BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_J18 (948 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC23E6.04c |utp10||U3 snoRNP-associated protein Utp10 |Schizos... 31 0.31 SPBC17G9.05 |rct1|cyp6|RRM-containing cyclophilin regulating tra... 28 2.2 SPAC19G12.16c |adg2|SPAC23A1.01c, mug46|conserved fungal protein... 28 2.2 SPAC1556.06.1 |meu1|SPAC1556.06a, SPAC1556.06|sequence orphan|Sc... 28 2.2 SPAC32A11.01 |mug8||conserved fungal protein|Schizosaccharomyces... 27 2.9 SPBC1271.09 |||glycerophosphodiester transporter|Schizosaccharom... 26 6.7 SPAC30.04c |abc4||glutathione S-conjugate-exporting ATPase Abc4|... 26 8.9 SPAC26F1.09 |gyp51||GTPase activating protein Gyp51 |Schizosacch... 26 8.9 >SPBC23E6.04c |utp10||U3 snoRNP-associated protein Utp10 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1649 Score = 30.7 bits (66), Expect = 0.31 Identities = 12/47 (25%), Positives = 25/47 (53%) Frame = -2 Query: 704 IGFVNEVVVFLVNAILSCGFRINEAMLHLCYVNFLQHFHIHKHFRVY 564 I + + V +++A++ G + ++L C+VN H H+ R+Y Sbjct: 917 IHVIEQTVKTVISALIRLGKDFDSSLLVSCFVNAFPHIPQHRRLRLY 963 >SPBC17G9.05 |rct1|cyp6|RRM-containing cyclophilin regulating transcription Rct1|Schizosaccharomyces pombe|chr 2|||Manual Length = 432 Score = 27.9 bits (59), Expect = 2.2 Identities = 11/24 (45%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -1 Query: 270 RYHSLCQFYNIHHQ--CLVGSHLG 205 +Y++ C FYNI H C G LG Sbjct: 35 KYYNFCPFYNIQHNYTCQTGDPLG 58 >SPAC19G12.16c |adg2|SPAC23A1.01c, mug46|conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 670 Score = 27.9 bits (59), Expect = 2.2 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = -1 Query: 819 STRTVNESGSSSSKRSCQYPQ*SMSAFVLH 730 +T TV+ESGSSS+ + YP ++S H Sbjct: 592 TTSTVSESGSSSASITSTYPSSTLSMTTSH 621 >SPAC1556.06.1 |meu1|SPAC1556.06a, SPAC1556.06|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 776 Score = 27.9 bits (59), Expect = 2.2 Identities = 13/46 (28%), Positives = 29/46 (63%), Gaps = 1/46 (2%) Frame = +3 Query: 120 VQYQNRAP*SQKMWMPXFVEK-QKKILSFFQDVSQLNTDDEYYKIG 254 V+ +N+ ++ M M FV++ ++++ +F D S++ D+E K+G Sbjct: 267 VESENKGLINEVMDMRNFVQQLEQELYAFEDDYSRIQNDEELLKVG 312 >SPAC32A11.01 |mug8||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 720 Score = 27.5 bits (58), Expect = 2.9 Identities = 14/56 (25%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Frame = +3 Query: 183 QKKILSFFQDVSQLNTDDEYYKIGKDY-DIEMNMDNYTNKKAVEEFLKMYRTGFMP 347 + K+ D + L DD KD+ ++ +N +Y NK ++ F + + F P Sbjct: 617 EMKLSDKIDDANSLKDDDFIQGSKKDFFEMNLNHSSYQNKDELKPFQLLVKHAFKP 672 >SPBC1271.09 |||glycerophosphodiester transporter|Schizosaccharomyces pombe|chr 2|||Manual Length = 543 Score = 26.2 bits (55), Expect = 6.7 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 759 EDIGMNAYYYYFHSHLPFWWTSEKYG 836 +DIGM AY L F W S+++G Sbjct: 118 QDIGMIAYVGTIVGQLSFGWYSDRFG 143 >SPAC30.04c |abc4||glutathione S-conjugate-exporting ATPase Abc4|Schizosaccharomyces pombe|chr 1|||Manual Length = 1469 Score = 25.8 bits (54), Expect = 8.9 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = -3 Query: 217 LTSWKKDRIFFCFSTNXGIHIF*LYGARFWYCTAERDGYKPSQE 86 L+S+ F+ F T G + L+ R WY D Y+PS E Sbjct: 186 LSSYSPFLWFYFFITIVG-NFIPLFTPRVWYPLFPEDNYQPSAE 228 >SPAC26F1.09 |gyp51||GTPase activating protein Gyp51 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1031 Score = 25.8 bits (54), Expect = 8.9 Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = +3 Query: 195 LSFF--QDVSQLNTDDEYYKIGKDYDIEMNMDN 287 L+FF Q+V Q+N +DEY + + D E +DN Sbjct: 49 LNFFSTQNVMQMNFEDEYSEFSNE-DDEAEIDN 80 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,382,696 Number of Sequences: 5004 Number of extensions: 66852 Number of successful extensions: 221 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 192 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 221 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 483319012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -