BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_J14 (893 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled ... 28 0.33 AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 26 1.8 AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A... 25 2.3 AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein pr... 24 5.4 >AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled receptor 3 protein. Length = 605 Score = 28.3 bits (60), Expect = 0.33 Identities = 22/75 (29%), Positives = 32/75 (42%), Gaps = 3/75 (4%) Frame = +2 Query: 26 GXSLRFDSRXGLSCGTVASTVIMAS---KFKSEKIGIVGSGLIGRSWAMLFASVGYQVTV 196 G ++RF + G+ S+ +A+ S IG G S A SVG V V Sbjct: 111 GLNMRFRDQTDTYTGSAGSSTQIAAFPLDHSSAAIGESADAAHGSSVAGGLGSVGSFVAV 170 Query: 197 YDVVAKQITDAIEDI 241 DV+ IT A+ + Sbjct: 171 NDVIGMNITPALSQV 185 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 25.8 bits (54), Expect = 1.8 Identities = 18/44 (40%), Positives = 27/44 (61%), Gaps = 4/44 (9%) Frame = +2 Query: 185 QVTVYD-VVAKQITDAIE--DIKYQLHTL-ENDGLLRGELKASE 304 Q T +D AK IT +E D+ ++ T +NDGL++ EL+ SE Sbjct: 350 QFTHHDGTPAKGITGKVEVSDVGFETTTTSDNDGLIKLELQPSE 393 >AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A2 protein. Length = 496 Score = 25.4 bits (53), Expect = 2.3 Identities = 15/71 (21%), Positives = 33/71 (46%) Frame = +2 Query: 185 QVTVYDVVAKQITDAIEDIKYQLHTLENDGLLRGELKASEQFQCIKGSTDLETAVKGAIF 364 +++ D+ K D+ ED ++ + DG++ L + + K STD+ + + + Sbjct: 379 RISPQDIARKLGLDSPEDAEFIVAKAIRDGVIEATLDPEKGYMRTKESTDIYSTREPQLA 438 Query: 365 VQECVPENLDL 397 + + LDL Sbjct: 439 FHQRISFCLDL 449 >AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein protein. Length = 476 Score = 24.2 bits (50), Expect = 5.4 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 61 VVRYGRIYSNHGI*IQVGKDRDRWKWFNR 147 VV GR+ N ++ K R+ W W+ R Sbjct: 443 VVLKGRLLENPSRRLRNDKQREFWTWYTR 471 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 799,861 Number of Sequences: 2352 Number of extensions: 15305 Number of successful extensions: 22 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 96334083 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -