BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_J22 (975 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 36 0.049 04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 34 0.15 08_01_0059 - 394001-394708 33 0.26 07_03_1136 + 24218601-24218734,24218769-24219906 33 0.34 02_05_0686 - 30900748-30902167,30903442-30904742 33 0.34 01_01_0082 + 625198-625719 33 0.46 04_04_0965 - 29762388-29762564,29764272-29766361,29766567-297671... 32 0.60 01_06_1377 + 36764461-36765339 32 0.60 05_02_0122 - 6840840-6841307 31 1.1 05_01_0142 - 940421-940701,941262-941574 31 1.4 03_05_0630 + 26260159-26260272,26260520-26260894 31 1.4 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 31 1.8 06_01_0486 - 3455030-3455770 31 1.8 01_07_0021 - 40533864-40534583,40534779-40534814,40534909-405350... 30 2.4 01_06_0823 + 32234588-32234936,32236354-32237093,32237260-322373... 30 2.4 01_01_0070 - 542603-542686,542803-543441 30 2.4 12_02_0118 - 13869237-13869307,13869375-13869465,13870321-138704... 30 3.2 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 30 3.2 07_03_1710 - 28903614-28903673,28904982-28905146,28905453-289056... 30 3.2 04_03_0904 + 20717005-20718087 30 3.2 04_03_0660 + 18463011-18463322,18463424-18463516,18464500-184646... 30 3.2 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 30 3.2 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 30 3.2 03_01_0515 - 3864796-3865425 29 4.2 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 29 4.2 01_06_1678 - 39095986-39096205,39096400-39096477,39096578-390969... 29 4.2 01_06_0146 + 26969011-26969995,26970878-26970930 29 4.2 07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828,504... 29 5.6 07_01_0516 - 3850252-3852870 29 5.6 12_02_1174 - 26696869-26698191 29 7.4 12_02_0643 - 21461123-21461902 29 7.4 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 29 7.4 12_02_0299 - 17051570-17052474,17053542-17053755 28 9.8 09_04_0081 - 14400293-14400397,14400953-14401036,14401144-144012... 28 9.8 09_02_0543 + 10427321-10428315,10428440-10429154 28 9.8 06_03_0310 - 19453047-19453160,19453240-19453338,19453441-194535... 28 9.8 04_04_0183 - 23384290-23384783,23385064-23385139,23385291-23385296 28 9.8 03_05_0269 - 22545925-22546554,22546663-22547010,22547447-22547797 28 9.8 03_01_0023 + 198414-198968 28 9.8 02_03_0120 + 15463163-15465250 28 9.8 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 35.9 bits (79), Expect = 0.049 Identities = 26/101 (25%), Positives = 28/101 (27%) Frame = -2 Query: 626 PPPPXXXXXXXXXXXXXXXXGPXXPXVFFXGGXGRPPXXEXXPRXXXXPPRXXVFWXSPP 447 PPPP P P G PP PP + PP Sbjct: 1065 PPPPQRENTSVGIQGGIPPLPPPLPPTLGDYGVAPPPPSIGAGAPPPPPPPGGITGVPPP 1124 Query: 446 XGGXXXXGCXPPPXXAXPPXGGGCXPPXPXLGXXGGXXXXP 324 G PP P GG PP P +G GG P Sbjct: 1125 PPIGGLGGHQAPPAPPLPEGIGGVPPP-PPVGGLGGPPAPP 1164 Score = 30.7 bits (66), Expect = 1.8 Identities = 21/80 (26%), Positives = 24/80 (30%) Frame = +1 Query: 325 GXXXXPPXFPKXGXGGXHPPPXGGXAXSGGGXXPSXXXPPXGGEXQXTXXRGGXXXXRGX 504 G PP P G GG PP GG P GG G Sbjct: 1117 GITGVPPPPPIGGLGGHQAPPAPPLPEGIGGVPPPPPVGGLGGPPAPPPPAGFRGGTPPP 1176 Query: 505 HSXXGGRPXPPXKKTXGXXG 564 ++ G P PP + G G Sbjct: 1177 NAHGGVAPPPPPPRGHGGVG 1196 >04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 Length = 906 Score = 34.3 bits (75), Expect = 0.15 Identities = 28/104 (26%), Positives = 28/104 (26%), Gaps = 4/104 (3%) Frame = -2 Query: 623 PPPXXXXXXXXXXXXXXXXGPXXPXVFFXGGXGRPPXXEXXPRXXXXPPRXXVFWXSPPX 444 PPP P P G G PP P PP SP Sbjct: 287 PPPLPPSHHHHHGHHPPPPHPLPPGAGAGAGTGAPPPPPAHPAAPAPPPPAP----SPSA 342 Query: 443 GGXXXXGCXPPPXXAX----PPXGGGCXPPXPXLGXXGGXXXXP 324 G PPP A PP G PP P GG P Sbjct: 343 AGAGSGPPPPPPPAAPAAPRPPGPGPGPPPPPGAAGRGGGGPPP 386 Score = 30.3 bits (65), Expect = 2.4 Identities = 19/67 (28%), Positives = 21/67 (31%), Gaps = 1/67 (1%) Frame = +1 Query: 340 PPXFPKXGXGGXHPPPXGGXAXSGGGXXPSXXXPPXGGEXQXTXXRG-GXXXXRGXHSXX 516 PP P PPP + +G G P PP G G G Sbjct: 321 PPPPPAHPAAPAPPPPAPSPSAAGAGSGPPPPPPPAAPAAPRPPGPGPGPPPPPGAAGRG 380 Query: 517 GGRPXPP 537 GG P PP Sbjct: 381 GGGPPPP 387 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 343 PXFPKXGXGGXHPPPXGGXAXSGGGXXPSXXXP 441 P P+ G PPP G A GGG P P Sbjct: 358 PAAPRPPGPGPGPPPPPGAAGRGGGGPPPPALP 390 >08_01_0059 - 394001-394708 Length = 235 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +1 Query: 811 PPPXXXHTPRPXXPXXXXPPPXXXPXTXPPXPXXXXXXXXXXXXXXXGPPPP 966 PPP P P P PPP P PP PPPP Sbjct: 18 PPPPRRAPPPPSPPIRPPPPPTPRPYAPPPPSHPLAPPPPHISPPAPVPPPP 69 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/52 (28%), Positives = 15/52 (28%) Frame = +1 Query: 811 PPPXXXHTPRPXXPXXXXPPPXXXPXTXPPXPXXXXXXXXXXXXXXXGPPPP 966 PPP P P P PPP PP P PPP Sbjct: 17 PPPPPRRAPPPPSPPIRPPPPPTPRPYAPPPPSHPLAPPPPHISPPAPVPPP 68 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/55 (29%), Positives = 16/55 (29%), Gaps = 3/55 (5%) Frame = +1 Query: 811 PPPXXXHTPRPXXPXXXXP---PPXXXPXTXPPXPXXXXXXXXXXXXXXXGPPPP 966 PPP P P P PP P PP P PPPP Sbjct: 3 PPPPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPPTPRPYAPPPPSHPLAPPPP 57 >07_03_1136 + 24218601-24218734,24218769-24219906 Length = 423 Score = 33.1 bits (72), Expect = 0.34 Identities = 28/103 (27%), Positives = 29/103 (28%), Gaps = 2/103 (1%) Frame = +1 Query: 325 GXXXXPPXFPK--XGXGGXHPPPXGGXAXSGGGXXPSXXXPPXGGEXQXTXXRGGXXXXR 498 G PP P G GG PP GG GGG GG GG Sbjct: 112 GGGGGPPSLPPGAGGGGGARPPAPGG--GGGGGAPRRVLGGGGGGGALARPPGGGRGGAL 169 Query: 499 GXHSXXGGRPXPPXKKTXGXXGXXXXXXXXXXXXXXXXXGGGG 627 G GG P + G G GGGG Sbjct: 170 GRPPGGGGGGGGPGRAPGGGGGGGGPGRAPGGGGGGGGLGGGG 212 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -2 Query: 452 PPXGGXXXXGCXPPPXXAXPPXGGGCXPPXPXLGXXGG 339 PP GG G PP GGG PP P G GG Sbjct: 108 PPGGGG---GGGPPSLPPGAGGGGGARPPAPGGGGGGG 142 Score = 29.1 bits (62), Expect = 5.6 Identities = 20/71 (28%), Positives = 21/71 (29%) Frame = +1 Query: 352 PKXGXGGXHPPPXGGXAXSGGGXXPSXXXPPXGGEXQXTXXRGGXXXXRGXHSXXGGRPX 531 P G GG PP A GGG P GG GG GGR Sbjct: 108 PPGGGGGGGPPSLPPGAGGGGGARPPAPGGGGGGGAPRRVLGGGGGGGALARPPGGGRGG 167 Query: 532 PPXKKTXGXXG 564 + G G Sbjct: 168 ALGRPPGGGGG 178 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 33.1 bits (72), Expect = 0.34 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +1 Query: 811 PPPXXXHTPRPXXPXXXXPPPXXXPXTXPPXPXXXXXXXXXXXXXXXGPPPP 966 PPP P P P PPP PP P G PPP Sbjct: 328 PPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPPGGKKGGPPP 379 Score = 31.9 bits (69), Expect = 0.80 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +1 Query: 811 PPPXXXHTPRPXXPXXXXPPPXXXPXTXPPXPXXXXXXXXXXXXXXXGPPPP 966 PPP P P P PPP P PP P PPPP Sbjct: 313 PPP-----PPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPP 359 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +1 Query: 811 PPPXXXHTPRPXXPXXXXPPPXXXPXTXPPXPXXXXXXXXXXXXXXXGPPPP 966 PP P P P PPP P PP P PPPP Sbjct: 318 PPKPAAAAPPPPPPPKAAPPPP--PPKGPPPPPPAKGPPPPPPPKGPSPPPP 367 Score = 29.1 bits (62), Expect = 5.6 Identities = 26/87 (29%), Positives = 28/87 (32%) Frame = -2 Query: 626 PPPPXXXXXXXXXXXXXXXXGPXXPXVFFXGGXGRPPXXEXXPRXXXXPPRXXVFWXSPP 447 PPPP P P G PP + P PP+ PP Sbjct: 315 PPPPPKPAAAAPPPPPPPKAAPPPPP---PKGPPPPPPAKGPP--PPPPPKGPSPPPPPP 369 Query: 446 XGGXXXXGCXPPPXXAXPPXGGGCXPP 366 GG G PPP PP GG PP Sbjct: 370 PGG--KKGGPPPP----PPKGGASRPP 390 Score = 28.7 bits (61), Expect = 7.4 Identities = 18/66 (27%), Positives = 19/66 (28%) Frame = -2 Query: 521 PPXXEXXPRXXXXPPRXXVFWXSPPXGGXXXXGCXPPPXXAXPPXGGGCXPPXPXLGXXG 342 PP + PP PP G P PP G PP P G G Sbjct: 316 PPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPPGGKKG 375 Query: 341 GXXXXP 324 G P Sbjct: 376 GPPPPP 381 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = -1 Query: 525 PAPPXRVXPPXXXVAXPPXXXLAFPPXXWXXXGXXXPPP 409 P PP PP PP PP G PPP Sbjct: 329 PPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPP 367 >01_01_0082 + 625198-625719 Length = 173 Score = 32.7 bits (71), Expect = 0.46 Identities = 19/70 (27%), Positives = 22/70 (31%), Gaps = 1/70 (1%) Frame = -2 Query: 521 PPXXEXXPRXXXXPPRXXVFWXSP-PXGGXXXXGCXPPPXXAXPPXGGGCXPPXPXLGXX 345 PP + P PP V++ P P P PP GGG P P Sbjct: 53 PPPPDVLPTPVYYPPPPPVYYPPPSPPPVAYPPPTTPSTNCPPPPYGGGGYNPTPSYNPT 112 Query: 344 GGXXXXPXXW 315 G P W Sbjct: 113 PGYNPTPSGW 122 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +1 Query: 808 HPPPXXXHTPRPXXPXXXXPPPXXXPXTXPPXP 906 +PPP + P P P PPP PP P Sbjct: 65 YPPPPPVYYPPPSPPPVAYPPPTTPSTNCPPPP 97 >04_04_0965 - 29762388-29762564,29764272-29766361,29766567-29767170, 29768395-29768637,29768704-29770203 Length = 1537 Score = 32.3 bits (70), Expect = 0.60 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 443 GGXXXXGCXPPPXXAXPPXGGGCXPPXPXLGXXGG 339 GG C PP GG C PP LG GG Sbjct: 26 GGSSGLLCLPPEALGVSSSGGACVPPPETLGVEGG 60 >01_06_1377 + 36764461-36765339 Length = 292 Score = 32.3 bits (70), Expect = 0.60 Identities = 15/52 (28%), Positives = 16/52 (30%) Frame = +1 Query: 811 PPPXXXHTPRPXXPXXXXPPPXXXPXTXPPXPXXXXXXXXXXXXXXXGPPPP 966 PPP P P PPP + PP P PPPP Sbjct: 155 PPPPEPQYPPPSSSPYYFPPPPPPAYSAPPPPQYGSEQYYRSGGYYSAPPPP 206 >05_02_0122 - 6840840-6841307 Length = 155 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 905 GXGGXVXGXXXGGGXXXXGXXGRGVCXXXGGG 810 G GG V G GGG G G GV GGG Sbjct: 84 GGGGAVEGGAGGGGAVGAGGGGGGVVGAGGGG 115 >05_01_0142 - 940421-940701,941262-941574 Length = 197 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 452 PPXGGXXXXGCXPPPXXAXPPXGGGCXPP 366 PP G G PPP A PP G PP Sbjct: 36 PPQGYPPPPGAYPPPPGAYPPPPGAYPPP 64 Score = 29.5 bits (63), Expect = 4.2 Identities = 22/66 (33%), Positives = 24/66 (36%) Frame = -2 Query: 536 GGXGRPPXXEXXPRXXXXPPRXXVFWXSPPXGGXXXXGCXPPPXXAXPPXGGGCXPPXPX 357 GG G PP P+ PP + PP G PPP A PP G PP Sbjct: 25 GGHGYPPHQGYPPQGYPPPPGA---YPPPP-------GAYPPPPGAYPPP-PGAYPPQHG 73 Query: 356 LGXXGG 339 GG Sbjct: 74 YPQPGG 79 >03_05_0630 + 26260159-26260272,26260520-26260894 Length = 162 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -2 Query: 965 GGGGPXXXXXXXXXXXXXGXGXGGXVXGXXXGGGXXXXGXXGRGVCXXXGGGW 807 GGGG G G GG G GGG G G G GG W Sbjct: 108 GGGGYGGGGGGGYGRREGGYGGGGGYGGGRGGGGGGYGGSRGGGYGGDSGGNW 160 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/52 (28%), Positives = 17/52 (32%) Frame = +1 Query: 811 PPPXXXHTPRPXXPXXXXPPPXXXPXTXPPXPXXXXXXXXXXXXXXXGPPPP 966 PPP + P P PPP + PP P PPPP Sbjct: 590 PPPPLPNCLVPSPPPPPPPPPILPNRSVPPPPPPPPPLPNHSVLPPPPPPPP 641 >06_01_0486 - 3455030-3455770 Length = 246 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Frame = +1 Query: 814 PPXXXHTPRPXX--PXXXXPPPXXXPXTXPPXPXXXXXXXXXXXXXXXGPPPP 966 PP TPRP P PPP P PP P PP P Sbjct: 77 PPYTPPTPRPPPTPPYVPSPPPYVPPYIPPPTPPYVPPYIPPPTPPYVPPPTP 129 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 811 PPPXXXHTPRPXXPXXXXPPPXXXPXTXPPXP 906 PPP + P P P PPP P T P P Sbjct: 117 PPPTPPYVPPPTPP---SPPPYVPPPTPPSPP 145 >01_07_0021 - 40533864-40534583,40534779-40534814,40534909-40535048, 40535837-40535922,40536430-40536653,40536770-40536865, 40538766-40538833,40539945-40540055,40540799-40540955 Length = 545 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 811 PPPXXXHTPRPXXPXXXXPPPXXXPXTXPPXP 906 PPP H P P PP P PP P Sbjct: 430 PPPPPEHPPPPESTSPPPPPTSDPPPVPPPPP 461 >01_06_0823 + 32234588-32234936,32236354-32237093,32237260-32237343, 32237909-32239263,32240399-32240460,32240544-32241144, 32241229-32241310,32241778-32241840 Length = 1111 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 811 PPPXXXHTPRPXXPXXXXPPPXXXPXTXPPXP 906 P P P P P PPP P PP P Sbjct: 24 PSPSSSSAPAPASPRSPVPPPPGVPPPPPPPP 55 >01_01_0070 - 542603-542686,542803-543441 Length = 240 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 811 PPPXXXHTPRPXXPXXXXPPPXXXPXTXPP 900 PPP TP P P PPP P T PP Sbjct: 102 PPPV---TPPPVSPPPATPPPALPPSTPPP 128 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 811 PPPXXXHTPRPXXPXXXXPPPXXXPXTXPP 900 PPP TP P P PPP P PP Sbjct: 91 PPPPV--TPPPVTPPPVTPPPVSPPPATPP 118 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 811 PPPXXXHTPRPXXPXXXXPPPXXXPXTXPP 900 PPP TP P P PPP P PP Sbjct: 97 PPPV---TPPPVTPPPVSPPPATPPPALPP 123 >12_02_0118 - 13869237-13869307,13869375-13869465,13870321-13870440, 13870668-13870795,13871159-13871270,13871719-13871817, 13871918-13871992,13872099-13872320,13873177-13874034 Length = 591 Score = 29.9 bits (64), Expect = 3.2 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = -2 Query: 527 GRPPXXEXXPRXXXXPPRXXVFWXSPPXGGXXXXGCXPPPXXAXPPXGGGCXPPXPXLG 351 G PP P PP S P GG PPP P G P P G Sbjct: 166 GGPPVAAAQPPPFGRPPSAAAAGQSAPLGGALFAAAQPPPFGGPP---GAAPQPAPTGG 221 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/51 (29%), Positives = 19/51 (37%) Frame = +1 Query: 811 PPPXXXHTPRPXXPXXXXPPPXXXPXTXPPXPXXXXXXXXXXXXXXXGPPP 963 PPP ++ +P P PPP P + PP P PPP Sbjct: 96 PPPYGVNSSQPPPPP---PPPPSPPPSAPPPPPPPPTQPPPREAQLAPPPP 143 Score = 29.1 bits (62), Expect = 5.6 Identities = 16/54 (29%), Positives = 17/54 (31%), Gaps = 2/54 (3%) Frame = +1 Query: 811 PPPXXXHTPRPXXPXXXXPPPXXXP--XTXPPXPXXXXXXXXXXXXXXXGPPPP 966 PPP P+P PPP P PP GPPPP Sbjct: 12 PPPQGGFPPQPPPMNPYGPPPPQQPAYGHMPPPQGAPPPFLAPPPPPPPGPPPP 65 >07_03_1710 - 28903614-28903673,28904982-28905146,28905453-28905638, 28905784-28905927,28906281-28906460,28906559-28907215 Length = 463 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 811 PPPXXXHTPRPXXPXXXXPPPXXXPXTXPP 900 PPP TP P P PP P + PP Sbjct: 56 PPPKPSPTPPPASPPPAPTPPQTRPPSPPP 85 >04_03_0904 + 20717005-20718087 Length = 360 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +1 Query: 811 PPPXXXHTPRPXXPXXXXPPPXXXPXTXPPXP 906 PPP +TP+P P PP P PP P Sbjct: 93 PPP---YTPKPTPPAHTPTPPTYTPTPTPPKP 121 >04_03_0660 + 18463011-18463322,18463424-18463516,18464500-18464607, 18464892-18465044,18465256-18465354,18465443-18465571, 18465987-18466166,18466208-18466246,18466247-18466363, 18466445-18466609 Length = 464 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 811 PPPXXXHTPRPXXPXXXXPPPXXXPXTXPPXP 906 PPP P P P PPP P PP P Sbjct: 39 PPPARHRAPSPPRP-PPPPPPPTQPAPPPPPP 69 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +1 Query: 835 PRPXXPXXXXPPPXXXPXTXPPXPXXXXXXXXXXXXXXXGPPPP 966 PRP P PPP P P P PPPP Sbjct: 265 PRPPPPQVPPPPPQAPPPPPPNAPMGMPPRIPPPPVGGTQPPPP 308 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +1 Query: 832 TPRPXXPXXXXPPPXXXPXTXPPXPXXXXXXXXXXXXXXXGPPPP 966 +PRP P PPP P PP P PPPP Sbjct: 339 SPRPVQPSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPP--PPPP 381 >03_01_0515 - 3864796-3865425 Length = 209 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +1 Query: 811 PPPXXXHTPRPXXPXXXXPPPXXXPXTXPPXP 906 PPP +P P PPP P PP P Sbjct: 75 PPPSVTSSPPPPPLPPPPPPPAASPPPPPPSP 106 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/52 (26%), Positives = 15/52 (28%) Frame = +1 Query: 811 PPPXXXHTPRPXXPXXXXPPPXXXPXTXPPXPXXXXXXXXXXXXXXXGPPPP 966 PPP +P P PPP P P PPPP Sbjct: 53 PPPSVTSSPPPPAAGPLMPPPPPPPSVTSSPPPPPLPPPPPPPAASPPPPPP 104 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 811 PPPXXXHTPRPXXPXXXXPPPXXXPXTXPPXP 906 PPP P P P PPP PP P Sbjct: 358 PPPPPPPPPPPPPPRPPPPPPPIKKGAPPPAP 389 >01_06_1678 - 39095986-39096205,39096400-39096477,39096578-39096949, 39097374-39097671,39097867-39098077,39098331-39099023 Length = 623 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 811 PPPXXXHTPRPXXPXXXXPPPXXXPXTXPPXP 906 PPP P P P PP P PP P Sbjct: 123 PPPHPPEDPPPHPPHPPDHPPPPPPCRVPPPP 154 >01_06_0146 + 26969011-26969995,26970878-26970930 Length = 345 Score = 29.5 bits (63), Expect = 4.2 Identities = 18/60 (30%), Positives = 19/60 (31%), Gaps = 7/60 (11%) Frame = +1 Query: 808 HPPPXXXHT---PRPXXPXXXXPPPXXXPXT----XPPXPXXXXXXXXXXXXXXXGPPPP 966 HPPP H P P P PPP P + P P PPPP Sbjct: 22 HPPPPTPHPATDPPPISPQNPTPPPPPLPASAAAPTTPSPNHSGDPSRPIPSQAPAPPPP 81 >07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828, 5049380-5049429,5049517-5049586,5049668-5049749, 5049867-5050267,5050414-5050941,5051823-5052044 Length = 558 Score = 29.1 bits (62), Expect = 5.6 Identities = 16/60 (26%), Positives = 17/60 (28%) Frame = +1 Query: 784 GXXXLXXXHPPPXXXHTPRPXXPXXXXPPPXXXPXTXPPXPXXXXXXXXXXXXXXXGPPP 963 G L PPP + P P PP P PP P PPP Sbjct: 199 GPSTLPPPPPPPPLPASSEPVDPSAASLPPLPPPPPPPPKPANIAGAPGLPLPPPPPPPP 258 >07_01_0516 - 3850252-3852870 Length = 872 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 814 PPXXXHTPRPXXPXXXXPPPXXXPXTXPP 900 PP T RP P PPP P PP Sbjct: 16 PPQPPPTSRPLPPPPPPPPPAHGPSPPPP 44 >12_02_1174 - 26696869-26698191 Length = 440 Score = 28.7 bits (61), Expect = 7.4 Identities = 16/55 (29%), Positives = 16/55 (29%), Gaps = 2/55 (3%) Frame = +1 Query: 808 HPPPXXXHTPRPXXPXXXXPPPXXXPXTXP--PXPXXXXXXXXXXXXXXXGPPPP 966 H PP P P P PPP P P P PPPP Sbjct: 139 HRPPPVKPQPPPSLPPPPPPPPPPPPPRPPSVKPPVVQPKPQPPPSLQPPSPPPP 193 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/52 (26%), Positives = 15/52 (28%) Frame = +1 Query: 811 PPPXXXHTPRPXXPXXXXPPPXXXPXTXPPXPXXXXXXXXXXXXXXXGPPPP 966 PPP P PPP P + PP P PPP Sbjct: 163 PPPRPPSVKPPVVQPKPQPPPSLQPPSPPPPPPTRPPSVKPPVVQPKPQPPP 214 >12_02_0643 - 21461123-21461902 Length = 259 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/33 (39%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +1 Query: 811 PPPXXXHTPRPXXPXXXXPPPXXX-PXTXPPXP 906 PPP +P P PPP P T PP P Sbjct: 204 PPPERRESPSPLRGRPRTPPPPRPRPPTTPPRP 236 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 811 PPPXXXHTPRPXXPXXXXPPPXXXPXTXPPXP 906 PPP P P P PP P PP P Sbjct: 427 PPPLPPPPPPPPPPPPPLPPNMPPPLPPPPEP 458 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 811 PPPXXXHTPRPXXPXXXXPPPXXXPXTXPPXP 906 PPP P P P P P P PP P Sbjct: 425 PPPPPLPPPPPPPPPPPPPLPPNMPPPLPPPP 456 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 28.3 bits (60), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 3/34 (8%) Frame = +1 Query: 814 PPXXXHTPRPXXPXX---XXPPPXXXPXTXPPXP 906 PP TPRP P PPP P PP P Sbjct: 215 PPIPFCTPRPWFPPIPFLTPPPPPFLPFPLPPIP 248 >09_04_0081 - 14400293-14400397,14400953-14401036,14401144-14401214, 14401293-14401380,14401487-14401678,14401772-14402704 Length = 490 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 811 PPPXXXHTPRPXX-PXXXXPPPXXXPXTXPPXP 906 PPP P P P PPP P PP P Sbjct: 220 PPPPPPPPPSPHRHPAAHPPPPPHHPAPRPPPP 252 >09_02_0543 + 10427321-10428315,10428440-10429154 Length = 569 Score = 28.3 bits (60), Expect = 9.8 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +1 Query: 811 PPPXXXHTPRPXXPXXXXPPPXXXPXTXPPXPXXXXXXXXXXXXXXXGPPPP 966 P P TP P P PPP P PP P PPP Sbjct: 18 PTPAPQATPPPAIPES-GPPPPPAPDMPPPPPTPAPQSSPAPPPAPDMTPPP 68 >06_03_0310 - 19453047-19453160,19453240-19453338,19453441-19453513, 19453598-19453708,19453795-19453956,19454064-19454340, 19454542-19455160,19455256-19455471 Length = 556 Score = 28.3 bits (60), Expect = 9.8 Identities = 11/29 (37%), Positives = 11/29 (37%) Frame = +1 Query: 814 PPXXXHTPRPXXPXXXXPPPXXXPXTXPP 900 PP P P P PPP P PP Sbjct: 156 PPSPPQDPAPSLPHAPAPPPPQAPAPTPP 184 Score = 28.3 bits (60), Expect = 9.8 Identities = 11/30 (36%), Positives = 11/30 (36%) Frame = +1 Query: 811 PPPXXXHTPRPXXPXXXXPPPXXXPXTXPP 900 P P H P P P P P P PP Sbjct: 163 PAPSLPHAPAPPPPQAPAPTPPQAPAPTPP 192 >04_04_0183 - 23384290-23384783,23385064-23385139,23385291-23385296 Length = 191 Score = 28.3 bits (60), Expect = 9.8 Identities = 15/29 (51%), Positives = 16/29 (55%), Gaps = 3/29 (10%) Frame = +1 Query: 340 PPXFPKXGXGGXHPPP---XGGXAXSGGG 417 PP P G GG +PPP GG SGGG Sbjct: 96 PPPAPYYGNGG-YPPPHQRGGGGGGSGGG 123 >03_05_0269 - 22545925-22546554,22546663-22547010,22547447-22547797 Length = 442 Score = 28.3 bits (60), Expect = 9.8 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -2 Query: 965 GGGGPXXXXXXXXXXXXXGXGXGGXVXGXXXGGGXXXXGXXGRGVCXXXGGGW 807 GGGG G G GG G GGG G GRG G GW Sbjct: 8 GGGGEMLAPLMEGPDPESGDGEGGGGGGGGGGGG----GGGGRGARGRRGEGW 56 >03_01_0023 + 198414-198968 Length = 184 Score = 28.3 bits (60), Expect = 9.8 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -2 Query: 965 GGGGPXXXXXXXXXXXXXGXGXGGXVXGXXXGGGXXXXGXXGRGVCXXXGGG 810 GGGG G G GG G GGG G G G GGG Sbjct: 43 GGGGGGGGGRGGGGGSGGGSGGGGGSGGGGSGGGGSGGGGSGGGGGGGSGGG 94 >02_03_0120 + 15463163-15465250 Length = 695 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 811 PPPXXXHTPRPXXPXXXXPPPXXXPXTXPPXP 906 PPP P P PPP P PP P Sbjct: 284 PPPTKYIGPMPPNNQPLPPPPSPSPSPPPPSP 315 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,882,140 Number of Sequences: 37544 Number of extensions: 290477 Number of successful extensions: 2596 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 889 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2103 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2834967080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -