941 P PPP PP PPP P PP PPP Sbjct: 73 PVSSPPPASPPPATPPPVASPPPPVASPPP 102 Score = 34.7 bits (76), Expect = 0.090 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPP-PXPPXXPPPP 941 P +S P PP PPP P PP PP PPP Sbjct: 70 PPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPP 107 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPX-PPXXPPPP 941 PPP PP P PPP PP PPP Sbjct: 65 PPPANPPPPVSSPPPASPPPATPPP 89 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 5/33 (15%) Frame = +3 Query: 858 PGXXPPPX--PPPX---PPPXPPPXPPXXPPPP 941 P PPP PPP PPP PP PPPP Sbjct: 41 PAATPPPVSAPPPVTTSPPPVTTAPPPANPPPP 73 Score = 32.3 bits (70), Expect = 0.48 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPP--XPPXXPPPP 941 P PP PP P PPP PP PPP Sbjct: 84 PATPPPVASPPPPVASPPPATPPPVATPPP 113 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P PPP P P PPP Sbjct: 27 PTATPAPPTPTTPPPAATPPPVSAPPP 53 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 6/33 (18%) Frame = +3 Query: 858 PGXXPPPX---PPPX---PPPXPPPXPPXXPPP 938 P PPP PPP PPP PP P PPP Sbjct: 47 PVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPP 79 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP P PPP PP PP P Sbjct: 88 PPVASPPPPVASPPPATPPPVATPPPAP 115 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/47 (29%), Positives = 15/47 (31%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P +PP P P P P P P P P PPP Sbjct: 67 PANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPP 113 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 2/26 (7%) Frame = +3 Query: 870 PPPXPPPX--PPPXPPPXPPXXPPPP 941 PP PPP PPP P PP P P Sbjct: 101 PPATPPPVATPPPAPLASPPAQVPAP 126 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPP--XPPPXPPPXPPXXPPPP 941 P P PPP PPP P P PPP Sbjct: 31 PAPPTPTTPPPAATPPPVSAPPPVTTSPPP 60 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P PPP PP P PPP P PP Sbjct: 96 PVASPPPATPP-PVATPPPAPLASPP 120 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P P PP P P P P PP P PPP Sbjct: 51 PPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPP 96 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPP---XPPXXPPPP 941 P P P P P PPP PP PPP Sbjct: 23 PTSPPTATPAPPTPTTPPPAATPPPVSAPPP 53 Score = 28.3 bits (60), Expect = 7.8 Identities = 16/62 (25%), Positives = 18/62 (29%) Frame = +3 Query: 753 PXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXP 932 P NPP P P ++ P PP PP P PP P Sbjct: 67 PANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAP 126 Query: 933 PP 938 P Sbjct: 127 AP 128 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 35.9 bits (79), Expect = 0.039 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 S V P PPP PPP P PP PPP Sbjct: 233 SFEFVKPDPTPPPPPPPPIPVKQSATPPPPPPP 265 Score = 35.1 bits (77), Expect = 0.068 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 P P PPP PPP P PPPP Sbjct: 239 PDPTPPPPPPPPIPVKQSATPPPP 262 Score = 33.1 bits (72), Expect = 0.27 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP P PPPP Sbjct: 241 PTPPPPPPPPIPVKQSATPPPPP 263 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXPPPP 941 PPP PPP P PPPP Sbjct: 259 PPPPPPPKLKNNGPSPPPPP 278 Score = 28.7 bits (61), Expect = 5.9 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 3/21 (14%) Frame = +3 Query: 870 PPPXPPP---XPPPXPPPXPP 923 PPP PPP P PPP PP Sbjct: 259 PPPPPPPKLKNNGPSPPPPPP 279 >At1g07135.1 68414.m00759 glycine-rich protein Length = 155 Score = 35.9 bits (79), Expect = 0.039 Identities = 18/39 (46%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -2 Query: 940 GGGGXXGGXGGG--XGGGXGGGXGGGXXPGRTXERXRXG 830 GGGG GG GGG GG G GGG R+ + R G Sbjct: 65 GGGGGGGGRGGGGARSGGRSRGGGGGSSSSRSRDWKRGG 103 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG RGGGG Sbjct: 66 GGGGGGGRGGGGARSGGRSRGGGG 89 >At5g51300.2 68418.m06360 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 35.5 bits (78), Expect = 0.051 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 3/37 (8%) Frame = +3 Query: 837 RSLSXVLPGXXPPPXPPPXPPPXPPP---XPPXXPPP 938 R+L+ + G PPP PP PP PP PP PP Sbjct: 549 RTLAVRIAGKSPPPIAPPGPPAPQPPTQGYPPSNQPP 585 >At5g51300.1 68418.m06359 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 35.5 bits (78), Expect = 0.051 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 3/37 (8%) Frame = +3 Query: 837 RSLSXVLPGXXPPPXPPPXPPPXPPP---XPPXXPPP 938 R+L+ + G PPP PP PP PP PP PP Sbjct: 549 RTLAVRIAGKSPPPIAPPGPPAPQPPTQGYPPSNQPP 585 >At5g07510.1 68418.m00860 glycine-rich protein (GRP14) oleosin; glycine-rich protein 14 (GRP14) PMID:11431566; PIR:JQ1063 Length = 193 Score = 35.5 bits (78), Expect = 0.051 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGGG GG GG GGG GG GG Sbjct: 119 GGGGLPGGLGGLGGGGLPGGLGG 141 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGGG P GGGG Sbjct: 111 GKPGGGGLGGGGLPGGLGGLGGGG 134 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGG GG GG GG GGG GG Sbjct: 115 GGGLGGGGLPGGLGGLGGGGLPGG 138 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 5/31 (16%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXG-----GGXGGGXXPG 857 GG G GGG GG G GG GGG PG Sbjct: 107 GGRFGKPGGGGLGGGGLPGGLGGLGGGGLPG 137 Score = 29.1 bits (62), Expect = 4.5 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG G G GGG GGG PG Sbjct: 101 GGGRRFGGRFGKPG---GGGLGGGGLPG 125 >At5g02600.2 68418.m00195 heavy-metal-associated domain-containing protein low similarity to gi:3168840 copper homeostasis factor; contains Pfam heavy-metal-associated domain PF00403; predicted proteins, Arabidopsis thaliana Length = 319 Score = 35.5 bits (78), Expect = 0.051 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPP 923 PPP PPP PP PP PP Sbjct: 225 PPPPPPPSPPQSSPPSPP 242 Score = 32.3 bits (70), Expect = 0.48 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXPP 935 PPP PPP PP P PP Sbjct: 225 PPPPPPPSPPQSSPPSPP 242 Score = 31.5 bits (68), Expect = 0.84 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P SLS + P PPP PPP PP PP Sbjct: 204 PTASLSSLEDKDVSSPDFKFSPPPPPPPSPPQSSPP 239 Score = 28.7 bits (61), Expect = 5.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPP 911 P PPP PP PP PP Sbjct: 225 PPPPPPPSPPQSSPPSPP 242 >At5g02600.1 68418.m00196 heavy-metal-associated domain-containing protein low similarity to gi:3168840 copper homeostasis factor; contains Pfam heavy-metal-associated domain PF00403; predicted proteins, Arabidopsis thaliana Length = 319 Score = 35.5 bits (78), Expect = 0.051 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPP 923 PPP PPP PP PP PP Sbjct: 225 PPPPPPPSPPQSSPPSPP 242 Score = 32.3 bits (70), Expect = 0.48 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXPP 935 PPP PPP PP P PP Sbjct: 225 PPPPPPPSPPQSSPPSPP 242 Score = 31.5 bits (68), Expect = 0.84 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P SLS + P PPP PPP PP PP Sbjct: 204 PTASLSSLEDKDVSSPDFKFSPPPPPPPSPPQSSPP 239 Score = 28.7 bits (61), Expect = 5.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPP 911 P PPP PP PP PP Sbjct: 225 PPPPPPPSPPQSSPPSPP 242 >At4g21720.1 68417.m03145 expressed protein Length = 139 Score = 35.5 bits (78), Expect = 0.051 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 ++ V P PPP P P PPP PP PP Sbjct: 99 VNKVKPKRPPPPPPKPQPPPPPPRSQKPMQPP 130 Score = 32.7 bits (71), Expect = 0.36 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PP PP PPP PP Sbjct: 107 PPPPPPKPQPPPPPPRSQKPMQPP 130 Score = 31.9 bits (69), Expect = 0.63 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 888 PXPPPXPPPXPPXXPPPP 941 P PP PPP P PPPP Sbjct: 104 PKRPPPPPPKPQPPPPPP 121 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/67 (28%), Positives = 21/67 (31%) Frame = +3 Query: 741 GGSXPXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPPXP 920 GGS P +P P P + PG P P P P P P Sbjct: 504 GGSPPSSPTTPSPGGSPPSPSISPSPPITVPSPPSTPTSPGSPPSPSSPTPSSPIPSPPT 563 Query: 921 PXXPPPP 941 P PP P Sbjct: 564 PSTPPTP 570 Score = 32.3 bits (70), Expect = 0.48 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXP-PPXPPXXPPPP 941 P ++ ++P PP P PP P PP PP P PP Sbjct: 573 PGQNSPPIIPS---PPFTGPSPPSSPSPPLPPVIPSPP 607 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P S + PG PP P P PP P P PP Sbjct: 494 PPSSPTTPTPGGSPPSSPTTPSPGGSPPSPSISPSPP 530 Score = 31.5 bits (68), Expect = 0.84 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P PPP P PPP Sbjct: 758 PPPPPTVHYNPPPPPSPAHYSPPP 781 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P PPP P PPP Sbjct: 703 PPPAPYYYSSPQPPPPPHYSLPPP 726 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Frame = +3 Query: 870 PPPXPPP-XPPPXPPPXPPXXPPPP 941 PPP P PPP PP PPPP Sbjct: 770 PPPSPAHYSPPPSPPVYYYNSPPPP 794 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P S + PG PP P P PP P P P Sbjct: 468 PPTSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPTP 503 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P S + PG PP P P PP P P P Sbjct: 481 PPSSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPSP 516 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 4/28 (14%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPP----XXPPPP 941 PPP P P P P PP PPPP Sbjct: 735 PPPPPTPIHSPPPQSHPPCIEYSPPPPP 762 Score = 28.7 bits (61), Expect = 5.9 Identities = 18/59 (30%), Positives = 20/59 (33%), Gaps = 4/59 (6%) Frame = +1 Query: 772 PXSXFXWXPPSPPXPXPPXXXXXPSPXFSLXXXPXPXP----XXPPXPXXPXTXXXPPP 936 P + PP P P P PSP P P P PP P + PPP Sbjct: 760 PPPTVHYNPP--PPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPPP 816 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%) Frame = +3 Query: 870 PPPXPPPX---PPPXPPPXPPXXPPPP 941 PPP PP PP PP PPPP Sbjct: 779 PPPSPPVYYYNSPPPPPAVHYSPPPPP 805 Score = 28.3 bits (60), Expect = 7.8 Identities = 19/69 (27%), Positives = 20/69 (28%), Gaps = 2/69 (2%) Frame = +3 Query: 741 GGSXPXNPPXPXQRFXXXXXXXXXXXXXXXPXRSLSXVLPGXXPPPXPPPXPPPXPPP-- 914 GGS P P P S+ P P P PP P P P Sbjct: 420 GGSPPSPSISPSPPITVPSPPTTPSPGGSPPSPSIVPSPPSTTPSPGSPPTSPTTPTPGG 479 Query: 915 XPPXXPPPP 941 PP P P Sbjct: 480 SPPSSPTTP 488 >At2g28490.1 68415.m03462 cupin family protein similar to preproMP27-MP32 [Cucurbita cv. Kurokawa Amakuri] GI:691752, allergen Gly m Bd 28K [Glycine max] GI:12697782, vicilin [Matteuccia struthiopteris] GI:1019792; contains Pfam profile PF00190: Cupin Length = 511 Score = 35.5 bits (78), Expect = 0.051 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG G G G GGG GGG Sbjct: 56 GGGGAWGGEGEGGGEWGGGGEGGG 79 Score = 34.7 bits (76), Expect = 0.090 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG GGG G G G GGG G Sbjct: 47 GGGAWGGGGGGGGAWGGEGEGGGEWGG 73 Score = 34.7 bits (76), Expect = 0.090 Identities = 17/30 (56%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -2 Query: 940 GGGGXXGGXGG-GXGGGXGGGXGGGXXPGR 854 GGGG G GG G GGG GG G G GR Sbjct: 53 GGGGGGGAWGGEGEGGGEWGGGGEGGGGGR 82 Score = 33.5 bits (73), Expect = 0.21 Identities = 20/49 (40%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -1 Query: 938 WGG-GXXXVXGXXGXGGXXGXGXGXXSRENXGEGXXXXXGGXGXGGEGG 795 WGG G G G G G G G + GEG GG G GG GG Sbjct: 34 WGGAGGGEWGGAEGGGAWGGGGGGGGAWGGEGEG-GGEWGGGGEGGGGG 81 Score = 33.1 bits (72), Expect = 0.27 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GG G G G GGG G Sbjct: 52 GGGGGGGGAWGGEGEGGGEWGGGGEGGG 79 Score = 32.3 bits (70), Expect = 0.48 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG--GGXXPG 857 GGG G GGG GG GGG G GG G Sbjct: 38 GGGEWGGAEGGGAWGGGGGGGGAWGGEGEG 67 Score = 31.5 bits (68), Expect = 0.84 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 GG G GG GGG GG GGG Sbjct: 35 GGAGGGEWGGAEGGGAWGGGGGG 57 Score = 31.5 bits (68), Expect = 0.84 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 3/31 (9%) Frame = -2 Query: 940 GGGGXXGGXGGG---XGGGXGGGXGGGXXPG 857 GGG GG GGG G G GGG GG G Sbjct: 47 GGGAWGGGGGGGGAWGGEGEGGGEWGGGGEG 77 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 35.5 bits (78), Expect = 0.051 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPP--XXPPPP 941 P PPP P PP P P PP PPPP Sbjct: 154 PESLPPPSPESPSPPSPEPPPPSSLEPPPP 183 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/33 (48%), Positives = 17/33 (51%), Gaps = 4/33 (12%) Frame = +3 Query: 855 LPGXXPPPXPPP---XPPPXP-PPXPPXXPPPP 941 + G PPP PP PPP P P PP PPP Sbjct: 142 IAGQPPPPESPPPESLPPPSPESPSPPSPEPPP 174 Score = 33.5 bits (73), Expect = 0.21 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP P P P P P PPPP Sbjct: 148 PPESPPPESLPPPSPESPSPPSPEPPPP 175 Score = 31.5 bits (68), Expect = 0.84 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPP--XPPPXPP 923 P SL P PP P P PP PPP PP Sbjct: 153 PPESLPPPSPESPSPPSPEPPPPSSLEPPPPPP 185 >At1g04930.1 68414.m00490 hydroxyproline-rich glycoprotein family protein Common family member: At2g32840 [Arabidopsis thaliana] Length = 332 Score = 35.5 bits (78), Expect = 0.051 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP PPP P P P P Sbjct: 35 PPSQPPPAPPPLPPPTYRPIAPLRHPNP 62 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 SLS P PP PPP PP PPP Sbjct: 17 SLSTASETPVTPVNTVRPPPSQPPPAPPPLPPP 49 >At5g65630.1 68418.m08256 DNA-binding bromodomain-containing protein similar to 5.9 kb fsh membrane protein [Drosophila melanogaster] GI:157455; contains Pfam profile PF00439: Bromodomain Length = 590 Score = 35.1 bits (77), Expect = 0.068 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 V P P PPP PP P P PPPP Sbjct: 339 VEPSRVQSPSPPPPPPVIQPELPQPQPPPP 368 >At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 35.1 bits (77), Expect = 0.068 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = -2 Query: 940 GGG--GXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GGG G GG GGG G G GG GGG G R G Sbjct: 43 GGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGG 81 Score = 32.3 bits (70), Expect = 0.48 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXP 860 GGGG GG GG G G GG G P Sbjct: 65 GGGGYQGGDRGGRGSGGGGRDGDWRCP 91 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG G G GGG GGG Sbjct: 9 GGGGAPIPSYGGDGYGGGGGYGGG 32 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGR 854 G G G GGG GG GG GGG R Sbjct: 35 GYGGRGASGGGSYGGRGGYGGGGGRGNR 62 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = -2 Query: 937 GGGXXGGXGGGXGG-GXGGGXGGGXXPGR 854 G G GG GGG G G G GGG GR Sbjct: 22 GYGGGGGYGGGDAGYGGRGASGGGSYGGR 50 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = -2 Query: 940 GGGGXXGGXGG-GXGGGXGGGXGGG 869 GGGG GG G G G GGG GG Sbjct: 25 GGGGYGGGDAGYGGRGASGGGSYGG 49 Score = 29.1 bits (62), Expect = 4.5 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGX---GGGXGGGXXPGRTXERXR 836 G GG G GGG GGG GG GR+ E R Sbjct: 120 GANDRGGGGYSRGGGDSDRGGGRGGRNDSGRSYESSR 156 Score = 28.7 bits (61), Expect = 5.9 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXG 887 GG GG GGG GGG G Sbjct: 383 GGGRGGGGGGYGGGGG 398 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GGG GGG G G G G Sbjct: 19 GGDGYGGGGGYGGGDAGYGGRGASGG 44 Score = 28.3 bits (60), Expect = 7.8 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 922 GGXGGGXGGGXGGGXG 875 GG GG GGG GGG G Sbjct: 383 GGGRGGGGGGYGGGGG 398 Score = 28.3 bits (60), Expect = 7.8 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 913 GGGXGGGXGGGXGGG 869 GGG GGG GG GGG Sbjct: 383 GGGRGGGGGGYGGGG 397 >At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 35.1 bits (77), Expect = 0.068 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = -2 Query: 940 GGG--GXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GGG G GG GGG G G GG GGG G R G Sbjct: 43 GGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGG 81 Score = 32.3 bits (70), Expect = 0.48 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXP 860 GGGG GG GG G G GG G P Sbjct: 65 GGGGYQGGDRGGRGSGGGGRDGDWRCP 91 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG G G GGG GGG Sbjct: 9 GGGGAPIPSYGGDGYGGGGGYGGG 32 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGR 854 G G G GGG GG GG GGG R Sbjct: 35 GYGGRGASGGGSYGGRGGYGGGGGRGNR 62 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = -2 Query: 937 GGGXXGGXGGGXGG-GXGGGXGGGXXPGR 854 G G GG GGG G G G GGG GR Sbjct: 22 GYGGGGGYGGGDAGYGGRGASGGGSYGGR 50 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = -2 Query: 940 GGGGXXGGXGG-GXGGGXGGGXGGG 869 GGGG GG G G G GGG GG Sbjct: 25 GGGGYGGGDAGYGGRGASGGGSYGG 49 Score = 29.1 bits (62), Expect = 4.5 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGX---GGGXGGGXXPGRTXERXR 836 G GG G GGG GGG GG GR+ E R Sbjct: 120 GANDRGGGGYSRGGGDSDRGGGRGGRNDSGRSYESSR 156 Score = 28.7 bits (61), Expect = 5.9 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXG 887 GG GG GGG GGG G Sbjct: 383 GGGRGGGGGGYGGGGG 398 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GGG GGG G G G G Sbjct: 19 GGDGYGGGGGYGGGDAGYGGRGASGG 44 Score = 28.3 bits (60), Expect = 7.8 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 922 GGXGGGXGGGXGGGXG 875 GG GG GGG GGG G Sbjct: 383 GGGRGGGGGGYGGGGG 398 Score = 28.3 bits (60), Expect = 7.8 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 913 GGGXGGGXGGGXGGG 869 GGG GGG GG GGG Sbjct: 383 GGGRGGGGGGYGGGG 397 >At5g52470.1 68418.m06510 fibrillarin 1 (FBR1) (FIB1) (SKIP7) identical to fibrillarin 1 GI:9965653 from [Arabidopsis thaliana]; C-terminus identical to SKP1 interacting partner 7 GI:10716959 from [Arabidopsis thaliana]; contains Pfam domain PF01269: Fibrillarin Length = 308 Score = 35.1 bits (77), Expect = 0.068 Identities = 17/37 (45%), Positives = 19/37 (51%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GG G G GG GGG G G G GR+ +R R G Sbjct: 7 GGRGGGGFRGGRDGGGRGFGGGRSFGGGRSGDRGRSG 43 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 3/38 (7%) Frame = -2 Query: 940 GGGGXXGGXGGGX---GGGXGGGXGGGXXPGRTXERXR 836 GGGG GG GG GGG G G GR+ R R Sbjct: 10 GGGGFRGGRDGGGRGFGGGRSFGGGRSGDRGRSGPRGR 47 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 35.1 bits (77), Expect = 0.068 Identities = 16/25 (64%), Positives = 16/25 (64%), Gaps = 2/25 (8%) Frame = -2 Query: 940 GGGGXX--GGXGGGXGGGXGGGXGG 872 GGGG GG GGG GG GGG GG Sbjct: 80 GGGGRREGGGYGGGDGGSYGGGGGG 104 Score = 34.7 bits (76), Expect = 0.090 Identities = 17/30 (56%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXGGXGGGX--GGGXGGGXGGGXXPG 857 GGGG G GGG GGG GGG GG G Sbjct: 72 GGGGGRGYGGGGRREGGGYGGGDGGSYGGG 101 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = -2 Query: 940 GGGGXXGGXG-GGXGGGXGGGXGGG 869 G GG GG G GG G GGG GGG Sbjct: 69 GSGGGGGGRGYGGGGRREGGGYGGG 93 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGG GG GG GG GG GGG Sbjct: 81 GGGRREGGGYGGGDGGSYGGGGGG 104 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 5/29 (17%) Frame = -2 Query: 940 GGGGXXGGX---GGGXGGGXGG--GXGGG 869 GG G GG GGG GGG GG G GGG Sbjct: 75 GGRGYGGGGRREGGGYGGGDGGSYGGGGG 103 >At3g55950.1 68416.m06217 protein kinase family protein contains protein kinase domain, Pfam:PF00069; similar to cytokinin-regulated kinase 1 [Nicotiana tabacum] gi|10998537|gb|AAG25966 Length = 814 Score = 35.1 bits (77), Expect = 0.068 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 837 RSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 +S P P P P PPP PPP P PP Sbjct: 354 KSCPIQFPASPPSQFPLPPPPPPPPPSPSTSSPP 387 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PP P PPP PPP P PP Sbjct: 364 PPSQFPLPPPPPPPPPSPSTSSPP 387 Score = 28.3 bits (60), Expect = 7.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPPP 941 P P PP P PP PPPP Sbjct: 357 PIQFPASPPSQFPLPPPPPPPP 378 >At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein contains Pfam profile PF04410: Gar1 protein RNA binding region Length = 202 Score = 35.1 bits (77), Expect = 0.068 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GG GGG G GGG Sbjct: 20 GGGGRFGGGGGRFGGGGGRFGGGG 43 Score = 34.7 bits (76), Expect = 0.090 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG G GGG GG GG GGG Sbjct: 19 GGGGGRFGGGGGRFGGGGGRFGGG 42 Score = 32.7 bits (71), Expect = 0.36 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXE 845 GGGG G GGG GG GG GG G E Sbjct: 26 GGGGGRFGGGGGRFGGGGGRFGGFRDEGPPSE 57 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 G GG GG GG GGG G GGG Sbjct: 13 GRGGRDGGGGGRFGGGGGRFGGGG 36 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G G GGG G GGG G Sbjct: 7 GGGGFRGRGGRDGGGGGRFGGGGGRFGG 34 >At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 383 Score = 35.1 bits (77), Expect = 0.068 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 +LP PPP PP P P P PP PPPP Sbjct: 217 LLPLQPPPPPPPSQPLPRPLLLPP--PPPP 244 Score = 34.7 bits (76), Expect = 0.090 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P PPP PP P P P PPPP Sbjct: 215 PVLLPLQPPPPPPPSQPLPRPLLLPPPP 242 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 34.7 bits (76), Expect = 0.090 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +3 Query: 870 PPPXPPPXPPP-XPPPXPPXXPP 935 PP PPP PPP PP PP PP Sbjct: 380 PPYGPPPGPPPMMRPPLPPGPPP 402 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = +3 Query: 876 PXPPPXPPPXPPP--XPPXXPPPP 941 P PP PPP PPP PP P PP Sbjct: 378 PRPPYGPPPGPPPMMRPPLPPGPP 401 Score = 31.9 bits (69), Expect = 0.63 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPP 923 P PPP PPP P PP PP Sbjct: 380 PPYGPPPGPPPMMRPPLPPGPP 401 Score = 31.5 bits (68), Expect = 0.84 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 8/36 (22%) Frame = +3 Query: 858 PGXXPPPXPPP------XPPPXPPPXPP--XXPPPP 941 P PPP PPP PP PPP P PPPP Sbjct: 217 PFPPPPPGPPPKEQDFVRPPLPPPPQLPQSSQPPPP 252 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 5/32 (15%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXP-----PXXPPPP 941 G P P P PPP PPP P PPPP Sbjct: 210 GLTLPHSPFPPPPPGPPPKEQDFVRPPLPPPP 241 >At5g25590.1 68418.m03045 expressed protein contains Pfam profile PF04783: Protein of unknown function (DUF630) Length = 775 Score = 34.7 bits (76), Expect = 0.090 Identities = 16/36 (44%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = +3 Query: 837 RSLSXVLPGXXPPPXPPPXP--PPXPPPXPPXXPPP 938 +S + V P PP PPP PP PPP P P P Sbjct: 78 QSRNNVDPASPQPPPPPPIENLPPPPPPLPKFSPSP 113 Score = 28.3 bits (60), Expect = 7.8 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 P P P PPP PP PP P Sbjct: 85 PASPQPPPPPPIENLPPPPPPLP 107 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 34.7 bits (76), Expect = 0.090 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = +1 Query: 796 PPSPPX----PXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P PP P P +L P P PP P P PPP Sbjct: 44 PPPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPP--PVNLSPPPP 92 Score = 34.3 bits (75), Expect = 0.12 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = +1 Query: 796 PPSPPX----PXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P PP P P +L P P PP P P PPP Sbjct: 62 PPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPP--PVNLSPPPP 110 Score = 34.3 bits (75), Expect = 0.12 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = +1 Query: 796 PPSPPX----PXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P PP P P +L P P PP P P PPP Sbjct: 80 PPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPP--PVLLSPPPP 128 Score = 33.9 bits (74), Expect = 0.16 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = +1 Query: 796 PPSPPX----PXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P PP P P +L P P PP P P PPP Sbjct: 89 PPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPP--PVLLSPPPP 137 Score = 33.9 bits (74), Expect = 0.16 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = +1 Query: 796 PPSPPX----PXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P PP P P +L P P PP P P PPP Sbjct: 116 PPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPPP--PVLFSPPPP 164 Score = 33.5 bits (73), Expect = 0.21 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 4/51 (7%) Frame = +1 Query: 796 PPSPPX----PXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P PP P P L P P PP P P PPP Sbjct: 71 PPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPP--PVNLSPPPP 119 Score = 33.1 bits (72), Expect = 0.27 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 4/51 (7%) Frame = +1 Query: 796 PPSPPX----PXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P PP P P L P P PP P P PPP Sbjct: 98 PPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPP--PVNLSPPPP 146 Score = 32.7 bits (71), Expect = 0.36 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = +1 Query: 796 PPSPPX---PXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P PP P P L P P PP P P PPP Sbjct: 134 PPPPPVNLSPPPPPVLLSPPPPPVLFSPPPPTVTRPPPP--PTITRSPPP 181 Score = 31.9 bits (69), Expect = 0.63 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = +1 Query: 796 PPSP---PXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP P P PP P P +L P P PP P P PPP Sbjct: 54 PPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPP--PVLLSPPPP 101 Score = 31.9 bits (69), Expect = 0.63 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 4/51 (7%) Frame = +1 Query: 796 PPSPPX----PXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P PP P P L P P PP P T PPP Sbjct: 125 PPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSPPPPTV--TRPPPPP 173 Score = 31.5 bits (68), Expect = 0.84 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PP P PPP PPPP Sbjct: 57 PVNLSPPPPPVNLSPPPPPVNLSPPPPP 84 Score = 31.5 bits (68), Expect = 0.84 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PP P PPP PPPP Sbjct: 66 PVNLSPPPPPVNLSPPPPPVNLSPPPPP 93 Score = 31.5 bits (68), Expect = 0.84 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PP P PPP PPPP Sbjct: 84 PVNLSPPPPPVLLSPPPPPVNLSPPPPP 111 Score = 31.5 bits (68), Expect = 0.84 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PP P PPP PPPP Sbjct: 93 PVLLSPPPPPVNLSPPPPPVNLSPPPPP 120 Score = 31.5 bits (68), Expect = 0.84 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PP P PPP PPPP Sbjct: 120 PVLLSPPPPPVLLSPPPPPVNLSPPPPP 147 Score = 31.5 bits (68), Expect = 0.84 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 5/35 (14%) Frame = +3 Query: 852 VLPGXXPPPX---PPPXPPPXPPPXPP--XXPPPP 941 VL PPP PPP P PP PP PPPP Sbjct: 130 VLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSPPPP 164 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PP P PPP PPPP Sbjct: 75 PVNLSPPPPPVNLSPPPPPVLLSPPPPP 102 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PP P PPP PPPP Sbjct: 102 PVNLSPPPPPVNLSPPPPPVLLSPPPPP 129 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PP P PPP PPPP Sbjct: 111 PVNLSPPPPPVLLSPPPPPVLLSPPPPP 138 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PP P PPP PPPP Sbjct: 129 PVLLSPPPPPVNLSPPPPPVLLSPPPPP 156 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 5/29 (17%) Frame = +3 Query: 870 PPPX---PPPXPPPXPPPXPP--XXPPPP 941 PPP PPP P PP PP PPPP Sbjct: 55 PPPVNLSPPPPPVNLSPPPPPVNLSPPPP 83 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 5/29 (17%) Frame = +3 Query: 870 PPPX---PPPXPPPXPPPXPP--XXPPPP 941 PPP PPP P PP PP PPPP Sbjct: 64 PPPVNLSPPPPPVNLSPPPPPVNLSPPPP 92 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 9/46 (19%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPX---PPPXP----PPXPP--XXPPPP 941 P +LS P P PPP PPP P PP PP PPPP Sbjct: 65 PPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPP 110 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 5/29 (17%) Frame = +3 Query: 870 PPPX---PPPXPPPXPPPXPP--XXPPPP 941 PPP PPP P PP PP PPPP Sbjct: 91 PPPVLLSPPPPPVNLSPPPPPVNLSPPPP 119 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 9/46 (19%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPX---PPPXP----PPXPP--XXPPPP 941 P +LS P P PPP PPP P PP PP PPPP Sbjct: 101 PPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPP 146 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 3/50 (6%) Frame = +1 Query: 796 PPSPPX---PXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP PP P PP P P L P P P P PPP Sbjct: 107 PPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPP 156 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P +LS P P PPP PPP PPPP Sbjct: 137 PPVNLSPPPPPVLLSPPPPPVLFSPPPPTVTRPPPPP 173 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/45 (33%), Positives = 17/45 (37%) Frame = +1 Query: 802 SPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 S P P P P P ++ P P PP P P PPP Sbjct: 32 SAPEPAPLVDLSPPPPPVNISSPPPPVNLSPPPP--PVNLSPPPP 74 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P LS P P PP P PPP PPPP Sbjct: 146 PPVLLSPPPPPVLFSPPPPTVTRPPPPPTITRSPPPP 182 Score = 29.1 bits (62), Expect = 4.5 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 7/31 (22%) Frame = +3 Query: 870 PPPXP-----PPXPPPXPPPXPP--XXPPPP 941 PPP P PP P PP PP PPPP Sbjct: 44 PPPPPVNISSPPPPVNLSPPPPPVNLSPPPP 74 Score = 29.1 bits (62), Expect = 4.5 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P LS P P PPP PPP PPPP Sbjct: 92 PPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPP 128 Score = 29.1 bits (62), Expect = 4.5 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P LS P P PPP PPP PPPP Sbjct: 119 PPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPPP 155 Score = 28.3 bits (60), Expect = 7.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPPP 941 P PP P PPP PPPP Sbjct: 54 PPPPVNLSPPPPPVNLSPPPPP 75 >At4g33520.3 68417.m04762 metal-transporting P-type ATPase, putative (PAA1) nearly identical to gi:2668492; contains Pfam heavy-metal-associated domain PF00403 Length = 949 Score = 34.7 bits (76), Expect = 0.090 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGG GG GG GGG GGG G Sbjct: 105 GGGSGFGGYNGGSGGGGGGGSESG 128 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -2 Query: 922 GGXG-GGXGGGXGGGXGGGXXPG 857 GG G GG GG GGG GGG G Sbjct: 106 GGSGFGGYNGGSGGGGGGGSESG 128 >At4g33520.2 68417.m04761 metal-transporting P-type ATPase, putative (PAA1) nearly identical to gi:2668492; contains Pfam heavy-metal-associated domain PF00403 Length = 949 Score = 34.7 bits (76), Expect = 0.090 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGG GG GG GGG GGG G Sbjct: 105 GGGSGFGGYNGGSGGGGGGGSESG 128 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -2 Query: 922 GGXG-GGXGGGXGGGXGGGXXPG 857 GG G GG GG GGG GGG G Sbjct: 106 GGSGFGGYNGGSGGGGGGGSESG 128 >At4g33520.1 68417.m04760 metal-transporting P-type ATPase, putative (PAA1) nearly identical to gi:2668492; contains Pfam heavy-metal-associated domain PF00403 Length = 237 Score = 34.7 bits (76), Expect = 0.090 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGG GG GG GGG GGG G Sbjct: 105 GGGSGFGGYNGGSGGGGGGGSESG 128 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -2 Query: 922 GGXG-GGXGGGXGGGXGGGXXPG 857 GG G GG GG GGG GGG G Sbjct: 106 GGSGFGGYNGGSGGGGGGGSESG 128 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 34.7 bits (76), Expect = 0.090 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP P PP P P PPPP Sbjct: 43 PNPSPPPPPSNPSPPPPSPTTTACPPPP 70 Score = 28.3 bits (60), Expect = 7.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 P P P PPP PP P PP P Sbjct: 40 PCQPNPSPPP-PPSNPSPPPPSP 61 >At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / heat shock transcription factor 7 (HSTF7) identical to heat shock factor protein 7 (HSF7) SP:Q9T0D3 from [Arabidopsis thaliana] Length = 377 Score = 34.7 bits (76), Expect = 0.090 Identities = 15/28 (53%), Positives = 16/28 (57%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPGRT 851 GG G GG GGG GGG GGG R+ Sbjct: 28 GGSSGCGAGGGGGGSGGGGGGGGDSQRS 55 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 GG G GGG GG GGG GGG Sbjct: 28 GGSSGCGAGGGGGGSGGGGGGGG 50 Score = 33.1 bits (72), Expect = 0.27 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 G G G G G GGG GG GGG Sbjct: 25 GNSGGSSGCGAGGGGGGSGGGGGG 48 Score = 33.1 bits (72), Expect = 0.27 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GG G GGG G G GGG GG Sbjct: 28 GGSSGCGAGGGGGGSGGGGGGGG 50 Score = 31.5 bits (68), Expect = 0.84 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPGRTXER 842 G GG G GG GGG GGG G +R Sbjct: 25 GNSGGSSGCGAGGGGGGSGGGGGGGGDSQR 54 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G G GG G GG GGG G Sbjct: 18 GGAGCSAGNSGGSSGCGAGGGGGGSGGG 45 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G G GGG GG GGG G Sbjct: 25 GNSGGSSGCGAGGGGGGSGGGGGGGG 50 Score = 28.3 bits (60), Expect = 7.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 GGG G G GG G G GGG Sbjct: 16 GGGGAGCSAGNSGGSSGCGAGGG 38 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 34.7 bits (76), Expect = 0.090 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 885 PPXPPPXPPPXPPXXPPPP 941 PP PP PP PP PPPP Sbjct: 217 PPPKPPSPPRKPPPPPPPP 235 Score = 33.1 bits (72), Expect = 0.27 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = +3 Query: 846 SXVLPGXXPPPXPP-PXPPPXPPPXP--PXXPPPP 941 S LP PPP PP PP P P P P P PP Sbjct: 57 SSPLPPSLPPPSPPGSLTPPLPQPSPSAPITPSPP 91 Score = 32.7 bits (71), Expect = 0.36 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP P PP PPP PP PP Sbjct: 54 PPPSSPLPPSLPPPSPPGSLTPP 76 Score = 32.7 bits (71), Expect = 0.36 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPP 935 PP PP PP PPP PP PP Sbjct: 217 PPPKPPSPPRKPPPPPP--PP 235 Score = 31.9 bits (69), Expect = 0.63 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXP 930 PPS P P PP P P S P P P P P + P Sbjct: 61 PPSLPPPSPPGSLTPPLPQPSPSAPITPSPPSPTTPSNPRSPPSP 105 Score = 31.9 bits (69), Expect = 0.63 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPP 923 PPP PP P PPP PP Sbjct: 217 PPPKPPSPPRKPPPPPPP 234 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 6/33 (18%) Frame = +3 Query: 858 PGXXPPPXPPPXP------PPXPPPXPPXXPPP 938 P P PPP P PP P PP PPP Sbjct: 35 PPTTTPSSPPPSPSTNSTSPPPSSPLPPSLPPP 67 Score = 29.5 bits (63), Expect = 3.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPP 914 LP PP P PPP PPP Sbjct: 216 LPPPKPPSPPRKPPPPPPPP 235 Score = 29.1 bits (62), Expect = 4.5 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 5/51 (9%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSL-XXXPXPXPXXP--PXPXXPXTXXXP--PP 936 P P P PP PSP SL P P P P P P P T P PP Sbjct: 54 PPPSSPLPP-SLPPPSPPGSLTPPLPQPSPSAPITPSPPSPTTPSNPRSPP 103 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P SL+ LP P P PP P P PP P Sbjct: 69 PPGSLTPPLPQPSPSAPITPSPPSPTTPSNPRSPPSP 105 >At3g24250.1 68416.m03044 glycine-rich protein Length = 137 Score = 34.7 bits (76), Expect = 0.090 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -2 Query: 940 GGGGXXGGXGGGXG--GGXGGGXGGGXXP 860 GG G GG GG G GG GGG GG P Sbjct: 102 GGAGGLGGLGGAMGFPGGLGGGPSGGGVP 130 >At3g05920.1 68416.m00668 heavy-metal-associated domain-containing protein contains Pfam profile PF00403: Heavy-metal-associated domain Length = 126 Score = 34.7 bits (76), Expect = 0.090 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPPP 941 G P P PP PP P PP P PP Sbjct: 71 GPPPKPPEPPKPPEPEKPKPPPAPEPP 97 >At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ boundaries domain protein 13 (LBD13) identical to LOB DOMAIN 13 [Arabidopsis thaliana] GI:17227158 SP|Q9AT61 Length = 268 Score = 34.7 bits (76), Expect = 0.090 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 6/38 (15%) Frame = +3 Query: 846 SXVLPGXXPPPXPPPXPP------PXPPPXPPXXPPPP 941 S +L PPP P P PP P PPP PP P P Sbjct: 188 SAILLPPPPPPPPTPRPPRLLSSQPAPPPTPPVSLPSP 225 >At2g11005.1 68415.m01177 glycine-rich protein Length = 170 Score = 34.7 bits (76), Expect = 0.090 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GG G GG G G G G GGG G G Sbjct: 16 GGSGGGGGSGDGSGSGDGGGSGDG 39 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GG GGG G G G G GGG G Sbjct: 13 GDGGGSGG-GGGSGDGSGSGDGGGSGDG 39 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG GGG G G G G G G G Sbjct: 11 GSGDGGGSGGGGGSGDGSGSGDGGGSG 37 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG G G G G G G G G G Sbjct: 15 GGGSGGGGGSGDGSGSGDGGGSGDGGG 41 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG G G G GGG G G G G Sbjct: 20 GGGGSGDGSGSGDGGGSGDGGGSRDSDG 47 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/48 (37%), Positives = 20/48 (41%) Frame = -1 Query: 941 GWGGGXXXVXGXXGXGGXXGXGXGXXSRENXGEGXXXXXGGXGXGGEG 798 G GGG G G G G G G SR++ G G G GG G Sbjct: 17 GSGGGGGSGDGS-GSGDGGGSGDGGGSRDSDGSGDSSGGGSGDSGGFG 63 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 34.7 bits (76), Expect = 0.090 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 7/28 (25%) Frame = +3 Query: 876 PXPPPXPPPXPPP-------XPPXXPPP 938 P PPP PPP PPP PP PPP Sbjct: 42 PHPPPPPPPPPPPLYFSYFSLPPPPPPP 69 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 6/33 (18%) Frame = +3 Query: 855 LPGXXPPPXPPPXP------PPXPPPXPPXXPP 935 LP PPP PPP P PPP PP PP Sbjct: 41 LPHPPPPPPPPPPPLYFSYFSLPPPPPPPHLPP 73 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 8/35 (22%) Frame = +3 Query: 858 PGXXPPPXPPPX-------PPPXPPP-XPPXXPPP 938 P PPP PPP PPP PPP PP P Sbjct: 44 PPPPPPPPPPPLYFSYFSLPPPPPPPHLPPTSVTP 78 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 7/35 (20%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPP-------XXPPPP 941 P P P PPP PPP PP PPPP Sbjct: 32 PSLIPTRFFLPHPPPPPPPPPPPLYFSYFSLPPPP 66 Score = 29.9 bits (64), Expect = 2.6 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +1 Query: 772 PXSXFXWXPPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXP 912 P F PP PP P PP FSL P P P PP P Sbjct: 36 PTRFFLPHPPPPPPPPPPPLYF---SYFSL-PPPPPPPHLPPTSVTP 78 >At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin family protein similar to arabinogalactan protein [Daucus carota] GI:11322245; contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 359 Score = 34.7 bits (76), Expect = 0.090 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPP 935 V P PP PP PP PP PP PP Sbjct: 100 VKPPTKPPVKPPVSPPAKPPVKPPVYPP 127 Score = 34.7 bits (76), Expect = 0.090 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPP 935 V P PP PP PP PP PP PP Sbjct: 172 VKPPTKPPVKPPVSPPAKPPVKPPVYPP 199 Score = 32.3 bits (70), Expect = 0.48 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPP--PP 941 V P PP P PP PP PP PP PP Sbjct: 88 VKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPP 119 Score = 32.3 bits (70), Expect = 0.48 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPP--PP 941 V P PP PP PP PP P PP PP Sbjct: 108 VKPPVSPPAKPPVKPPVYPPTKAPVKPPTKPP 139 Score = 32.3 bits (70), Expect = 0.48 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPP--PP 941 V P PP P PP PP PP PP PP Sbjct: 160 VKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPP 191 Score = 32.3 bits (70), Expect = 0.48 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPP--PP 941 V P PP PP PP PP P PP PP Sbjct: 180 VKPPVSPPAKPPVKPPVYPPTKAPVKPPVSPP 211 Score = 32.3 bits (70), Expect = 0.48 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPP--PP 941 V P PP P PP PP PP PP PP Sbjct: 192 VKPPVYPPTKAPVKPPVSPPTKPPVTPPVYPP 223 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPP--PP 941 V P PP PP PP P PP PP PP Sbjct: 80 VSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPP 111 Score = 31.9 bits (69), Expect = 0.63 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPP 935 V P PP P PP PP PP PP Sbjct: 120 VKPPVYPPTKAPVKPPTKPPVKPPVYPP 147 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPP--PP 941 V P PP PP PP P PP PP PP Sbjct: 132 VKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPP 163 Score = 31.9 bits (69), Expect = 0.63 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPP 935 V P PP P PP PP PP PP Sbjct: 140 VKPPVYPPTKAPVKPPTKPPVKPPVYPP 167 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPP--PP 941 V P PP PP PP P PP PP PP Sbjct: 152 VKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPP 183 Score = 31.5 bits (68), Expect = 0.84 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP--PP 941 P PP PP P PP PP PP PP Sbjct: 118 PPVKPPVYPPTKAPVKPPTKPPVKPPVYPP 147 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP--PP 941 P PP PP PP PP PP P PP Sbjct: 106 PPVKPPVSPPAKPPVKPPVYPPTKAPVKPP 135 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP--PP 941 P PP PP PP PP PP P PP Sbjct: 178 PPVKPPVSPPAKPPVKPPVYPPTKAPVKPP 207 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP--PP 941 P PP PP P PP PP PP PP Sbjct: 190 PPVKPPVYPPTKAPVKPPVSPPTKPPVTPP 219 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPP 938 PP PP PP PP P PP Sbjct: 102 PPTKPPVKPPVSPPAKPPVKPP 123 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPP 938 PP PP PP PP P PP Sbjct: 174 PPTKPPVKPPVSPPAKPPVKPP 195 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +3 Query: 846 SXVLPGXXPPPXPPPXPPPXPPPXPPXXPP--PP 941 S V P P PP PP PP PP P PP Sbjct: 70 SPVKPPVKAPVSPPAKPPVKPPVYPPTKAPVKPP 103 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPP--PP 941 V P P PP PP PP PP P PP Sbjct: 124 VYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPP 155 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPP--PP 941 V P P PP PP PP PP P PP Sbjct: 144 VYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPP 175 >At3g05470.1 68416.m00599 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 884 Score = 28.3 bits (60), Expect(2) = 0.099 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 873 PPXPPPXPPPXP 908 PP PPP PPP P Sbjct: 368 PPPPPPPPPPLP 379 Score = 28.3 bits (60), Expect = 7.8 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 885 PPXPPPXPPPXP 920 PP PPP PPP P Sbjct: 368 PPPPPPPPPPLP 379 Score = 25.0 bits (52), Expect(2) = 0.099 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +3 Query: 888 PXPPPXPPPXPPXXPPPP 941 P P P PP PPPP Sbjct: 418 PINVPNSQPRPPPPPPPP 435 >At5g61660.1 68418.m07736 glycine-rich protein Length = 134 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGG GG G G G G GG GGG Sbjct: 93 GGGARGGGYGYGSGNGRSGGGGGG 116 Score = 31.5 bits (68), Expect = 0.84 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRT 851 G G G G G GG GGG G G GR+ Sbjct: 82 GSGTGYGYGSGGGGARGGGYGYGSGNGRS 110 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXE 845 GGGG GG G G G G G GGG G E Sbjct: 92 GGGGARGG-GYGYGSGNGRSGGGGGGGGFNGE 122 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXG 830 G G G G G G G GG GGG G R G Sbjct: 78 GSGSGSGTGYGYGSGGGGARGGGYGYGSGNGRSGGG 113 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G GGG G G G G GG G Sbjct: 90 GSGGGGARGGGYGYGSGNGRSGGGGGG 116 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G G G G G G G G GGG G Sbjct: 72 GSGYGYGSGSGSGTGYGYGSGGGGARG 98 >At5g33390.1 68418.m03985 glycine-rich protein similar to nuclear antigen EBNA-1 (GI:3342234) {Cercopithecine herpesvirus 15} Length = 118 Score = 34.3 bits (75), Expect = 0.12 Identities = 20/59 (33%), Positives = 20/59 (33%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXGXXXXXXXXXXXGPKXXRXXGXGG 761 GG GG G G G G G GG GR R G G R G GG Sbjct: 16 GGSVSGGSGSGGSGSGGSGSGGSGSGGRANGRGNGGRGSGRGGGRGDGRGDGRGIGGGG 74 Score = 32.7 bits (71), Expect = 0.36 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GG G G G GG G G GGG GR R G Sbjct: 36 GGSGSGGRANGRGNGGRGSGRGGGRGDGRGDGRGIGG 72 Score = 28.3 bits (60), Expect = 7.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGG 869 GG G G G GG GG G G Sbjct: 5 GGGSGSSGSGSGGSVSGGSGSG 26 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 5/29 (17%) Frame = +3 Query: 870 PPPXPP-----PXPPPXPPPXPPXXPPPP 941 PPP PP P PPP PP PPPP Sbjct: 25 PPPPPPMRRSAPSPPPMSGRVPPPPPPPP 53 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = +3 Query: 870 PPPXPPPX--PPPXPPPXPPXXPPPP 941 PPP PPP P PPP PPPP Sbjct: 24 PPPPPPPMRRSAPSPPPMSGRVPPPP 49 Score = 31.9 bits (69), Expect = 0.63 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPP 923 PP PPP P PPP PP Sbjct: 150 PPPPPPMPRRSPPPPPP 166 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP P PP PPPP Sbjct: 148 PLPPP-PPPMPRRSPP--PPPP 166 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXP 894 P PP P PP PSP P P P P Sbjct: 22 PLPPPPPPPMRRSAPSPPPMSGRVPPPPPPPP 53 Score = 28.3 bits (60), Expect = 7.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 888 PXPPPXPPPXPPXXPPPP 941 P PPP PPP P PP Sbjct: 22 PLPPPPPPPMRRSAPSPP 39 >At5g07190.1 68418.m00819 embryo-specific protein 3, putative similar to embryo-specific protein 3 GI:3335171 from [Arabidopsis thaliana] Length = 213 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 P PPP PP PP P PPPP Sbjct: 157 PDLPPPHFPPEFPPETPTTPPPP 179 Score = 33.5 bits (73), Expect = 0.21 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PP PP P PP PP P Sbjct: 160 PPPHFPPEFPPETPTTPPPPPPRP 183 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PP PP PP P PP P P Sbjct: 157 PDLPPPHFPPEFPPETPTTPPPPPPRP 183 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 837 RSLSXVLPGXXPPPXPPPXPPPXPPPXPP 923 R S LP PP PP P PPP PP Sbjct: 153 RPSSPDLPPPHFPPEFPPETPTTPPPPPP 181 >At4g32340.1 68417.m04603 expressed protein Length = 238 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGG 869 GG GG GG G G GGG GGG Sbjct: 85 GGSNGGFGGRGGDGAGGGGGGG 106 Score = 32.7 bits (71), Expect = 0.36 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 G G GG GG GG GGG GG Sbjct: 86 GSNGGFGGRGGDGAGGGGGGGGG 108 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GG G GG G G GGG GGG G Sbjct: 89 GGFGGRGGDGAGGGGGGGGGSVDG 112 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +3 Query: 855 LPGXXPPPXP--PPXPPPXPPPXPPXXPPPP 941 +P PPP P PP P PPP P PP P Sbjct: 57 MPMMTPPPMPMTPPPMPMTPPPMPMAPPPMP 87 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P PPP P PP P Sbjct: 50 PPPVMSPMPMMTPPPMPMTPPPMP 73 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P P P PP P PPP Sbjct: 52 PVMSPMPMMTPPPMPMTPPPMPMTPPP 78 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP P PPP P PP P P Sbjct: 71 PMPMTPPPMPMAPPPMPMASPPMMPMTP 98 Score = 28.3 bits (60), Expect = 7.8 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 1/24 (4%) Frame = +3 Query: 870 PPPXPPPXPP-PXPPPXPPXXPPP 938 PPP P PP P PP P PP Sbjct: 69 PPPMPMTPPPMPMAPPPMPMASPP 92 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 34.3 bits (75), Expect = 0.12 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 18/42 (42%) Frame = +3 Query: 870 PPPXPPPXPPPX------------------PPPXPPXXPPPP 941 PPP PPP PPP PPP PP PPPP Sbjct: 121 PPPPPPPPPPPTITPPVTTTTAGHHHHRRSPPPPPPPPPPPP 162 Score = 32.7 bits (71), Expect = 0.36 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 885 PPXPPPXPPPXPPXXPP 935 PP PPP PPP P PP Sbjct: 120 PPPPPPPPPPPPTITPP 136 Score = 32.7 bits (71), Expect = 0.36 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 888 PXPPPXPPPXPPXXPPP 938 P PPP PPP PP PP Sbjct: 120 PPPPPPPPPPPPTITPP 136 Score = 32.7 bits (71), Expect = 0.36 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 885 PPXPPPXPPPXPPXXPP 935 PP PPP PPP P PP Sbjct: 151 PPPPPPPPPPPPTITPP 167 Score = 32.7 bits (71), Expect = 0.36 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 888 PXPPPXPPPXPPXXPPP 938 P PPP PPP PP PP Sbjct: 151 PPPPPPPPPPPPTITPP 167 Score = 31.9 bits (69), Expect = 0.63 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPP 923 PP PPP PPP P PP Sbjct: 120 PPPPPPPPPPPPTITPP 136 Score = 31.9 bits (69), Expect = 0.63 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPP 923 PP PPP PPP P PP Sbjct: 151 PPPPPPPPPPPPTITPP 167 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 10/34 (29%) Frame = +3 Query: 870 PPPXPPPXPP----------PXPPPXPPXXPPPP 941 PPP PPP PPP PP PPPP Sbjct: 98 PPPPPPPLSAITTTGHHHHRRSPPPPPPPPPPPP 131 Score = 30.3 bits (65), Expect = 1.9 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPP 914 PPP PPP PP PP Sbjct: 153 PPPPPPPPPPTITPP 167 Score = 29.5 bits (63), Expect = 3.4 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPP 914 PPP PPP PPP P Sbjct: 152 PPPPPPPPPPPTITP 166 Score = 29.1 bits (62), Expect = 4.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 894 PPPXPPPXPPXXPPPP 941 PPP PPP PP PP Sbjct: 152 PPPPPPPPPPPTITPP 167 >At3g43583.1 68416.m04636 hypothetical protein Length = 100 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P P PPP P P P P P P P Sbjct: 23 PEKPPSPEPPPSPEPPPSPEKPTSPEQP 50 Score = 33.5 bits (73), Expect = 0.21 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP PP P P P P PP P P Sbjct: 22 PPEKPPSPEPPPSPEPPPSPEKP 44 Score = 33.1 bits (72), Expect = 0.27 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPP--PXPPXXPPPP 941 P PPP P P P P P P P P PP Sbjct: 27 PSPEPPPSPEPPPSPEKPTSPEQPSSPEPP 56 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = +3 Query: 870 PPPXPP-PXPPPXP-PPXPPXXPPPP 941 PP PP P PPP P PP P P P Sbjct: 22 PPEKPPSPEPPPSPEPPPSPEKPTSP 47 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/48 (39%), Positives = 20/48 (41%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPPH 939 P PP P PP PSP P P P P P P + PPPH Sbjct: 23 PEKPPSPEPP-----PSPE------PPPSPEKPTSPEQP-SSPEPPPH 58 >At2g05510.1 68415.m00583 glycine-rich protein Length = 127 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/30 (56%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGG--XGGGXGGGXXPG 857 GGGG GG GG GGG GGG GG G Sbjct: 87 GGGGHYGGGGGHGGGGHYGGGGHHGGGGHG 116 Score = 33.5 bits (73), Expect = 0.21 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = -3 Query: 933 GGXXXGXGXXXXGGXXGXXXXXXXXXXXXXXXGXGXXGGGGXGGGGXPXEXAXRGGGG 760 GG G G GG G G GGGG GGGG GGGG Sbjct: 57 GGGGHGHGGHNGGGGHGLDGYGGGHGGHYGGGGGHYGGGGGHGGGGHYGGGGHHGGGG 114 Score = 33.1 bits (72), Expect = 0.27 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 941 GWGGGXXXVXGXXGXGGXXGXGXGXXSRENXGEGXXXXXGGXGXGGEGG 795 G GGG G G GG G G G G GG GG GG Sbjct: 49 GHGGGGHYGGGGHGHGGHNGGGGHGLDGYGGGHGGHYGGGGGHYGGGGG 97 Score = 33.1 bits (72), Expect = 0.27 Identities = 17/30 (56%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXGGXGGGXGG--GXGGGXGGGXXPG 857 G GG GG GG GG G GGG GGG G Sbjct: 76 GYGGGHGGHYGGGGGHYGGGGGHGGGGHYG 105 Score = 32.3 bits (70), Expect = 0.48 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GG GG GGG GG GGG G Sbjct: 80 GHGGHYGGGGGHYGGG-GGHGGGGHYGG 106 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRT 851 GGGG GG G GG GGG G P +T Sbjct: 94 GGGGHGGGGHYGGGGHHGGGGHGLNEPVQT 123 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G G GG GG GGG G GGG G Sbjct: 73 GLDGYGGGHGGHYGGGGGHYGGGGGHGG 100 Score = 28.3 bits (60), Expect = 7.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGG GGGG Sbjct: 48 GGHGGGGHYGGGGHGHGGHNGGGG 71 Score = 28.3 bits (60), Expect = 7.8 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GG G G GGG G G GG GGG Sbjct: 48 GGHGGGGHYGGG-GHGHGGHNGGG 70 >At1g80130.1 68414.m09379 expressed protein Length = 305 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXE 845 GGGG GG GG G GG G G GR+ + Sbjct: 132 GGGGGMGGSGGNICNGGGGVGGSGVDGGRSED 163 >At1g69440.1 68414.m07979 PAZ domain-containing protein / piwi domain-containing protein similar to SP|Q9XGW1 PINHEAD protein (ZWILLE protein) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 990 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP PPP P PP PP P PP Sbjct: 79 PPPPPPHLLPLSPPLPPLLPLPP 101 >At1g02710.1 68414.m00222 glycine-rich protein Length = 96 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 5/29 (17%) Frame = -2 Query: 940 GGGGXXGGXGGGXG-----GGXGGGXGGG 869 GGGG GG GG G GG GGG GGG Sbjct: 49 GGGGEGGGGEGGGGQKISKGGGGGGSGGG 77 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GGG GGG G G Sbjct: 70 GGGGSGGGQRSSSGGGGGGGEGDG 93 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GGG G Sbjct: 68 GGGG--GGSGGGQRSSSGGGGGGGEGDG 93 Score = 32.3 bits (70), Expect = 0.48 Identities = 17/34 (50%), Positives = 18/34 (52%), Gaps = 5/34 (14%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXG-----GGXGGGXXPGR 854 GGG GG GGG GG G GG GGG G+ Sbjct: 45 GGGEGGGGEGGGGEGGGGQKISKGGGGGGSGGGQ 78 Score = 31.5 bits (68), Expect = 0.84 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGGX*XXNLPTXPGGG 721 G GGGG GGGG GGG + GGG Sbjct: 51 GGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGG 87 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG G G GG GGG GGG G Sbjct: 33 GGGSGKGQWLHGGGGEGGGGEGGGGEGG 60 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 5/32 (15%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGG-----XGGGXXPG 857 GGG GG G G GG GGG GGG G Sbjct: 44 GGGGEGGGGEGGGGEGGGGQKISKGGGGGGSG 75 Score = 29.5 bits (63), Expect = 3.4 Identities = 19/59 (32%), Positives = 19/59 (32%) Frame = -3 Query: 936 GGGXXXGXGXXXXGGXXGXXXXXXXXXXXXXXXGXGXXGGGGXGGGGXPXEXAXRGGGG 760 GGG G GG G G GGGG GGG GGGG Sbjct: 33 GGGSGKGQWLHGGGGEGGGGEGGGGEGGGGQKISKG--GGGGGSGGGQRSSSGGGGGGG 89 Score = 29.1 bits (62), Expect = 4.5 Identities = 16/39 (41%), Positives = 18/39 (46%), Gaps = 4/39 (10%) Frame = -2 Query: 934 GGXXGGXGGGX----GGGXGGGXGGGXXPGRTXERXRXG 830 GG GG G G GGG GGG GG G ++ G Sbjct: 30 GGNGGGSGKGQWLHGGGGEGGGGEGGGGEGGGGQKISKG 68 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GG GGG G G Sbjct: 69 GGGGGSGGGQRSSSGGGGGGGEGDGGGG 96 >At5g43770.1 68418.m05353 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 187 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 V+P PP PP PP PP P PPPP Sbjct: 153 VVPPIWEPPRPPDIFPPESPP-PGIDPPPP 181 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/46 (30%), Positives = 15/46 (32%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPP 933 PP P P PP P + P P PP P PP Sbjct: 136 PPMPDTPNPPTPKTPPDVVPPIWEPPRPPDIFPPESPPPGIDPPPP 181 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 +P PP PP P P P P PP P Sbjct: 111 VPSDPPPLGPPQTPGPEFPVPPSPSPPMP 139 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG P P P PP P PP PP Sbjct: 124 PGPEFPVPPSPSPPMPDTPNPPTPKTPP 151 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPP-XPPXXPPP 938 P P PP PP PP PP PPP Sbjct: 147 PKTPPDVVPPIWEPPRPPDIFPPESPPP 174 >At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ZF-HD homeobox protein-related predicted proteins, Arabidopsis thaliana Length = 334 Score = 33.9 bits (74), Expect = 0.16 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXPPPP 941 PPP PPP PP P PPP Sbjct: 135 PPPPPPPPPPRSPNSASPPP 154 Score = 28.7 bits (61), Expect = 5.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPP 935 PPP PPP PP P P PP Sbjct: 135 PPPPPPPPPPRSPNSASP--PP 154 >At4g03390.1 68417.m00461 leucine-rich repeat transmembrane protein kinase, putative similar to Z. mays leucine-rich repeat transmembrane protein kinase LRRTPK 1, GenBank accession number AF023164 Length = 776 Score = 33.9 bits (74), Expect = 0.16 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = +3 Query: 870 PPPXPPPXPPPXPP 911 PPP PPP PPP PP Sbjct: 427 PPPPPPPPPPPPPP 440 Score = 33.9 bits (74), Expect = 0.16 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = +3 Query: 873 PPXPPPXPPPXPPP 914 PP PPP PPP PPP Sbjct: 427 PPPPPPPPPPPPPP 440 Score = 33.9 bits (74), Expect = 0.16 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = +3 Query: 882 PPPXPPPXPPPXPP 923 PPP PPP PPP PP Sbjct: 427 PPPPPPPPPPPPPP 440 Score = 31.9 bits (69), Expect = 0.63 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = +3 Query: 894 PPPXPPPXPPXXPPPP 941 PPP PPP PP PPPP Sbjct: 427 PPPPPPPPPP--PPPP 440 Score = 29.5 bits (63), Expect = 3.4 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +3 Query: 846 SXVLPGXXPPPXPPPXPP 899 S ++P PPP PPP PP Sbjct: 423 SMLMPPPPPPPPPPPPPP 440 >At3g46740.1 68416.m05074 chloroplast outer envelope protein, putative similar to chloroplastic outer envelope membrane protein (OEP75) [Pisum sativum] GI:633607; contains Pfam profile PF01103: outer membrane protein, OMP85 family Length = 818 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG 875 GGGG G GG GGG GGG G Sbjct: 102 GGGGGGDGNFGGFGGGGGGGDG 123 Score = 32.7 bits (71), Expect = 0.36 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = -2 Query: 940 GGGGXXGGXGG-GXGGGXGGGXGGG 869 GGGG G GG G GGG G G GG Sbjct: 103 GGGGGDGNFGGFGGGGGGGDGNDGG 127 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/20 (70%), Positives = 14/20 (70%), Gaps = 2/20 (10%) Frame = -2 Query: 922 GGXGGGXG--GGXGGGXGGG 869 GG GGG G GG GGG GGG Sbjct: 102 GGGGGGDGNFGGFGGGGGGG 121 >At3g18360.1 68416.m02335 VQ motif-containing protein contains PF05678: VQ motif Length = 285 Score = 33.9 bits (74), Expect = 0.16 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = +3 Query: 873 PPXPPPXPPPXPPP 914 PP PPP PPP PPP Sbjct: 201 PPQPPPHPPPPPPP 214 Score = 33.5 bits (73), Expect = 0.21 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 897 PPXPPPXPPXXPPPP 941 PP PPP PP PPPP Sbjct: 201 PPQPPPHPPPPPPPP 215 Score = 31.5 bits (68), Expect = 0.84 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +3 Query: 885 PPXPPPXPPPXPPXXPP 935 PP PPP PPP PP PP Sbjct: 201 PPQPPPHPPPPPP--PP 215 Score = 29.9 bits (64), Expect = 2.6 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPP 914 PP PP PPP PPP Sbjct: 201 PPQPPPHPPPPPPPP 215 >At2g35920.1 68415.m04409 helicase domain-containing protein similar to DEIH-box RNA/DNA helicase [Arabidopsis thaliana] GI:5881579; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain Length = 995 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 GGG G GG GGG GG GGG Sbjct: 14 GGGHSSGRRGGRGGGGRGGGGGG 36 Score = 33.1 bits (72), Expect = 0.27 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGG G GG GGG GGG GG Sbjct: 14 GGGHSSGRRGGRGGGGRGGGGGG 36 >At2g05380.1 68415.m00566 glycine-rich protein (GRP3S) identical to cDNA glycine-rich protein 3 short isoform (GRP3S) GI:4206766 Length = 116 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GGGG G GGG GG G GGG G R G Sbjct: 54 GGGGHGGHGGGGYQGGGGRYQGGGGRQGGGGSYCRHG 90 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 2/28 (7%) Frame = -2 Query: 934 GGXXGGXGGGX--GGGXGGGXGGGXXPG 857 GG G GGG GGG GG GGG G Sbjct: 41 GGGFGDNGGGRYQGGGGHGGHGGGGYQG 68 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG GG G G GG G GGG G Sbjct: 48 GGGRYQGGGGHGGHGGGGYQGGGGRYQG 75 >At1g54060.1 68414.m06160 expressed protein similar to 6b-interacting protein 1 (NtSIP1) [Nicotiana tabacum] GI:18149189 Length = 383 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGGG G G GGG GGG GG Sbjct: 67 GGGGSGNRNGRGGGGGSGGGGGG 89 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 GGG G G GGG GG GGG Sbjct: 67 GGGGSGNRNGRGGGGGSGGGGGG 89 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PP PPP PPPP Sbjct: 160 PPPPPYVYSPPPPPPYVYQSPPPP 183 Score = 31.5 bits (68), Expect = 0.84 Identities = 19/56 (33%), Positives = 21/56 (37%), Gaps = 8/56 (14%) Frame = +1 Query: 796 PPSPPX-----PXPPXXXXXPSPXFSLXXXPXPXPXX---PPXPXXPXTXXXPPPH 939 PP PP P PP P P + P P P PP P T PPP+ Sbjct: 280 PPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYTSPPPPPY 335 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 8/32 (25%) Frame = +3 Query: 870 PPPX---PPPXPP-----PXPPPXPPXXPPPP 941 PPP PPP PP P PPP PPPP Sbjct: 162 PPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPP 193 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P PPP PPPP Sbjct: 70 PPPPPYVYSSPPPPPYVYNSPPPP 93 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P PPP PPPP Sbjct: 90 PPPPPYVYSSPPPPPYVYKSPPPP 113 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P PPP PPPP Sbjct: 100 PPPPPYVYKSPPPPPYVYSSPPPP 123 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P PPP PPPP Sbjct: 110 PPPPPYVYSSPPPPPYVYKSPPPP 133 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P PPP PPPP Sbjct: 120 PPPPPYVYKSPPPPPYVYSSPPPP 143 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/53 (33%), Positives = 19/53 (35%), Gaps = 6/53 (11%) Frame = +1 Query: 796 PPSPPX-----PXPPXXXXXPSPXFSLXXXPXPXPXX-PPXPXXPXTXXXPPP 936 PP PP P PP P P + P P P P P P PPP Sbjct: 130 PPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPP 182 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P PPP PPPP Sbjct: 130 PPPPPYVYSSPPPPPYVYSSPPPP 153 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P PPP PPPP Sbjct: 140 PPPPPYVYSSPPPPPYVYKSPPPP 163 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P PPP PPPP Sbjct: 150 PPPPPYVYKSPPPPPYVYSPPPPP 173 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P PPP PPPP Sbjct: 180 PPPPPYVYSSPPPPPYVYKSPPPP 203 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P PPP PPPP Sbjct: 190 PPPPPYVYKSPPPPPYVYSSPPPP 213 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P PPP PPPP Sbjct: 200 PPPPPYVYSSPPPPPYVYKSPPPP 223 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P PPP PPPP Sbjct: 210 PPPPPYVYKSPPPPPYVYSSPPPP 233 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P PPP PPPP Sbjct: 220 PPPPPYVYSSPPPPPYVYKSPPPP 243 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P PPP PPPP Sbjct: 230 PPPPPYVYKSPPPPPYVYSSPPPP 253 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P PPP PPPP Sbjct: 240 PPPPPYVYSSPPPPPYVYKSPPPP 263 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P PPP PPPP Sbjct: 250 PPPPPYVYKSPPPPPYVYSSPPPP 273 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P PPP PPPP Sbjct: 260 PPPPPYVYSSPPPPPYVYKSPPPP 283 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P PPP PPPP Sbjct: 270 PPPPPYVYKSPPPPPYVYSSPPPP 293 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P PPP PPPP Sbjct: 280 PPPPPYVYSSPPPPPYVYSSPPPP 303 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P PPP PPPP Sbjct: 290 PPPPPYVYSSPPPPPYVYSSPPPP 313 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P PPP PPPP Sbjct: 300 PPPPPYVYSSPPPPPYVYKSPPPP 323 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P PPP PPPP Sbjct: 310 PPPPPYVYKSPPPPPYVYTSPPPP 333 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P PPP PPPP Sbjct: 320 PPPPPYVYTSPPPPPYVYKSPPPP 343 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P PPP PPPP Sbjct: 80 PPPPPYVYNSPPPPPYVYSSPPPP 103 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/45 (31%), Positives = 15/45 (33%) Frame = +1 Query: 802 SPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 SPP P P P P + P P P P PPP Sbjct: 168 SPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 212 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP PP PPPP Sbjct: 161 PPPPYVYSPPPPPPYVYQSPPPPP 184 Score = 28.7 bits (61), Expect = 5.9 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 12/36 (33%) Frame = +3 Query: 870 PPPXPP-----PXPPPX----PPPXP---PXXPPPP 941 PPP PP P PPP PPP P PPPP Sbjct: 169 PPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPP 204 Score = 28.3 bits (60), Expect = 7.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P PPP PPP Sbjct: 330 PPPPPYVYKSPPPPPYVDSYSPPP 353 >At1g11850.1 68414.m01363 expressed protein Length = 93 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 G G G GGG GGG GGG GG Sbjct: 69 GAGAGLGLGGGGFGGGAGGGLGG 91 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXG-GGXGGGXXPG 857 GGGG G G G GGG G GG G G G Sbjct: 41 GGGGSGDGLGLGLGGGAGLGGLGIGAGIG 69 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXG--GXGGGXGGGXGGGXGGGXXPG 857 GGG G G G G G G G G GGG G Sbjct: 54 GGGAGLGGLGIGAGIGAGAGLGLGGGGFGG 83 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G G G G G G GGG GG G Sbjct: 60 GGLGIGAGIGAGAGLGLGGGGFGGGAGG 87 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGX-GGGXGGG 869 G G G G G GGG GGG GGG Sbjct: 65 GAGIGAGAGLGLGGGGFGGGAGGG 88 >At5g66960.1 68418.m08442 prolyl oligopeptidase family protein similar to OpdB [Treponema denticola] GI:13786054; contains Pfam profiles PF00326: prolyl oligopeptidase family, PF02897: Prolyl oligopeptidase, N-terminal beta-propeller domain Length = 792 Score = 33.5 bits (73), Expect = 0.21 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXP 932 PP PPP PPP P PP P Sbjct: 26 PPKSPPPPPPPPALPKPPKKP 46 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 885 PPXPPPXPPPXPPXXPPPP 941 PP PP PPP PP P PP Sbjct: 26 PPKSPP-PPPPPPALPKPP 43 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXP 920 P PPP PPP P PP P Sbjct: 26 PPKSPPPPPPPPALPKPPKKP 46 Score = 28.3 bits (60), Expect = 7.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP PP PP PPP P P P Sbjct: 26 PPKSPP--PPPPPPALPKPPKKP 46 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 33.5 bits (73), Expect = 0.21 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P PP PP P PP PP PP P Sbjct: 180 PPVQPPTYNPPTTPVKPPTAPPVKPPTP 207 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPP 935 P + V P PP P PP PP PP PP Sbjct: 175 PPTTTPPVQPPTYNPPTTPVKPPTAPPVKPPTPPP 209 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PP PP PP P PP PP Sbjct: 146 PVQSPPVQPPTYKPPTSPVKPPTTTPP 172 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PP PP PP P PP PP Sbjct: 96 PIKLPPVQPPTYKPPTPTVKPPSVQPP 122 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP--PP 941 P PP PP P PP P PP PP Sbjct: 117 PSVQPPTYKPPTPTVKPPTTSPVKPPTTPP 146 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +3 Query: 846 SXVLPGXXPPPXPPPX-PPPXPPPXPPXXPP 935 S V P PP PP PP PP P PP Sbjct: 137 SPVKPPTTPPVQSPPVQPPTYKPPTSPVKPP 167 Score = 28.7 bits (61), Expect = 5.9 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPP 935 V P PP P PP P PP PP Sbjct: 119 VQPPTYKPPTPTVKPPTTSPVKPPTTPP 146 Score = 28.7 bits (61), Expect = 5.9 Identities = 14/38 (36%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXP--PPXPPPXPPXXPPP 938 P + + P P PP P PP PP P PPP Sbjct: 172 PVKPPTTTPPVQPPTYNPPTTPVKPPTAPPVKPPTPPP 209 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPP-XPPXXPPP 938 LP PP PP P PP PP PP Sbjct: 99 LPPVQPPTYKPPTPTVKPPSVQPPTYKPP 127 Score = 28.3 bits (60), Expect = 7.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 V P PP P PP PP P PP Sbjct: 152 VQPPTYKPPTSPVKPPTTTPPVKPPTTTPP 181 Score = 28.3 bits (60), Expect = 7.8 Identities = 14/39 (35%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPPXXPP--PP 941 P + + P P PP PP PP P PP PP Sbjct: 163 PVKPPTTTPPVKPPTTTPPVQPPTYNPPTTPVKPPTAPP 201 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 5/34 (14%) Frame = +3 Query: 855 LPGXXPPPX-----PPPXPPPXPPPXPPXXPPPP 941 LP PPP PPP PPP P PPPP Sbjct: 29 LPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPP 62 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 6/30 (20%) Frame = +3 Query: 870 PPPXPPPX------PPPXPPPXPPXXPPPP 941 PPP PPP PPP PPP P PP Sbjct: 43 PPPPPPPLMRRRAPPPPPPPPLPRPCSRPP 72 Score = 32.7 bits (71), Expect = 0.36 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPPP 941 P PPP PPP P PPPP Sbjct: 28 PLPPPPPPPLMRRRAPPPPPPP 49 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 11/33 (33%) Frame = +3 Query: 876 PXPPPXPP------PXPPPXPP-----XXPPPP 941 P PPP PP P PPP PP PPPP Sbjct: 14 PLPPPPPPLMRRRAPLPPPPPPPLMRRRAPPPP 46 >At4g37900.1 68417.m05360 glycine-rich protein Length = 787 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG GG GG G G GGG GGG G Sbjct: 713 GGHCGGCGGCGGCGGGGGCGGGGRCG 738 >At4g29020.1 68417.m04149 glycine-rich protein supporting cDNA gi|20465684|gb|AY096677.1| Length = 158 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXG-GGXGGGXXPG 857 G GG GG GGG GG G GG GGG G Sbjct: 80 GVGGGIGGLGGGVGGLGGLGGLGGGSGLG 108 Score = 29.5 bits (63), Expect = 3.4 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -2 Query: 940 GGGGXXGGXGGGXG-GGXGGGXG-GGXXP 860 GG G GG GG G GG GGG GG P Sbjct: 128 GGAGGLGGIGGVGGLGGIGGGSDCGGVIP 156 Score = 29.1 bits (62), Expect = 4.5 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXGGXGG--GXGGGXGGGXGGGXXPG 857 G GG GG GG G GGG G G G G G Sbjct: 87 GLGGGVGGLGGLGGLGGGSGLGHGVGGIGG 116 Score = 28.3 bits (60), Expect = 7.8 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 4/27 (14%) Frame = -2 Query: 940 GGGGXXGGXGGGXG----GGXGGGXGG 872 G GG GG GG G GG GGG GG Sbjct: 61 GLGGVAGGVGGVAGVLPVGGVGGGIGG 87 >At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containing protein similar to Hsc70-interacting protein (Hip) from {Homo sapiens} SP|P50502, {Rattus norvegicus} SP|P50503; contains Pfam profile PF00515: tetratricopeptide repeat (TPR) domain Length = 441 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/28 (57%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGX-GGGXXPG 857 GGG G GGG G GGG GGG PG Sbjct: 354 GGGMPAGMGGGGMPGAGGGMPGGGGMPG 381 Score = 33.1 bits (72), Expect = 0.27 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 G GG GG GG GGG G GGG PG Sbjct: 326 GMGGMPGGFPGGMGGGMPAGMGGG-MPG 352 Score = 33.1 bits (72), Expect = 0.27 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 3/30 (10%) Frame = -2 Query: 937 GGGXXGGXGGGX---GGGXGGGXGGGXXPG 857 GGG G GGG GGG G GGG PG Sbjct: 339 GGGMPAGMGGGMPGMGGGMPAGMGGGGMPG 368 Score = 28.7 bits (61), Expect = 5.9 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGG---XGGGXXPG 857 G GG G GGG G GGG GG PG Sbjct: 345 GMGGGMPGMGGGMPAGMGGGGMPGAGGGMPG 375 Score = 28.3 bits (60), Expect = 7.8 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGG--GXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG G GG G GGG G GGG G Sbjct: 347 GGGMPGMGGGMPAGMGGGGMPGAGGGMPGG 376 >At3g55790.1 68416.m06199 expressed protein predicted protein, Arabidopsis thaliana; expression supported by MPSS Length = 103 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG G GGG GGG G G G Sbjct: 59 GGGGGGRGGGGGHGGGGGEDFGNG 82 >At3g06130.1 68416.m00704 heavy-metal-associated domain-containing protein contains Pfam heavy metal associated domain PF00403 Length = 473 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GGG GGG G G G PG Sbjct: 256 GGKGAPAAGGGGAGGGKGAGGGAKGGPG 283 Score = 31.5 bits (68), Expect = 0.84 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = -3 Query: 822 GGGGXGGGGXPXEXAXRGGGGX*XXNLPTXPGGG 721 GGG GGGG P + GGGG GGG Sbjct: 288 GGGKNGGGGHPQDGKNGGGGGGPNAGKKGNGGGG 321 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXP 860 GGG G G G GG GG GG P Sbjct: 307 GGGPNAGKKGNGGGGPMAGGVSGGFRP 333 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGG G GG GGG GGG Sbjct: 106 GGGNNNNNKKGQKNGGGGGGGGGG 129 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGR 854 GGG GG GG G GG GGG G+ Sbjct: 288 GGGKNGG-GGHPQDGKNGGGGGGPNAGK 314 Score = 29.1 bits (62), Expect = 4.5 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 4/32 (12%) Frame = -2 Query: 940 GGG----GXXGGXGGGXGGGXGGGXGGGXXPG 857 GGG G GG GGG G G GGG G Sbjct: 294 GGGHPQDGKNGGGGGGPNAGKKGNGGGGPMAG 325 Score = 28.7 bits (61), Expect = 5.9 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = -2 Query: 940 GGGGXXGGXGGGX--GGGXGGGXGGG 869 GGGG G GGG GGG GGG Sbjct: 105 GGGGNNNNNKKGQKNGGGGGGGGGGG 130 Score = 28.7 bits (61), Expect = 5.9 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXGGXG--GGXGGGXGGGXGGGXXPG 857 GGGG GG G GG GG G GG G Sbjct: 264 GGGGAGGGKGAGGGAKGGPGNQNQGGGKNG 293 >At2g05540.1 68415.m00586 glycine-rich protein Length = 135 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GG GG GG GGG GG GGG R R G Sbjct: 48 GGFPGGGYGGFPGGGYGGNPGGGYGNRGGGYRNRDG 83 >At5g59950.3 68418.m07518 RNA and export factor-binding protein, putative Length = 242 Score = 33.1 bits (72), Expect = 0.27 Identities = 16/30 (53%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = -2 Query: 937 GGGXXGGX--GGGXGGGXGGGXGGGXXPGR 854 GG GG GGG GGG GG G G PG+ Sbjct: 187 GGQGRGGQQRGGGRGGGGRGGGGRGRRPGK 216 >At5g59950.2 68418.m07519 RNA and export factor-binding protein, putative Length = 178 Score = 33.1 bits (72), Expect = 0.27 Identities = 16/30 (53%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = -2 Query: 937 GGGXXGGX--GGGXGGGXGGGXGGGXXPGR 854 GG GG GGG GGG GG G G PG+ Sbjct: 123 GGQGRGGQQRGGGRGGGGRGGGGRGRRPGK 152 >At5g59950.1 68418.m07517 RNA and export factor-binding protein, putative Length = 244 Score = 33.1 bits (72), Expect = 0.27 Identities = 16/30 (53%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = -2 Query: 937 GGGXXGGX--GGGXGGGXGGGXGGGXXPGR 854 GG GG GGG GGG GG G G PG+ Sbjct: 189 GGQGRGGQQRGGGRGGGGRGGGGRGRRPGK 218 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 33.1 bits (72), Expect = 0.27 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPPPXP-PPXPPPXPPPXPPXXPPPP 941 P P P P PP P P P P PP P P Sbjct: 29 PKPKPAPAPTPPKPKPTPAPTPPKPKPKP 57 Score = 33.1 bits (72), Expect = 0.27 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPPPXP-PPXPPPXPPPXPPXXPPPP 941 P P P P PP P P P P PP P P Sbjct: 40 PKPKPTPAPTPPKPKPKPAPTPPKPKPAP 68 Score = 33.1 bits (72), Expect = 0.27 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPPPXP-PPXPPPXPPPXPPXXPPPP 941 P P P P PP P P P P PP P P Sbjct: 51 PKPKPKPAPTPPKPKPAPAPTPPKPKPAP 79 Score = 33.1 bits (72), Expect = 0.27 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPPPXP-PPXPPPXPPPXPPXXPPPP 941 P P P P PP P P P P PP P P Sbjct: 62 PKPKPAPAPTPPKPKPAPAPTPPKPKPKP 90 Score = 33.1 bits (72), Expect = 0.27 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPPPXP-PPXPPPXPPPXPPXXPPPP 941 P P P P PP P P P P PP P P Sbjct: 73 PKPKPAPAPTPPKPKPKPAPTPPNPKPTP 101 Score = 33.1 bits (72), Expect = 0.27 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPPPXP-PPXPPPXPPPXPPXXPPPP 941 P P P P PP P P P P PP P P Sbjct: 84 PKPKPKPAPTPPNPKPTPAPTPPKPKPAP 112 Score = 32.7 bits (71), Expect = 0.36 Identities = 16/36 (44%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = +3 Query: 840 SLSXVLPGXXP-PPXPPPXPPPXPP-PXPPXXPPPP 941 S++ V P PP P P P P PP P P P PP Sbjct: 16 SITIVSSAPAPKPPKPKPAPAPTPPKPKPTPAPTPP 51 Score = 32.7 bits (71), Expect = 0.36 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPP-PXPPPXP-PPXPPPXPPXXPPPP 941 P PP P P P P PP P P P PP P Sbjct: 24 PAPKPPKPKPAPAPTPPKPKPTPAPTPPKP 53 Score = 32.7 bits (71), Expect = 0.36 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXP-PPXPPPXPPPXPP-PXPPXXPPPP 941 P P PP P P P P PP P P P PP Sbjct: 33 PAPAPTPPKPKPTPAPTPPKPKPKPAPTPP 62 Score = 32.7 bits (71), Expect = 0.36 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPP-PXPPPXP-PPXPPPXPPXXPPPP 941 P PP P P P P PP P P P PP P Sbjct: 35 PAPTPPKPKPTPAPTPPKPKPKPAPTPPKP 64 Score = 32.7 bits (71), Expect = 0.36 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPP-PXPPPXP-PPXPPPXPPXXPPPP 941 P PP P P P P PP P P P PP P Sbjct: 46 PAPTPPKPKPKPAPTPPKPKPAPAPTPPKP 75 Score = 32.7 bits (71), Expect = 0.36 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPP-PXPPPXP-PPXPPPXPPXXPPPP 941 P PP P P P P PP P P P PP P Sbjct: 57 PAPTPPKPKPAPAPTPPKPKPAPAPTPPKP 86 Score = 32.7 bits (71), Expect = 0.36 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXP-PPXPPPXPPPXPP-PXPPXXPPPP 941 P P PP P P P P PP P P P PP Sbjct: 66 PAPAPTPPKPKPAPAPTPPKPKPKPAPTPP 95 Score = 32.7 bits (71), Expect = 0.36 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXP-PPXPPPXPPPXPP-PXPPXXPPPP 941 P P PP P P P P PP P P P PP Sbjct: 77 PAPAPTPPKPKPKPAPTPPNPKPTPAPTPP 106 Score = 32.7 bits (71), Expect = 0.36 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPP-PXPPPXP-PPXPPPXPPXXPPPP 941 P PP P P P P PP P P P PP P Sbjct: 79 PAPTPPKPKPKPAPTPPNPKPTPAPTPPKP 108 Score = 32.3 bits (70), Expect = 0.48 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPP-PXPPPXP-PPXPPPXPPXXPPPP 941 P PP P P P P PP P P P PP P Sbjct: 68 PAPTPPKPKPAPAPTPPKPKPKPAPTPPNP 97 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXP-PPXPPPXPPPXPPXXPPP 938 P P P P PP P P P P P P P Sbjct: 95 PNPKPTPAPTPPKPKPAPAPAPTPAPKP 122 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPP-PXPPPXPPPXPPPXPPXXPPP 938 P PP P P P P P P P P P P Sbjct: 101 PAPTPPKPKPAPAPAPTPAPKPKPAPKP 128 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 +S + P P P P P P P P PP P P Sbjct: 15 ISITIVSSAPAPKP-PKPKPAPAPTPPKPKPTP 46 Score = 30.3 bits (65), Expect = 1.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP P P P P PP P P P Sbjct: 94 PPNPKPTPAPTPPKPKPAPAPAP 116 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +3 Query: 858 PGXXPPPXPP-PXPPPXPPPXPPXXPPP 938 P P P PP P P P P P P P P Sbjct: 97 PKPTPAPTPPKPKPAPAPAPTPAPKPKP 124 Score = 30.3 bits (65), Expect = 1.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 P P P P P P P P P P P Sbjct: 108 PKPAPAPAPTPAPKPKPAPKPAP 130 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/47 (31%), Positives = 15/47 (31%), Gaps = 1/47 (2%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSP-XFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P PP P P P P P P P P P P P P Sbjct: 26 PKPPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTP 72 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/47 (31%), Positives = 16/47 (34%), Gaps = 1/47 (2%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSP-XFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P+PP P P P P P P P P P P P P Sbjct: 37 PTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTP 83 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/47 (31%), Positives = 16/47 (34%), Gaps = 1/47 (2%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSP-XFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P+PP P P P P P P P P P P P P Sbjct: 70 PTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAP 116 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPPPXPP-PXPPPXPPPXPPXXPPPP 941 P P P PP P P P P P P P P Sbjct: 86 PKPKPAPTPPNPKPTPAPTPPKPKPAPAP 114 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = +3 Query: 858 PGXXPP-PXPPPXP-PPXPPPXPPXXPPP 938 P PP P P P P PP P P P P P Sbjct: 90 PAPTPPNPKPTPAPTPPKPKPAPAPAPTP 118 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = +3 Query: 858 PGXXPPPXPP-PXPPPXP-PPXPPXXPPP 938 P P P PP P P P P PP P P P Sbjct: 42 PKPTPAPTPPKPKPKPAPTPPKPKPAPAP 70 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = +3 Query: 858 PGXXPPPXPP-PXPPPXP-PPXPPXXPPP 938 P P P PP P P P P PP P P P Sbjct: 53 PKPKPAPTPPKPKPAPAPTPPKPKPAPAP 81 Score = 29.1 bits (62), Expect = 4.5 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXP 932 P P P P P P P P P P P Sbjct: 106 PKPKPAPAPAPTPAPKPKPAPKPAP 130 Score = 28.7 bits (61), Expect = 5.9 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = +1 Query: 799 PSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXP 903 P+PP P P P P + P P P P P Sbjct: 92 PTPPNPKPTPAPTPPKPKPAPAPAPTPAPKPKPAP 126 >At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 175 Score = 33.1 bits (72), Expect = 0.27 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGGG GG GG GGG GG G Sbjct: 127 GGGGQGGGGQGGGGGGAEGGTTG 149 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 913 GGGXGGGXGGGXGGGXXPGRT 851 GGG GGG GG GGG G T Sbjct: 128 GGGQGGGGQGGGGGGAEGGTT 148 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 922 GGXGGGXGGGXGGGXGGG 869 GG GGG GG GGG GG Sbjct: 129 GGQGGGGQGGGGGGAEGG 146 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 922 GGXGGGXGGGXGGGXGGGXXPGRT 851 G GGG GG G G GGG G T Sbjct: 124 GTIGGGGQGGGGQGGGGGGAEGGT 147 Score = 28.7 bits (61), Expect = 5.9 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 P PPP P PP PP PP Sbjct: 61 PYGNPPPPSPQYSPPPPPSQSSPP 84 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXP-PPXPPXXPPPP 941 G PPP P PPP P PP PP Sbjct: 63 GNPPPPSPQYSPPPPPSQSSPPRSRCPP 90 >At4g38770.1 68417.m05490 proline-rich family protein (PRP4) similar to proline-rich protein [Arabidopsis thaliana] gi|6782442|gb|AAF28388; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 448 Score = 33.1 bits (72), Expect = 0.27 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 3/30 (10%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPX---PPPXPPXXPPP 938 P PPP P PPP PPP P PPP Sbjct: 189 PVEVPPPVPVYEPPPKKEIPPPVPVYDPPP 218 Score = 32.3 bits (70), Expect = 0.48 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 3/26 (11%) Frame = +3 Query: 870 PPPXPPPXPPPX---PPPXPPXXPPP 938 PPP P PPP PPP P PPP Sbjct: 208 PPPVPVYDPPPKKEVPPPVPVYKPPP 233 Score = 32.3 bits (70), Expect = 0.48 Identities = 15/40 (37%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPX---PPPXPPPXPPPXPPXXPPPP 941 P + + +P PPP PPP P PP PP PP Sbjct: 218 PKKEVPPPVPVYKPPPKVELPPPIPKKPCPPKPPKIEHPP 257 Score = 32.3 bits (70), Expect = 0.48 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 3/26 (11%) Frame = +3 Query: 870 PPPXPPPXPPPX---PPPXPPXXPPP 938 PPP P PPP PPP P PPP Sbjct: 256 PPPVPVYKPPPKIEKPPPVPVYKPPP 281 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPP--XPPPXPPXXPPP 938 LP P PP PP PPP P PPP Sbjct: 174 LPPFLKKPCPPKYSPPVEVPPPVPVYEPPP 203 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/32 (43%), Positives = 15/32 (46%), Gaps = 3/32 (9%) Frame = +3 Query: 855 LPGXXPPPX---PPPXPPPXPPPXPPXXPPPP 941 +P PPP PPP P PPP PP P Sbjct: 196 VPVYEPPPKKEIPPPVPVYDPPPKKEVPPPVP 227 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/32 (43%), Positives = 15/32 (46%), Gaps = 3/32 (9%) Frame = +3 Query: 855 LPGXXPPPX---PPPXPPPXPPPXPPXXPPPP 941 +P PPP PPP P PPP PP P Sbjct: 259 VPVYKPPPKIEKPPPVPVYKPPPKIEHPPPVP 290 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +3 Query: 858 PGXXPP-PXPPPXPPPXPPPXPPXXPPPP 941 P PP PPP P PPP PP P Sbjct: 184 PKYSPPVEVPPPVPVYEPPPKKEIPPPVP 212 Score = 28.3 bits (60), Expect = 7.8 Identities = 14/40 (35%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXP---PPXPPPXPPPXPPXXPPPP 941 P + + +P PPP PP P PPP PP P Sbjct: 203 PKKEIPPPVPVYDPPPKKEVPPPVPVYKPPPKVELPPPIP 242 Score = 28.3 bits (60), Expect = 7.8 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPX--PPPXP--PPXPPXXPPPP 941 P L +P PP PP PPP P P P PPP Sbjct: 233 PKVELPPPIPKKPCPPKPPKIEHPPPVPVYKPPPKIEKPPP 273 Score = 28.3 bits (60), Expect = 7.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PP P P PPP Sbjct: 306 PPPVPVHKPPTKKPCPPKKVDPPP 329 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%) Frame = +3 Query: 870 PPPXPPPXPPP---XPPPXPPXXPPPP 941 PPP P PPP PPP PP P Sbjct: 327 PPPVPVHKPPPKIVIPPPKIEHPPPVP 353 Score = 28.3 bits (60), Expect = 7.8 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 +P P PPP P PP P P PP Sbjct: 368 IPPIVKKPCPPPVPIYKPPVVIPKKPCPP 396 >At4g12470.1 68417.m01972 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 161 Score = 33.1 bits (72), Expect = 0.27 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPPP 941 P P P P P P P P PPPP Sbjct: 32 PSPKPKPVPSPKPKPVQCPPPP 53 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P P P PPP P P P Sbjct: 34 PKPKPVPSPKPKPVQCPPPPRPSVPSP 60 >At3g15000.1 68416.m01897 expressed protein similar to DAG protein (required for chloroplast differentiation and palisade development) GB:Q38732 [Antirrhinum majus] Length = 395 Score = 33.1 bits (72), Expect = 0.27 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 + G PP PP PP PP PPPP Sbjct: 237 MAGGPPPQRPPMGGPPPPPHIGGSAPPPP 265 >At2g26410.1 68415.m03169 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 516 Score = 33.1 bits (72), Expect = 0.27 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = +3 Query: 870 PPPXPPPXPPPXPPP-XPPXXPPPP 941 P P PPP P P P PP PPPP Sbjct: 52 PYPPPPPLPDFAPQPLLPPPSPPPP 76 Score = 32.7 bits (71), Expect = 0.36 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P P P P PP PPPP Sbjct: 54 PPPPPLPDFAPQPLLPPPSPPPPP 77 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P PPP P P P PP P PPP Sbjct: 52 PYPPPPPLPDFAPQPLLPPPSPPPPPP 78 Score = 29.5 bits (63), Expect = 3.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPP 914 LP P P PP PP PPP Sbjct: 59 LPDFAPQPLLPPPSPPPPPP 78 >At2g05530.1 68415.m00585 glycine-rich protein Length = 115 Score = 33.1 bits (72), Expect = 0.27 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = -2 Query: 940 GGGGXXGGXGGGXGG-GXGGGXGGGXXPGR 854 GGGG GG G GG GGG GG GR Sbjct: 53 GGGGYNGGGGHNGGGYNGGGGYNGGGHGGR 82 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG GG G GGG GG G Sbjct: 43 GGHGGNGGYNGGGGYNGGGGHNGGGYNG 70 Score = 29.1 bits (62), Expect = 4.5 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGG---XGGGXXPG 857 G GG GG G GGG GG GGG G Sbjct: 47 GNGGYNGGGGYNGGGGHNGGGYNGGGGYNGG 77 Score = 28.7 bits (61), Expect = 5.9 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -3 Query: 831 GXXGGGGXGGGGXPXEXAXRGGGG 760 G GGGG GGG GGGG Sbjct: 50 GYNGGGGYNGGGGHNGGGYNGGGG 73 >At1g77030.1 68414.m08970 glycine-rich protein Length = 349 Score = 33.1 bits (72), Expect = 0.27 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GG G GG GG GGG GG GG Sbjct: 205 GGRGGRGGARGGRGGGARGGRGG 227 Score = 32.7 bits (71), Expect = 0.36 Identities = 17/36 (47%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGG---XGGGXXPGRTXER 842 G GG GG GGG GG GG GGG G + +R Sbjct: 209 GRGGARGGRGGGARGGRGGSRDFGGGGRDFGSSSDR 244 >At1g68390.1 68414.m07813 expressed protein contains Pfam profile PF03267: Arabidopsis protein of unknown function, DUF266; expression supported by MPSS Length = 408 Score = 33.1 bits (72), Expect = 0.27 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXP 920 PP PPP PPP PP P Sbjct: 79 PPSPPPPPPPSPPSEP 94 Score = 33.1 bits (72), Expect = 0.27 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 885 PPXPPPXPPPXPPXXP 932 PP PPP PPP PP P Sbjct: 79 PPSPPPPPPPSPPSEP 94 >At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family protein Length = 558 Score = 33.1 bits (72), Expect = 0.27 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPP 923 P PP PPP PPP PP Sbjct: 255 PFAPPTPPPPPPPPPP 270 Score = 32.3 bits (70), Expect = 0.48 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXP 920 PP PPP PPP PPP P Sbjct: 258 PPTPPP-PPPPPPPRP 272 Score = 31.9 bits (69), Expect = 0.63 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 888 PXPPPXPPPXPPXXPPPP 941 P PP PPP PP PP P Sbjct: 255 PFAPPTPPPPPPPPPPRP 272 Score = 29.9 bits (64), Expect = 2.6 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPP 914 PP PPP PPP P P Sbjct: 258 PPTPPPPPPPPPPRP 272 Score = 28.7 bits (61), Expect = 5.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXP 920 P PP PPP PPP P Sbjct: 255 PFAPPTPPPPPPPPPP 270 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXPP 923 P SL P P P PPP PPP P Sbjct: 242 PASSLGKRDENSSPFAPPTPPPPPPPPPPRP 272 >At1g35617.1 68414.m04424 hypothetical protein Length = 121 Score = 33.1 bits (72), Expect = 0.27 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP P P P PP P Sbjct: 21 PPPAPPPESSSPPTPPEPPDPPDP 44 >At5g66400.1 68418.m08374 dehydrin (RAB18) nearly identical to SP|P30185 Dehydrin Rab18 {Arabidopsis thaliana} Length = 186 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGGG G GGG GG G G GG Sbjct: 32 GGGGYGTGGGGGATGGQGYGTGG 54 Score = 28.3 bits (60), Expect = 7.8 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = -1 Query: 941 GWGGGXXXVXGXXGXGGXXGXGXGXXSRENXGEGXXXXXGGXGXGGEGG 795 G GGG G G G G G G+G G G G GG Sbjct: 37 GTGGGGGATGGQGYGTGGQGYGSGGQGYGTGGQGYGTGTGTEGFGTGGG 85 >At5g62440.1 68418.m07837 expressed protein Length = 202 Score = 32.7 bits (71), Expect = 0.36 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -2 Query: 937 GGGXXGGXGGGXG--GGXGGGXGG 872 G G GG GGG G GG GGG GG Sbjct: 175 GNGHGGGRGGGGGRRGGRGGGRGG 198 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 G G G G G GGG GG GGG Sbjct: 172 GANGNGHGGGRGGGGGRRGGRGGG 195 Score = 29.1 bits (62), Expect = 4.5 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 940 GGGGXXGGXGGGXGG 896 GGGG GG GGG GG Sbjct: 184 GGGGRRGGRGGGRGG 198 >At5g14540.1 68418.m01704 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 547 Score = 32.7 bits (71), Expect = 0.36 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPP 938 PP P PP PP PP PPP Sbjct: 356 PPYPQQSYPPNPPRQPPSHPPP 377 Score = 29.1 bits (62), Expect = 4.5 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 8/45 (17%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPX------PPPXPPPXPPXXP--PPP 941 P S P PP PPP PP PPP P P PPP Sbjct: 299 PPSGQSQPPPTIQPPYQPPPPTQSLHQPPYQPPPQQPQYPQQPPP 343 >At5g07650.1 68418.m00876 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 815 Score = 32.7 bits (71), Expect = 0.36 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +3 Query: 840 SLSXVLPGXXPPPXPPPXPPPXPPPXPP 923 +++ +PG PP PPP PPP P PP Sbjct: 11 AMAAPMPGRVPP--PPPRPPPMPRRLPP 36 Score = 32.3 bits (70), Expect = 0.48 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPP 935 P P P PPP PPP P PP Sbjct: 15 PMPGRVPPPPPRPPPMPRRLPP 36 >At4g16830.1 68417.m02540 nuclear RNA-binding protein (RGGA) identical to nuclear RNA binding protein GI:6492264 from [Arabidopsis thaliana] Length = 355 Score = 32.7 bits (71), Expect = 0.36 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG-XXPGRTXERXR 836 GGGG G G GGG GGG GG G ER R Sbjct: 113 GGGGAPRGSFRGEGGGPGGGRRGGFSNEGGDGERPR 148 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 7/40 (17%) Frame = -2 Query: 940 GGGGXXG---GXGGGXGGGXGGG----XGGGXXPGRTXER 842 GGG G G GGG GGG GG G G P R ER Sbjct: 114 GGGAPRGSFRGEGGGPGGGRRGGFSNEGGDGERPRRAFER 153 >At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 32.7 bits (71), Expect = 0.36 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GG G Sbjct: 574 GGGGGGGGSDYYGGGGYGGGGYGGAPSG 601 Score = 32.7 bits (71), Expect = 0.36 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRT 851 GGG G GG GGG GG GG G T Sbjct: 579 GGGSDYYGGGGYGGGGYGGAPSGGYGAGVT 608 Score = 31.5 bits (68), Expect = 0.84 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 3/31 (9%) Frame = -2 Query: 940 GGGGXXGGXGG---GXGGGXGGGXGGGXXPG 857 GGGG GG G G GG GGG GG G Sbjct: 572 GGGGGGGGGGSDYYGGGGYGGGGYGGAPSGG 602 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 4/31 (12%) Frame = -2 Query: 937 GGGXXGGXGGGXGGG----XGGGXGGGXXPG 857 G GG GGG GGG GGG GGG G Sbjct: 567 GSYSRGGGGGGGGGGSDYYGGGGYGGGGYGG 597 Score = 29.5 bits (63), Expect = 3.4 Identities = 17/30 (56%), Positives = 17/30 (56%), Gaps = 6/30 (20%) Frame = -2 Query: 940 GGGGXXGGX----GG--GXGGGXGGGXGGG 869 GGGG GG GG G G G GGG GGG Sbjct: 62 GGGGASGGGYRNDGGRTGYGYGAGGGGGGG 91 Score = 28.7 bits (61), Expect = 5.9 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 4/39 (10%) Frame = -2 Query: 940 GGG----GXXGGXGGGXGGGXGGGXGGGXXPGRTXERXR 836 GGG G G G G GGG GGG G G R R Sbjct: 68 GGGYRNDGGRTGYGYGAGGGGGGGGGWNNRSGGWDRRER 106 >At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 32.7 bits (71), Expect = 0.36 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GGG GGG GG G Sbjct: 574 GGGGGGGGSDYYGGGGYGGGGYGGAPSG 601 Score = 32.7 bits (71), Expect = 0.36 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRT 851 GGG G GG GGG GG GG G T Sbjct: 579 GGGSDYYGGGGYGGGGYGGAPSGGYGAGVT 608 Score = 31.5 bits (68), Expect = 0.84 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 3/31 (9%) Frame = -2 Query: 940 GGGGXXGGXGG---GXGGGXGGGXGGGXXPG 857 GGGG GG G G GG GGG GG G Sbjct: 572 GGGGGGGGGGSDYYGGGGYGGGGYGGAPSGG 602 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 4/31 (12%) Frame = -2 Query: 937 GGGXXGGXGGGXGGG----XGGGXGGGXXPG 857 G GG GGG GGG GGG GGG G Sbjct: 567 GSYSRGGGGGGGGGGSDYYGGGGYGGGGYGG 597 Score = 29.5 bits (63), Expect = 3.4 Identities = 17/30 (56%), Positives = 17/30 (56%), Gaps = 6/30 (20%) Frame = -2 Query: 940 GGGGXXGGX----GG--GXGGGXGGGXGGG 869 GGGG GG GG G G G GGG GGG Sbjct: 62 GGGGASGGGYRNDGGRTGYGYGAGGGGGGG 91 Score = 28.7 bits (61), Expect = 5.9 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 4/39 (10%) Frame = -2 Query: 940 GGG----GXXGGXGGGXGGGXGGGXGGGXXPGRTXERXR 836 GGG G G G G GGG GGG G G R R Sbjct: 68 GGGYRNDGGRTGYGYGAGGGGGGGGGWNNRSGGWDRRER 106 >At3g45540.1 68416.m04918 zinc finger (C3HC4-type RING finger) family protein contains a Prosite:PS00518 Zinc finger, C3HC4 type (RING finger), signature Length = 348 Score = 32.7 bits (71), Expect = 0.36 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXP 920 G PP PPP PPP PPP P Sbjct: 302 GHGLPPRPPP-PPPSPPPTP 320 Score = 30.3 bits (65), Expect = 1.9 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 897 PPXPPPXPPXXPPPP 941 PP PPP PP PP P Sbjct: 306 PPRPPPPPPSPPPTP 320 Score = 29.1 bits (62), Expect = 4.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 885 PPXPPPXPPPXPPXXP 932 PP PPP PPP PP P Sbjct: 306 PPRPPP-PPPSPPPTP 320 >At2g04190.1 68415.m00404 meprin and TRAF homology domain-containing protein / MATH domain-containing protein similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 411 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 GGG G GG GGG G G GGG Sbjct: 24 GGGGGGPAFGGRGGGPGRGYGGG 46 Score = 31.9 bits (69), Expect = 0.63 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGG 881 GGG GG GGG G G GGG Sbjct: 27 GGGPAFGGRGGGPGRGYGGG 46 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GG G G GGG G G G G GG Sbjct: 70 GGAGPGPGYGGGGGHGPGYGGGG 92 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGG 869 GG G G G GGG G G GGG Sbjct: 70 GGAGPGPGYGGGGGHGPGYGGG 91 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGG G GGG G G G GGG Sbjct: 81 GGGHGPGYGGGGDGRGYGSETGGG 104 >At1g35880.1 68414.m04457 hypothetical protein Length = 222 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GG GGG GG G Sbjct: 165 GGGGNLGGGGGKFGGGGDGGFWRG 188 Score = 31.5 bits (68), Expect = 0.84 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG GG GG GGG GG G Sbjct: 163 GGGG--GGNLGGGGGKFGGGGDGGFWRG 188 >At5g60850.1 68418.m07633 Dof-type zinc finger domain-containing protein similar to zinc finger protein OBP4 gi:5059396 from [Arabidopsis thaliana]; EMBL:AF155817 Length = 307 Score = 32.3 bits (70), Expect = 0.48 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 G GG GG G GGG GGG GG Sbjct: 11 GVGGGGGGGGRFFGGGIGGGGGG 33 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 922 GGXGGGXGGGXGGGXGGG 869 GG GGG G GGG GGG Sbjct: 13 GGGGGGGGRFFGGGIGGG 30 >At5g04290.1 68418.m00422 KOW domain-containing transcription factor family protein Length = 1493 Score = 32.3 bits (70), Expect = 0.48 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPGR 854 GG G GGG G G GGG G G G+ Sbjct: 398 GGKGEGSGGGKGEGSGGGKGEGSRGGK 424 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 GGG G GGG G G GG G G Sbjct: 405 GGGKGEGSGGGKGEGSRGGKGEG 427 >At4g29240.1 68417.m04182 leucine-rich repeat family protein / extensin family protein contains Pfam PF00560: Leucine Rich Repeat domains; similar to leucine-rich repeat/extensin 1 (GI:13809918) [Arabidopsis thaliana] Length = 415 Score = 32.3 bits (70), Expect = 0.48 Identities = 16/28 (57%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGG-GXGGGXXPG 857 GGG G GGG GGG GG GGG G Sbjct: 33 GGGVGVGIGGGGGGGGGGVWVGGGYNNG 60 Score = 31.9 bits (69), Expect = 0.63 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGG 872 G GG G G GGG GGG GG Sbjct: 31 GVGGGVGVGIGGGGGGGGGG 50 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 919 GXGGGXGGGXGGGXGGG 869 G GGG G G GGG GGG Sbjct: 31 GVGGGVGVGIGGGGGGG 47 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GGGG GG G GGG G PG Sbjct: 41 GGGGGGGGGGVWVGGGYNNGGNRNAVPG 68 >At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibrillarin 2 GI:9965655 from [Arabidopsis thaliana] Length = 320 Score = 32.3 bits (70), Expect = 0.48 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 5/42 (11%) Frame = -2 Query: 940 GGGGXXGGXGG-GXGGGXG----GGXGGGXXPGRTXERXRXG 830 G GG GG GG G GGG G GG G G P R R G Sbjct: 26 GDGGFSGGRGGGGRGGGRGFSDRGGRGRGRGPPRGGARGGRG 67 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGR 854 GG G G GG GGG GGG G GR Sbjct: 23 GGRGDGGFSGGRGGGGRGGGRGFSDRGGR 51 Score = 31.5 bits (68), Expect = 0.84 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -2 Query: 937 GGGXXGGXGGGXG-GGXGGGXGGGXXPGRTXERXRXG 830 GG GG GG G GG GG GGG G R G Sbjct: 14 GGRGRGGYSGGRGDGGFSGGRGGGGRGGGRGFSDRGG 50 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 2/26 (7%) Frame = -2 Query: 940 GGGGXXGGXGGGX--GGGXGGGXGGG 869 G GG GG G G GG GGG GGG Sbjct: 17 GRGGYSGGRGDGGFSGGRGGGGRGGG 42 >At3g46270.1 68416.m05008 receptor protein kinase-related contains weak similarity to light repressible receptor protein kinase (GI:1321686) [Arabidopsis thaliana] Length = 470 Score = 32.3 bits (70), Expect = 0.48 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 934 GGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GGG GG GG GGG G Sbjct: 360 GGSGGKSGGGDNGGGGGQSGGGNNGG 385 Score = 31.5 bits (68), Expect = 0.84 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 GG GG GG GG GGG GG Sbjct: 363 GGKSGGGDNGGGGGQSGGGNNGG 385 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 G GG GG G GGG GG G Sbjct: 361 GSGGKSGGGDNGGGGGQSGGGNNG 384 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 931 GXXGGXGGGXGGGXGGGXGGGXXPGRT 851 G GG GG G GGG GG G T Sbjct: 360 GGSGGKSGGGDNGGGGGQSGGGNNGGT 386 >At1g47660.1 68414.m05295 hypothetical protein Length = 275 Score = 32.3 bits (70), Expect = 0.48 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPP 938 P PPP P PPP P PPP Sbjct: 34 PTTPPPARPTTPPPVWPTTPPP 55 Score = 29.5 bits (63), Expect = 3.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPP 938 P PP P PPP P PPP Sbjct: 26 PRAAPPARPTTPPPARPTTPPP 47 Score = 28.3 bits (60), Expect = 7.8 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 PPP P PPP P PP P Sbjct: 37 PPPARPTTPPPVWPTTPPPAGAP 59 >At1g19950.1 68414.m02500 abscisic acid-responsive HVA22 family protein weak similarity to SP|Q00765 Polyposis locus protein 1 (TB2 protein) {Homo sapiens}; contains Pfam profile PF03134: TB2/DP1, HVA22 family Length = 315 Score = 32.3 bits (70), Expect = 0.48 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXP 920 PP PPP PPP PPP P Sbjct: 234 PPGPPP-PPPPPPPSP 248 Score = 31.1 bits (67), Expect = 1.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +3 Query: 885 PPXPPPXPPPXPP 923 PP PPP PPP PP Sbjct: 234 PPGPPPPPPPPPP 246 Score = 30.3 bits (65), Expect = 1.9 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 897 PPXPPPXPPXXPPPP 941 PP PPP PP PP P Sbjct: 234 PPGPPPPPPPPPPSP 248 Score = 29.9 bits (64), Expect = 2.6 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 870 PPPXPPPXPPPXPPP 914 PP PPP PPP P P Sbjct: 234 PPGPPPPPPPPPPSP 248 Score = 28.7 bits (61), Expect = 5.9 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 L+ + P PPP PPP P P P P Sbjct: 229 LTTLTPPGPPPPPPPPPPSPTTAAKRNADPAQP 261 >At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein similar to SP|Q15459 Splicing factor 3 subunit 1 (Spliceosome associated protein 114) {Homo sapiens}; contains Pfam profiles PF00240: Ubiquitin family, PF01805: Surp module Length = 785 Score = 32.3 bits (70), Expect = 0.48 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PPP P PP P P Sbjct: 654 PPPMPGMAPPPPPEEAPPPLPEEP 677 Score = 29.9 bits (64), Expect = 2.6 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXP 908 +PG PPP P PPP P Sbjct: 657 MPGMAPPPPPEEAPPPLP 674 Score = 29.1 bits (62), Expect = 4.5 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPPXP 920 P ++ + P P PPP P PPP P Sbjct: 645 PPSAMGMMQPPPMPGMAPPPPPEEAPPPLP 674 >At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 554 Score = 32.3 bits (70), Expect = 0.48 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 9/37 (24%) Frame = +3 Query: 858 PGXXPPPXPPPXP---------PPXPPPXPPXXPPPP 941 PG P PPP P PP PPP PPPP Sbjct: 227 PGRAALPPPPPLPMAVRKGVAAPPLPPPGTAALPPPP 263 Score = 28.3 bits (60), Expect = 7.8 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXP 920 V G PP PPP PPP P Sbjct: 242 VRKGVAAPPLPPPGTAALPPPPP 264 >At5g48360.1 68418.m05975 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 782 Score = 31.9 bits (69), Expect = 0.63 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +3 Query: 843 LSXVLPGXXPPPXPPPXPPPXPPPXPP 923 LS + P P PP PPP PP PP Sbjct: 45 LSPISPPFFPLESSPPSPPPPLPPTPP 71 >At4g14750.1 68417.m02270 calmodulin-binding family protein contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 387 Score = 31.9 bits (69), Expect = 0.63 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPP 914 P + + L PPP PPP PPP P Sbjct: 55 PPPACAITLKDSPPPPPPPPPPPPLQQP 82 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PPP PP PPPP Sbjct: 55 PPPACAITLKDSPPPPPPPPPPPP 78 Score = 29.9 bits (64), Expect = 2.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 888 PXPPPXPPPXPPXXPP 935 P PPP PPP PP P Sbjct: 67 PPPPPPPPPPPPLQQP 82 Score = 29.1 bits (62), Expect = 4.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXP 920 PP PPP PPP P P Sbjct: 67 PPPPPPPPPPPPLQQP 82 Score = 29.1 bits (62), Expect = 4.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPP 923 P PPP PPP PP P Sbjct: 67 PPPPPPPPPPPPLQQP 82 Score = 29.1 bits (62), Expect = 4.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 885 PPXPPPXPPPXPPXXP 932 PP PPP PPP P P Sbjct: 67 PPPPPPPPPPPPLQQP 82 Score = 28.3 bits (60), Expect = 7.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP PP PP PPPP Sbjct: 54 PPPPACAITLKDSPPPPPPPPPPP 77 >At3g50130.1 68416.m05480 expressed protein ; expression supported by MPSS Length = 564 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 4/28 (14%) Frame = +3 Query: 870 PPPXPPPXPP----PXPPPXPPXXPPPP 941 PPP PPP P P PPP P PP Sbjct: 9 PPPPPPPPPSFRSIPRPPPPPSFRSIPP 36 >At3g44950.1 68416.m04843 glycine-rich protein Length = 72 Score = 31.9 bits (69), Expect = 0.63 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGG 872 GGG G GG GGG GG GG Sbjct: 47 GGGGGGDDGGDVGGGDDGGGGG 68 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 922 GGXGGGXGGGXGGGXGGGXXPG 857 G GGG GG GG GGG G Sbjct: 44 GNSGGGGGGDDGGDVGGGDDGG 65 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGG 881 GGGG GG GG G GGG Sbjct: 49 GGGGDDGGDVGGGDDGGGGG 68 Score = 28.7 bits (61), Expect = 5.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GGGG GG GG GG G GGG Sbjct: 47 GGGG--GGDDGGDVGGGDDGGGGG 68 >At3g22330.1 68416.m02820 DEAD box RNA helicase, putative similar to RNA helicases GI:3775995, GI:3775987 from [Arabidopsis thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 616 Score = 31.9 bits (69), Expect = 0.63 Identities = 16/36 (44%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = -2 Query: 934 GGXXGGXG-GGXGGGXGGGXGGGXXPGRTXERXRXG 830 GG GG G GG GG GGG GG + + R G Sbjct: 510 GGRSGGGGYGGSSGGYGGGRSGGSSNRYSGDSDRSG 545 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGG 881 GGG GG GG GGG GG Sbjct: 514 GGGGYGGSSGGYGGGRSGG 532 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = -2 Query: 934 GGXXGGXGGGXG-GGXGGGXGGGXXPG 857 G GG GG G GG GG GGG G Sbjct: 506 GSSFGGRSGGGGYGGSSGGYGGGRSGG 532 >At3g04640.1 68416.m00497 glycine-rich protein predicted proteins, Arabidopsis thaliana Length = 159 Score = 31.9 bits (69), Expect = 0.63 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GGGG G GG GGG G GG G R G Sbjct: 73 GGGGGGRGGGGFGGGGRSFGGGGSSSRGGGGSSSRGG 109 Score = 31.5 bits (68), Expect = 0.84 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXRXG 830 GGGG GG GG G GGG G + R G Sbjct: 75 GGGGRGGGGFGGGGRSFGGGGSSSRGGGGSSSRGGGG 111 Score = 28.3 bits (60), Expect = 7.8 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 7/44 (15%) Frame = -2 Query: 940 GGGGXXGGXGGGXGG---GXGG----GXGGGXXPGRTXERXRXG 830 GGGG GG G G GG G GG G GG G R G Sbjct: 74 GGGGGRGGGGFGGGGRSFGGGGSSSRGGGGSSSRGGGGSSSRGG 117 Score = 28.3 bits (60), Expect = 7.8 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Frame = -2 Query: 940 GGGGXXGGXGGGX---GGGXGGGXGGGXXP 860 GGGG GGG GGG GGG P Sbjct: 92 GGGGSSSRGGGGSSSRGGGGSSSRGGGLRP 121 >At2g24590.1 68415.m02936 splicing factor, putative similar to to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352 Length = 196 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGG 869 GGG GG GGG GGG GG GG Sbjct: 73 GGG--GGRGGGRGGGDGGRGRGG 93 Score = 31.9 bits (69), Expect = 0.63 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGG 881 GGGG GG GGG GG GG Sbjct: 74 GGGGRGGGRGGGDGGRGRGG 93 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 31.9 bits (69), Expect = 0.63 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGG 872 GGGG GGG G G GG GG Sbjct: 191 GGGGYGSNFGGGGGYGVAGGVGG 213 Score = 28.3 bits (60), Expect = 7.8 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 3/26 (11%) Frame = -2 Query: 940 GGGGXXGGXGGGXG---GGXGGGXGG 872 G GG G GG G GG GGG GG Sbjct: 123 GPGGGYGASDGGYGAPAGGYGGGAGG 148 >At1g52030.2 68414.m05870 myrosinase-binding protein, putative (F-ATMBP) identical to SP|Q9SAV1 Myrosinase binding protein-like f-AtMBP [Arabidopsis thaliana]; similar to myrosinase binding protein GI:1711295 from [Brassica napus]; contains Pfam PF01419: Jacalin-like lectin domain; identical to cDNA myrosinase-binding protein-like protein (MBP1.2) GI:6760446 Length = 642 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXP-PXXPPPP 941 LP P P P P P P P P P P P P Sbjct: 292 LPAPTPAPAPAPAPAPAPAPSPAPASAPVP 321 Score = 31.5 bits (68), Expect = 0.84 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P P P P P P P P P PP Sbjct: 307 PAPAPSPAPASAPVPAPAPTPAPAPAPP 334 Score = 29.5 bits (63), Expect = 3.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 P P P P P P P P P P P Sbjct: 291 PLPAPTPAPAPAPAPAPAPAPSP 313 Score = 29.1 bits (62), Expect = 4.5 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P P P P P P P P Sbjct: 297 PAPAPAPAPAPAPAPSPAPASAPVPAP 323 Score = 29.1 bits (62), Expect = 4.5 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P P P P P P P P Sbjct: 301 PAPAPAPAPAPSPAPASAPVPAPAPTP 327 Score = 28.7 bits (61), Expect = 5.9 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P P P P P P P P Sbjct: 299 PAPAPAPAPAPAPSPAPASAPVPAPAP 325 Score = 28.7 bits (61), Expect = 5.9 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P P P P P P P P Sbjct: 303 PAPAPAPAPSPAPASAPVPAPAPTPAP 329 Score = 28.3 bits (60), Expect = 7.8 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXP 932 P P P P P P P P P P P Sbjct: 291 PLPAPTPAPAPAPAPAPAPAPSPAP 315 >At1g52030.1 68414.m05869 myrosinase-binding protein, putative (F-ATMBP) identical to SP|Q9SAV1 Myrosinase binding protein-like f-AtMBP [Arabidopsis thaliana]; similar to myrosinase binding protein GI:1711295 from [Brassica napus]; contains Pfam PF01419: Jacalin-like lectin domain; identical to cDNA myrosinase-binding protein-like protein (MBP1.2) GI:6760446 Length = 642 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXPPPXP-PXXPPPP 941 LP P P P P P P P P P P P P Sbjct: 292 LPAPTPAPAPAPAPAPAPAPSPAPASAPVP 321 Score = 31.5 bits (68), Expect = 0.84 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P P P P P P P P P PP Sbjct: 307 PAPAPSPAPASAPVPAPAPTPAPAPAPP 334 Score = 29.5 bits (63), Expect = 3.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPP 938 P P P P P P P P P P P Sbjct: 291 PLPAPTPAPAPAPAPAPAPAPSP 313 Score = 29.1 bits (62), Expect = 4.5 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P P P P P P P P Sbjct: 297 PAPAPAPAPAPAPAPSPAPASAPVPAP 323 Score = 29.1 bits (62), Expect = 4.5 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P P P P P P P P Sbjct: 301 PAPAPAPAPAPSPAPASAPVPAPAPTP 327 Score = 28.7 bits (61), Expect = 5.9 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P P P P P P P P Sbjct: 299 PAPAPAPAPAPAPSPAPASAPVPAPAP 325 Score = 28.7 bits (61), Expect = 5.9 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPP 938 P P P P P P P P P P P Sbjct: 303 PAPAPAPAPSPAPASAPVPAPAPTPAP 329 Score = 28.3 bits (60), Expect = 7.8 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXP 932 P P P P P P P P P P P Sbjct: 291 PLPAPTPAPAPAPAPAPAPAPSPAP 315 >At1g31750.1 68414.m03895 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 176 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 PG PPP PPP P P PPPP Sbjct: 26 PGAYPPPPQGAYPPPGGYP-PQGYPPPP 52 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = +3 Query: 861 GXXPPPX--PPPXPPPXPPPXPPXXPPPP 941 G PPP PP PP P PP PPP Sbjct: 35 GAYPPPGGYPPQGYPPPPHGYPPAAYPPP 63 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Frame = +3 Query: 858 PGXXPPPXPPPXP---PPXPPPXPPXXPPP 938 PG PP PP P PP P PP PP Sbjct: 40 PGGYPPQGYPPPPHGYPPAAYPPPPGAYPP 69 >At1g04660.1 68414.m00463 glycine-rich protein Length = 212 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXPG 857 GG G GG GGG GG G G GG G Sbjct: 167 GGLGGLGGAGGGLGGVGGLGKAGGIGVG 194 Score = 31.5 bits (68), Expect = 0.84 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGG 869 GG G GG G G G GGG GGG Sbjct: 177 GGLGGVGGLGKAGGIGVGGGIGGG 200 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -2 Query: 940 GGGGXXGGXGG-GXGGGXGGGXG 875 GG G G GG G GGG GGG G Sbjct: 180 GGVGGLGKAGGIGVGGGIGGGHG 202 >At5g62190.1 68418.m07807 DEAD box RNA helicase (PRH75) nearly identical to RNA helicase [Arabidopsis thaliana] GI:1488521; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 671 Score = 31.5 bits (68), Expect = 0.84 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = -2 Query: 940 GGGGXXGGXGGGXGG--GXGGGXGGGXXPGR 854 GGGG GGG G G GGG G G GR Sbjct: 637 GGGGRGNRFGGGGGNRFGGGGGRGRGGSGGR 667 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG 875 GGGG G GGG G G GG G Sbjct: 647 GGGGNRFGGGGGRGRGGSGGRG 668 Score = 28.7 bits (61), Expect = 5.9 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = -2 Query: 940 GGGGXXGGXGGGX--GGGXGGGXGGGXXPGR 854 GG G G GGG GGG G G GG G+ Sbjct: 639 GGRGNRFGGGGGNRFGGGGGRGRGGSGGRGQ 669 >At5g57290.1 68418.m07157 60S acidic ribosomal protein P3 (RPP3B) Length = 120 Score = 31.5 bits (68), Expect = 0.84 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRTXERXR 836 GGG GG G GG GG GGG T E + Sbjct: 70 GGGGGGGFAAG-GGAAAGGGGGGEAAAATKEEEK 102 Score = 28.7 bits (61), Expect = 5.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGG 881 GGGG GG GG GGG Sbjct: 72 GGGGGFAAGGGAAAGGGGGG 91 >At5g15870.1 68418.m01857 glycosyl hydrolase family 81 protein similar to beta-glucan-elicitor receptor GI:1752734 from [Glycine max] Length = 745 Score = 31.5 bits (68), Expect = 0.84 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 P PP PPP P P PP PPP Sbjct: 20 PKNRPPSPPP-PLPLPPSPSPPP 41 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPP 935 P P PP PPP P P P PP Sbjct: 16 PFKKPKNRPPSPPPPLPLPPSPSPPP 41 >At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identical to gi_3883126_gb_AAC77826 Length = 135 Score = 31.5 bits (68), Expect = 0.84 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPPPXPPXXPPPP 941 P P PPP PP PP PPP Sbjct: 24 PAPTPTATPPPATPPPVATPPPVATPPP 51 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPX--PPPXPPPXPPPXPPXXPPPP 941 P PPP PPP P P P PPP Sbjct: 33 PPATPPPVATPPPVATPPPAATPAPATPPP 62 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 3/30 (10%) Frame = +3 Query: 858 PGXXPPPXPPP---XPPPXPPPXPPXXPPP 938 P PPP PP PPP P P P P Sbjct: 28 PTATPPPATPPPVATPPPVATPPPAATPAP 57 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 2/30 (6%) Frame = +3 Query: 858 PGXXPPPX--PPPXPPPXPPPXPPXXPPPP 941 P PPP PPP P P PP P P Sbjct: 39 PVATPPPVATPPPAATPAPATPPPAATPAP 68 >At4g34440.1 68417.m04894 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 670 Score = 31.5 bits (68), Expect = 0.84 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP+PP PP P P S P P P P P T P Sbjct: 32 PPTPPSSPPPSSISAPPPDISASFSPPPAP--PTQETSPPTSPSSSP 76 >At4g34150.1 68417.m04846 C2 domain-containing protein similar to calcium-dependent protein kinase [Dunaliella tertiolecta] GI:6644464; contains Pfam profile PF00168: C2 domain Length = 247 Score = 31.5 bits (68), Expect = 0.84 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 3/31 (9%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXP---PPXPPXXPPPP 941 P PP P PPP PP P PPPP Sbjct: 186 PASGYPPQPSAYPPPSTSGYPPIPSAYPPPP 216 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/30 (43%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +3 Query: 855 LPGXXPPPXPPPXPPPXP-PPXPPXXPPPP 941 +P PPP P PP P PP P P P Sbjct: 208 IPSAYPPPPPSSAYPPQPYPPQPSYYPQGP 237 Score = 28.7 bits (61), Expect = 5.9 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 1/56 (1%) Frame = +1 Query: 772 PXSXFXWXPPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPP-XPXXPXTXXXPPP 936 P + PPS PP P P S P P P P P P PPP Sbjct: 191 PPQPSAYPPPSTSG-YPPIPSAYPPPPPSSAYPPQPYPPQPSYYPQGPYPGQYPPP 245 Score = 28.7 bits (61), Expect = 5.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXPPXXPPPP 941 PP P PPP P P P PP Sbjct: 206 PPIPSAYPPPPPSSAYPPQPYPP 228 >At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-like SR protein (SRZ22) identical to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352, 9G8-like SR protein [Arabidopsis thaliana] GI:3435094; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) and PF00098: Zinc knuckle; identical to cDNA 9G8-like SR protein (SRZ22) GI:3435093 Length = 200 Score = 31.5 bits (68), Expect = 0.84 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXG 875 GGG GG GG GGG GG G Sbjct: 76 GGGGRGGDRGGGGGGRGGRGG 96 >At4g17800.1 68417.m02656 DNA-binding protein-related contains Pfam domain PF03479: Domain of unknown function (DUF296), found in AT-hook motifs Pfam:PF02178 Length = 292 Score = 31.5 bits (68), Expect = 0.84 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -3 Query: 822 GGGGXGGGGXPXEXAXRGGGGX*XXNLP 739 GGG GGG E A GGGG NLP Sbjct: 241 GGGSNGGGNLFPEVAAGGGGGLPFFNLP 268 Score = 28.7 bits (61), Expect = 5.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 919 GXGGGXGGGXGGGXGGGXXPGR 854 G G G GG GG GGG GR Sbjct: 61 GGGSGSSGGGGGHGGGGDVVGR 82 >At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At3g25690, At5g61090 [Arabidopsis thaliana] Length = 681 Score = 31.5 bits (68), Expect = 0.84 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 885 PPXPPPXPPPXPPXXPPPP 941 PP PPP P P PPPP Sbjct: 325 PPPPPPSPEHKAPAPPPPP 343 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/20 (60%), Positives = 12/20 (60%), Gaps = 3/20 (15%) Frame = +3 Query: 873 PPXPPPXPP---PXPPPXPP 923 PP PPP P P PPP PP Sbjct: 325 PPPPPPSPEHKAPAPPPPPP 344 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPPP 941 P PPP P P PP PPPP Sbjct: 325 PPPPPPSPEHKAPAPP--PPPP 344 >At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 646 Score = 31.5 bits (68), Expect = 0.84 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 3/30 (10%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXG---GGXXP 860 GGG G GGG GG GGG G GG P Sbjct: 570 GGGADYYGGGGGYGGVPGGGYGAMPGGYGP 599 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGGXGGGXGGGXXP 860 G G GG G GGG G GGG P Sbjct: 589 GYGAMPGGYGPVPGGGYGNVPGGGYAP 615 >At3g11402.1 68416.m01388 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 708 Score = 31.5 bits (68), Expect = 0.84 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 888 PXPPPXPPPXPPXXPPPP 941 P P PPP PP PPPP Sbjct: 60 PLPRHYPPPPPPLPPPPP 77 Score = 28.7 bits (61), Expect = 5.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 873 PPXPPPXPPPXPPPXP 920 P PP PPP PPP P Sbjct: 62 PRHYPPPPPPLPPPPP 77 Score = 28.3 bits (60), Expect = 7.8 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 21/45 (46%) Frame = +3 Query: 870 PPPXPPPXPPPXP---------------------PPXPPXXPPPP 941 PPP PPP PP P PP PP PPPP Sbjct: 32 PPPPPPPPPPVLPHIRSRKKMDIKEVHLPLPRHYPPPPPPLPPPP 76 >At3g07195.1 68416.m00858 proline-rich family protein Length = 225 Score = 31.5 bits (68), Expect = 0.84 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 2/26 (7%) Frame = -2 Query: 940 GGGGXXGGX--GGGXGGGXGGGXGGG 869 GGGG GG G G GG GG GGG Sbjct: 95 GGGGSGGGGRSGSGSAGGLYGGYGGG 120 Score = 28.7 bits (61), Expect = 5.9 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = -2 Query: 940 GGGGXXG-GXGGGXGGGXGGGXGG 872 GGGG G G GG GG GGG G Sbjct: 100 GGGGRSGSGSAGGLYGGYGGGSVG 123 >At1g63600.1 68414.m07189 protein kinase-related low similarity to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam profile: PF01657 Domain of unknown function DUF26 Length = 302 Score = 31.5 bits (68), Expect = 0.84 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPPXXPPPP 941 PPP P PPP P P P PP Sbjct: 256 PPPPYPSPPPPSSPLFSPLLPSPP 279 >At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putative similar to glycine-rich RNA-binding protein from {Sorghum bicolor} SP|Q99070, GI:1778373 from [Pisum sativum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 155 Score = 31.5 bits (68), Expect = 0.84 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = -2 Query: 940 GGGGXXGGXG--GGXGGGXGGGXGGGXXPG 857 GGGG GG GG GGG GG GG G Sbjct: 115 GGGGGGGGFARRGGYGGGRGGYARGGFGRG 144 >At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 31.5 bits (68), Expect = 0.84 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 913 GGGXGGGXGGGXGGGXXPGRTXE 845 GGG GGG G G GG P R E Sbjct: 96 GGGRGGGRGRGDGGSRGPSRRSE 118 >At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 285 Score = 31.5 bits (68), Expect = 0.84 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 913 GGGXGGGXGGGXGGGXXPGRTXE 845 GGG GGG G G GG P R E Sbjct: 96 GGGRGGGRGRGDGGSRGPSRRSE 118 >At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 31.5 bits (68), Expect = 0.84 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 913 GGGXGGGXGGGXGGGXXPGRTXE 845 GGG GGG G G GG P R E Sbjct: 96 GGGRGGGRGRGDGGSRGPSRRSE 118 >At2g41260.2 68415.m05096 glycine-rich protein / late embryogenesis abundant protein (M17) identical to late-embryogenesis abundant M17 protein GI:3342551 from [Arabidopsis thaliana] Length = 280 Score = 26.6 bits (56), Expect(2) = 0.87 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 922 GGXGGGXGGGXGGGXGG 872 GG GGG GG GGG GG Sbjct: 118 GGRGGG--GGGGGGRGG 132 Score = 26.6 bits (56), Expect(2) = 0.87 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 922 GGXGGGXGGGXGGGXGG 872 GG GGG GG GGG GG Sbjct: 173 GGRGGG--GGGGGGRGG 187 Score = 23.4 bits (48), Expect(2) = 0.87 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -2 Query: 898 GGXGGGXGGGXXPG 857 GG GGG GGG G Sbjct: 173 GGRGGGGGGGGGRG 186 Score = 23.4 bits (48), Expect(2) = 0.87 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -2 Query: 898 GGXGGGXGGGXXPG 857 GG GGG GGG G Sbjct: 228 GGRGGGGGGGGGRG 241 >At2g41260.1 68415.m05095 glycine-rich protein / late embryogenesis abundant protein (M17) identical to late-embryogenesis abundant M17 protein GI:3342551 from [Arabidopsis thaliana] Length = 225 Score = 26.6 bits (56), Expect(2) = 0.89 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 922 GGXGGGXGGGXGGGXGG 872 GG GGG GG GGG GG Sbjct: 118 GGRGGG--GGGGGGRGG 132 Score = 23.4 bits (48), Expect(2) = 0.89 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -2 Query: 898 GGXGGGXGGGXXPG 857 GG GGG GGG G Sbjct: 173 GGRGGGGGGGGGRG 186 >At1g27090.1 68414.m03302 glycine-rich protein Length = 420 Score = 25.8 bits (54), Expect(2) = 1.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -2 Query: 940 GGGGXXGGXGGGXGGG 893 GGGG G GG GGG Sbjct: 351 GGGGYQNGRGGRGGGG 366 Score = 23.8 bits (49), Expect(2) = 1.1 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -2 Query: 913 GGGXGGGXGGGXG 875 G G GGG GGG G Sbjct: 393 GRGRGGGGGGGNG 405 >At5g22790.1 68418.m02664 expressed protein Length = 433 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = -2 Query: 940 GGGGXXGGX--GGGXGGGXGGGXGGGXXPGRTXE 845 G GG G GGG GG GG GGG G E Sbjct: 101 GDGGDENGNNDGGGNGGNGDGGGGGGDGEGDDGE 134 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = -2 Query: 937 GGGXXGGXGGGXGGGXGGGXGGGXXPGRTXER 842 GGG G GG GGG G G G + E+ Sbjct: 112 GGGNGGNGDGGGGGGDGEGDDGEDEADKAEEK 143 >At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin family protein contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 401 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +3 Query: 855 LPGXXPPPXPPPXP--PPXPPPXPPXXPPPP 941 LP P PP P PP P PP PPPP Sbjct: 324 LPPIPTIPTLPPLPVLPPVPIVNPPSLPPPP 354 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPP-PXPPXXPPPP 941 V P PPP PP P P PP P P PP P Sbjct: 345 VNPPSLPPP-PPSFPVPLPPVPGLPGIPPVP 374 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXP-PPXPPXXPPPP 941 P S + P P P P PP P P PP PP P Sbjct: 265 PLNPPSIIPPNPLIPSIPTPTLPPNPLIPSPPSLPPIP 302 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/47 (29%), Positives = 16/47 (34%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 PP+P P P P+P P P P P P P P Sbjct: 273 PPNPLIPSIPTPTLPPNPLIPSPPSLPPIPLIPTPPTLPTIPLLPTP 319 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/40 (37%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXP---PPXPPPXPPPXPPXXPPPP 941 P ++ + P PP P PP PP PP P PP P Sbjct: 326 PIPTIPTLPPLPVLPPVPIVNPPSLPPPPPSFPVPLPPVP 365 Score = 28.3 bits (60), Expect = 7.8 Identities = 16/47 (34%), Positives = 18/47 (38%) Frame = +1 Query: 796 PPSPPXPXPPXXXXXPSPXFSLXXXPXPXPXXPPXPXXPXTXXXPPP 936 P P P PP P P ++ P P P PP P PPP Sbjct: 311 PTIPLLPTPPTPTLPPIP--TIPTLP-PLPVLPPVPIVNPPSLPPPP 354 >At5g13910.1 68418.m01627 AP2/EREBP-like transcription factor LEAFY PETIOLE, putative nearly identical to AP2/EREBP-like transcription factor LEAFY PETIOLE [Arabidopsis thaliana] GI:6942018 Length = 211 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 846 SXVLPGXXPPPXPPPXPPPXPP 911 S V P PPP PPP PP P Sbjct: 88 SIVSPDDPPPPPPPPAPPSNDP 109 Score = 30.3 bits (65), Expect = 1.9 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +3 Query: 831 PXRSLSXVLPGXXPPPXPPPXPPPXPPP 914 P S++ ++ PPP PPP PP P Sbjct: 82 PSSSVTSIVSPDDPPPPPPPPAPPSNDP 109 Score = 29.1 bits (62), Expect = 4.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 870 PPPXPPPXPPPXPPPXPP 923 P PPP PPP PP P Sbjct: 92 PDDPPPPPPPPAPPSNDP 109 Score = 29.1 bits (62), Expect = 4.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 882 PPPXPPPXPPPXPPXXPP 935 P PPP PPP PP P Sbjct: 92 PDDPPPPPPPPAPPSNDP 109 >At5g11550.1 68418.m01347 expressed protein Length = 314 Score = 31.1 bits (67), Expect = 1.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +3 Query: 870 PPPXPPPXPPPXP 908 PPP PPP PPP P Sbjct: 81 PPPHPPPPPPPLP 93 Score = 31.1 bits (67), Expect = 1.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +3 Query: 882 PPPXPPPXPPPXP 920 PPP PPP PPP P Sbjct: 81 PPPHPPPPPPPLP 93 Score = 28.3 bits (60), Expect = 7.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 858 PGXXPPPXPPPXPPPXPP 911 P PPP PP PPP P Sbjct: 76 PSTAPPPPHPPPPPPPLP 93 >At5g07150.1 68418.m00815 leucine-rich repeat family protein contains weak similarity to LRR receptor-like protein kinase [Nicotiana tabacum] gi|7672732|gb|AAF66615; contains Pfam PF00560 domain Leucine Rich Repeat Length = 553 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 876 PXPPPXPPPXPPPXPPXXPPP 938 P P P PPP P P PPP Sbjct: 191 PNPSPVPPPPAQPPPAQTPPP 211 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 861 GXXPPPXPPPXPPPXPPPXPPXXPPP 938 G PP P P P P PP PPP Sbjct: 180 GASPPTETQVIPNPSPVPPPPAQPPP 205 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 852 VLPGXXPPPXPPPXPPPXPPPXPPXXPPP 938 V+P P P PP PPP P P P Sbjct: 189 VIPNPSPVPPPPAQPPPAQTPPPQLSEVP 217 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,507,946 Number of Sequences: 28952 Number of extensions: 424895 Number of successful extensions: 24315 Number of sequences better than 10.0: 442 Number of HSP's better than 10.0 without gapping: 1811 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11429 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2256303936 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -