BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_J12 (979 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) 98 1e-20 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 84 1e-16 SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) 83 3e-16 SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 2e-15 SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 2e-15 SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) 77 3e-14 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 57 2e-08 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 56 3e-08 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 56 3e-08 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 56 6e-08 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 53 4e-07 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 53 4e-07 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 50 4e-06 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 50 4e-06 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_36015| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 3e-05 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 46 6e-05 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) 45 1e-04 SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) 45 1e-04 SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) 45 1e-04 SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) 45 1e-04 SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) 45 1e-04 SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) 45 1e-04 SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) 45 1e-04 SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 45 1e-04 SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) 45 1e-04 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 45 1e-04 SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) 45 1e-04 SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) 45 1e-04 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 45 1e-04 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) 45 1e-04 SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) 45 1e-04 SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) 45 1e-04 SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) 45 1e-04 SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) 45 1e-04 SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) 45 1e-04 SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) 45 1e-04 SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) 45 1e-04 SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) 45 1e-04 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) 45 1e-04 SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) 45 1e-04 SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) 45 1e-04 SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) 45 1e-04 SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) 45 1e-04 SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) 45 1e-04 SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) 45 1e-04 SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_18781| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) 45 1e-04 SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 45 1e-04 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) 45 1e-04 SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) 45 1e-04 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 45 1e-04 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 45 1e-04 SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) 45 1e-04 SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) 45 1e-04 SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) 45 1e-04 SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) 45 1e-04 SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) 45 1e-04 SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) 45 1e-04 SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 45 1e-04 SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) 45 1e-04 SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) 45 1e-04 SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 45 1e-04 SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) 45 1e-04 SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) 45 1e-04 SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) 45 1e-04 SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) 45 1e-04 SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_56405| Best HMM Match : Fels1 (HMM E-Value=6.5) 45 1e-04 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55772| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55573| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) 45 1e-04 SB_55103| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55047| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_54903| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_54851| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_54482| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 45 1e-04 SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_53836| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_53493| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_53207| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_52948| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_52761| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_52662| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) 45 1e-04 SB_52572| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_51972| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_51882| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_51647| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_51566| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_51213| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_50537| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_50527| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_50288| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_49986| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_49737| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_49720| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_48785| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_47297| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_46711| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_46514| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 45 1e-04 SB_46282| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_46221| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_45973| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_45953| Best HMM Match : LRR_1 (HMM E-Value=7.4e-15) 45 1e-04 SB_45744| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_45699| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_45621| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) 45 1e-04 SB_45253| Best HMM Match : ig (HMM E-Value=0.00016) 45 1e-04 SB_45037| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_44899| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) 45 1e-04 SB_44593| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_44336| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_44213| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_44147| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_44009| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7) 45 1e-04 SB_43776| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_43277| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_43062| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_43007| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_42249| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_42173| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_41969| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_41303| Best HMM Match : DUF485 (HMM E-Value=2) 45 1e-04 SB_40919| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40898| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40785| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40759| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40752| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.5) 45 1e-04 SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40596| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40501| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40404| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40215| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40094| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_39735| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_39642| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_39544| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_39336| Best HMM Match : Kinesin (HMM E-Value=0) 45 1e-04 SB_39320| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 45 1e-04 SB_39131| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_39083| Best HMM Match : PhaC_N (HMM E-Value=0.7) 45 1e-04 SB_39081| Best HMM Match : Pertussis_S2S3 (HMM E-Value=9.8) 45 1e-04 SB_38904| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_38654| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) 45 1e-04 SB_38317| Best HMM Match : bZIP_2 (HMM E-Value=5.1e-14) 45 1e-04 SB_38140| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_37833| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_37700| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_37689| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_37634| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_37586| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_37467| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_37442| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_37275| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_37081| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_36845| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_36843| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_36822| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_36672| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_36551| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_36497| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_36480| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_36092| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_36066| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_35911| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_35809| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_35778| Best HMM Match : Dickkopf_N (HMM E-Value=2.4) 45 1e-04 SB_35695| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_35616| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_35502| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_35393| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_35230| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_35217| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_35048| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_34691| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 45 1e-04 SB_34399| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_34374| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_34227| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_34125| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) 45 1e-04 SB_33490| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_33325| Best HMM Match : ShTK (HMM E-Value=6.3e-10) 45 1e-04 SB_33281| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024) 45 1e-04 SB_32541| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_32443| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_32291| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_32217| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_32188| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_32162| Best HMM Match : Ras (HMM E-Value=4.7e-31) 45 1e-04 SB_32050| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_31853| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_31524| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_31275| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_31071| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_30889| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_30687| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_30453| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_30166| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_30004| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_29812| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_29620| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_29583| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_29441| Best HMM Match : MFS_1 (HMM E-Value=1.6e-12) 45 1e-04 SB_29433| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_29380| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_29161| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_29146| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_28829| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_28797| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_28439| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_28284| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_28002| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_27895| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 45 1e-04 SB_27625| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_27082| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_26894| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_26697| Best HMM Match : EGF (HMM E-Value=7.5e-34) 45 1e-04 SB_26278| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_26034| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_26029| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_25779| Best HMM Match : DUF485 (HMM E-Value=5.1) 45 1e-04 SB_25252| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_25111| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24900| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24899| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24625| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24558| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24302| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24239| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_23976| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_23972| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_23930| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_23315| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_23224| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_23079| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_22871| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_22743| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_22715| Best HMM Match : SAM_PNT (HMM E-Value=1.8) 45 1e-04 SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_22298| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_22087| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_21944| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_21601| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 45 1e-04 SB_21220| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_21197| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_21163| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_21132| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_21115| Best HMM Match : Swi3 (HMM E-Value=6.9) 45 1e-04 SB_20993| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_20955| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_20344| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_20082| Best HMM Match : DUF378 (HMM E-Value=4.1) 45 1e-04 SB_20043| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_19841| Best HMM Match : Myb_DNA-binding (HMM E-Value=1.1) 45 1e-04 SB_19497| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_19432| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_19022| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_18824| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_18805| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_18801| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_18630| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_18572| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_18544| Best HMM Match : 7tm_1 (HMM E-Value=0.00082) 45 1e-04 SB_18337| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_18037| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_17968| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_17922| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_17258| Best HMM Match : DUF791 (HMM E-Value=0.002) 45 1e-04 SB_17135| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_16840| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 45 1e-04 SB_16764| Best HMM Match : ACPS (HMM E-Value=4.4) 45 1e-04 SB_16696| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_16602| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_16512| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_16421| Best HMM Match : HD-ZIP_N (HMM E-Value=7.6) 45 1e-04 SB_16384| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.1) 45 1e-04 SB_16324| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_16112| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_16101| Best HMM Match : RVT_1 (HMM E-Value=0.00031) 45 1e-04 SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_15771| Best HMM Match : VQ (HMM E-Value=4.3) 45 1e-04 SB_15715| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_15545| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_15218| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_15175| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_15145| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_14983| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_14808| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_14442| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_14379| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_14356| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_14291| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_13637| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_13233| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_12576| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 >SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) Length = 203 Score = 97.9 bits (233), Expect = 1e-20 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +2 Query: 308 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 439 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR Sbjct: 100 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 143 >SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 97.9 bits (233), Expect = 1e-20 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +2 Query: 308 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 439 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR Sbjct: 464 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 507 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 84.2 bits (199), Expect = 1e-16 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = +3 Query: 447 VIHRIRGITQERTCEQKASKRPGTVKRPRCWRFSIGSAPLXSIXK 581 +I+ +GITQERTCEQKASKRPGTVKRPRCWRFSIGSAPL SI K Sbjct: 82 LIYLNQGITQERTCEQKASKRPGTVKRPRCWRFSIGSAPLTSITK 126 >SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) Length = 347 Score = 83.4 bits (197), Expect = 3e-16 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = +3 Query: 462 RGITQERTCEQKASKRPGTVKRPRCWRFSIGSAPLXSIXK 581 +GITQERTCEQKASKRPGTVKRPRCWRFSIGSAPL SI K Sbjct: 116 QGITQERTCEQKASKRPGTVKRPRCWRFSIGSAPLTSITK 155 >SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 83.4 bits (197), Expect = 3e-16 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = -3 Query: 575 DAVQGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP 465 D QGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP Sbjct: 19 DVGQGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP 55 Score = 54.8 bits (126), Expect = 1e-07 Identities = 31/45 (68%), Positives = 33/45 (73%) Frame = -1 Query: 529 GLFTVPGLLLAFCSHVLSCVIPLILWITVLPPLSELIPLAAAERP 395 G + GLLL CS + PLILWITVLPPLSELIPLAAAERP Sbjct: 38 GSWPFAGLLLT-CSFLR---YPLILWITVLPPLSELIPLAAAERP 78 >SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 1e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 564 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 463 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 33.1 bits (72), Expect = 0.35 Identities = 22/53 (41%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -3 Query: 578 GDAVQGGGAYGKTPATRPFYG----SWPFAGLLLTCSFLRYPPDSVDNRITAF 432 G V GG + K + F WPFA + F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMF----FPALSPDSVDNRITAF 60 >SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 1e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 564 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 463 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 33.1 bits (72), Expect = 0.35 Identities = 22/53 (41%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -3 Query: 578 GDAVQGGGAYGKTPATRPFYG----SWPFAGLLLTCSFLRYPPDSVDNRITAF 432 G V GG + K + F WPFA + F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMF----FPALSPDSVDNRITAF 60 >SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 1e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 564 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 463 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 33.1 bits (72), Expect = 0.35 Identities = 22/53 (41%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -3 Query: 578 GDAVQGGGAYGKTPATRPFYG----SWPFAGLLLTCSFLRYPPDSVDNRITAF 432 G V GG + K + F WPFA + F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMF----FPALSPDSVDNRITAF 60 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 81.4 bits (192), Expect = 1e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 564 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 463 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 33.1 bits (72), Expect = 0.35 Identities = 22/53 (41%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -3 Query: 578 GDAVQGGGAYGKTPATRPFYG----SWPFAGLLLTCSFLRYPPDSVDNRITAF 432 G V GG + K + F WPFA + F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMF----FPALSPDSVDNRITAF 60 >SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 1e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 564 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 463 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 33.1 bits (72), Expect = 0.35 Identities = 22/53 (41%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -3 Query: 578 GDAVQGGGAYGKTPATRPFYG----SWPFAGLLLTCSFLRYPPDSVDNRITAF 432 G V GG + K + F WPFA + F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMF----FPALSPDSVDNRITAF 60 >SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 1e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 564 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 463 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 33.1 bits (72), Expect = 0.35 Identities = 22/53 (41%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -3 Query: 578 GDAVQGGGAYGKTPATRPFYG----SWPFAGLLLTCSFLRYPPDSVDNRITAF 432 G V GG + K + F WPFA + F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMF----FPALSPDSVDNRITAF 60 >SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 1e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 564 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 463 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 33.1 bits (72), Expect = 0.35 Identities = 22/53 (41%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -3 Query: 578 GDAVQGGGAYGKTPATRPFYG----SWPFAGLLLTCSFLRYPPDSVDNRITAF 432 G V GG + K + F WPFA + F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMF----FPALSPDSVDNRITAF 60 >SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 1e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 564 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 463 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 33.1 bits (72), Expect = 0.35 Identities = 22/53 (41%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -3 Query: 578 GDAVQGGGAYGKTPATRPFYG----SWPFAGLLLTCSFLRYPPDSVDNRITAF 432 G V GG + K + F WPFA + F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMF----FPALSPDSVDNRITAF 60 >SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 1e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 564 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 463 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 33.1 bits (72), Expect = 0.35 Identities = 22/53 (41%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -3 Query: 578 GDAVQGGGAYGKTPATRPFYG----SWPFAGLLLTCSFLRYPPDSVDNRITAF 432 G V GG + K + F WPFA + F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMF----FPALSPDSVDNRITAF 60 >SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 1e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 564 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 463 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 33.1 bits (72), Expect = 0.35 Identities = 22/53 (41%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -3 Query: 578 GDAVQGGGAYGKTPATRPFYG----SWPFAGLLLTCSFLRYPPDSVDNRITAF 432 G V GG + K + F WPFA + F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMF----FPALSPDSVDNRITAF 60 >SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 1e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 564 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 463 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 33.1 bits (72), Expect = 0.35 Identities = 22/53 (41%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -3 Query: 578 GDAVQGGGAYGKTPATRPFYG----SWPFAGLLLTCSFLRYPPDSVDNRITAF 432 G V GG + K + F WPFA + F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMF----FPALSPDSVDNRITAF 60 >SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 1e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 564 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 463 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 33.1 bits (72), Expect = 0.35 Identities = 22/53 (41%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -3 Query: 578 GDAVQGGGAYGKTPATRPFYG----SWPFAGLLLTCSFLRYPPDSVDNRITAF 432 G V GG + K + F WPFA + F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMF----FPALSPDSVDNRITAF 60 >SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 1e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 564 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 463 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 33.1 bits (72), Expect = 0.35 Identities = 22/53 (41%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -3 Query: 578 GDAVQGGGAYGKTPATRPFYG----SWPFAGLLLTCSFLRYPPDSVDNRITAF 432 G V GG + K + F WPFA + F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMF----FPALSPDSVDNRITAF 60 >SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 1e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 564 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 463 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 33.1 bits (72), Expect = 0.35 Identities = 22/53 (41%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -3 Query: 578 GDAVQGGGAYGKTPATRPFYG----SWPFAGLLLTCSFLRYPPDSVDNRITAF 432 G V GG + K + F WPFA + F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMF----FPALSPDSVDNRITAF 60 >SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 1e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 564 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 463 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 33.1 bits (72), Expect = 0.35 Identities = 22/53 (41%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -3 Query: 578 GDAVQGGGAYGKTPATRPFYG----SWPFAGLLLTCSFLRYPPDSVDNRITAF 432 G V GG + K + F WPFA + F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMF----FPALSPDSVDNRITAF 60 >SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 81.4 bits (192), Expect = 1e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 564 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 463 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 33.1 bits (72), Expect = 0.35 Identities = 22/53 (41%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -3 Query: 578 GDAVQGGGAYGKTPATRPFYG----SWPFAGLLLTCSFLRYPPDSVDNRITAF 432 G V GG + K + F WPFA + F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMF----FPALSPDSVDNRITAF 60 >SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 1e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 564 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 463 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 33.1 bits (72), Expect = 0.35 Identities = 22/53 (41%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -3 Query: 578 GDAVQGGGAYGKTPATRPFYG----SWPFAGLLLTCSFLRYPPDSVDNRITAF 432 G V GG + K + F WPFA + F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMF----FPALSPDSVDNRITAF 60 >SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 1e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 564 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 463 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 33.1 bits (72), Expect = 0.35 Identities = 22/53 (41%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -3 Query: 578 GDAVQGGGAYGKTPATRPFYG----SWPFAGLLLTCSFLRYPPDSVDNRITAF 432 G V GG + K + F WPFA + F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMF----FPALSPDSVDNRITAF 60 >SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 1e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 564 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 463 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 33.1 bits (72), Expect = 0.35 Identities = 22/53 (41%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -3 Query: 578 GDAVQGGGAYGKTPATRPFYG----SWPFAGLLLTCSFLRYPPDSVDNRITAF 432 G V GG + K + F WPFA + F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMF----FPALSPDSVDNRITAF 60 >SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 1e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 564 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 463 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 33.1 bits (72), Expect = 0.35 Identities = 22/53 (41%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -3 Query: 578 GDAVQGGGAYGKTPATRPFYG----SWPFAGLLLTCSFLRYPPDSVDNRITAF 432 G V GG + K + F WPFA + F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMF----FPALSPDSVDNRITAF 60 >SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 1e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 564 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 463 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 33.1 bits (72), Expect = 0.35 Identities = 22/53 (41%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -3 Query: 578 GDAVQGGGAYGKTPATRPFYG----SWPFAGLLLTCSFLRYPPDSVDNRITAF 432 G V GG + K + F WPFA + F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMF----FPALSPDSVDNRITAF 60 >SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 1e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 564 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 463 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 33.1 bits (72), Expect = 0.35 Identities = 22/53 (41%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -3 Query: 578 GDAVQGGGAYGKTPATRPFYG----SWPFAGLLLTCSFLRYPPDSVDNRITAF 432 G V GG + K + F WPFA + F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMF----FPALSPDSVDNRITAF 60 >SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 1e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 564 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 463 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 33.1 bits (72), Expect = 0.35 Identities = 22/53 (41%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -3 Query: 578 GDAVQGGGAYGKTPATRPFYG----SWPFAGLLLTCSFLRYPPDSVDNRITAF 432 G V GG + K + F WPFA + F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMF----FPALSPDSVDNRITAF 60 >SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 1e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 564 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 463 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 33.1 bits (72), Expect = 0.35 Identities = 22/53 (41%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -3 Query: 578 GDAVQGGGAYGKTPATRPFYG----SWPFAGLLLTCSFLRYPPDSVDNRITAF 432 G V GG + K + F WPFA + F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMF----FPALSPDSVDNRITAF 60 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 81.4 bits (192), Expect = 1e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 564 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 463 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 33.1 bits (72), Expect = 0.35 Identities = 22/53 (41%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -3 Query: 578 GDAVQGGGAYGKTPATRPFYG----SWPFAGLLLTCSFLRYPPDSVDNRITAF 432 G V GG + K + F WPFA + F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMF----FPALSPDSVDNRITAF 60 >SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 1e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 564 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 463 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 33.1 bits (72), Expect = 0.35 Identities = 22/53 (41%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -3 Query: 578 GDAVQGGGAYGKTPATRPFYG----SWPFAGLLLTCSFLRYPPDSVDNRITAF 432 G V GG + K + F WPFA + F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMF----FPALSPDSVDNRITAF 60 >SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 81.4 bits (192), Expect = 1e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 564 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 463 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 93 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 126 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 512 WPFAGLLLTCSFLRYPPDSVDNRITAF 432 WPFA + F PDSVDNRITAF Sbjct: 114 WPFAHMF----FPALSPDSVDNRITAF 136 >SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 1e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 564 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 463 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 33.1 bits (72), Expect = 0.35 Identities = 22/53 (41%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -3 Query: 578 GDAVQGGGAYGKTPATRPFYG----SWPFAGLLLTCSFLRYPPDSVDNRITAF 432 G V GG + K + F WPFA + F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMF----FPALSPDSVDNRITAF 60 >SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 1e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 564 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 463 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 33.1 bits (72), Expect = 0.35 Identities = 22/53 (41%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -3 Query: 578 GDAVQGGGAYGKTPATRPFYG----SWPFAGLLLTCSFLRYPPDSVDNRITAF 432 G V GG + K + F WPFA + F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMF----FPALSPDSVDNRITAF 60 >SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 1e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 564 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 463 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 33.1 bits (72), Expect = 0.35 Identities = 22/53 (41%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -3 Query: 578 GDAVQGGGAYGKTPATRPFYG----SWPFAGLLLTCSFLRYPPDSVDNRITAF 432 G V GG + K + F WPFA + F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMF----FPALSPDSVDNRITAF 60 >SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 81.4 bits (192), Expect = 1e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 564 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 463 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 59 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 92 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 512 WPFAGLLLTCSFLRYPPDSVDNRITAF 432 WPFA + F PDSVDNRITAF Sbjct: 80 WPFAHMF----FPALSPDSVDNRITAF 102 >SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 1e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 564 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 463 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 33.1 bits (72), Expect = 0.35 Identities = 22/53 (41%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -3 Query: 578 GDAVQGGGAYGKTPATRPFYG----SWPFAGLLLTCSFLRYPPDSVDNRITAF 432 G V GG + K + F WPFA + F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMF----FPALSPDSVDNRITAF 60 >SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 1e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 564 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 463 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 33.1 bits (72), Expect = 0.35 Identities = 22/53 (41%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -3 Query: 578 GDAVQGGGAYGKTPATRPFYG----SWPFAGLLLTCSFLRYPPDSVDNRITAF 432 G V GG + K + F WPFA + F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMF----FPALSPDSVDNRITAF 60 >SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 1e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 564 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 463 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 33.1 bits (72), Expect = 0.35 Identities = 22/53 (41%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -3 Query: 578 GDAVQGGGAYGKTPATRPFYG----SWPFAGLLLTCSFLRYPPDSVDNRITAF 432 G V GG + K + F WPFA + F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMF----FPALSPDSVDNRITAF 60 >SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 1e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 564 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 463 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 33.1 bits (72), Expect = 0.35 Identities = 22/53 (41%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -3 Query: 578 GDAVQGGGAYGKTPATRPFYG----SWPFAGLLLTCSFLRYPPDSVDNRITAF 432 G V GG + K + F WPFA + F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMF----FPALSPDSVDNRITAF 60 >SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 81.0 bits (191), Expect = 1e-15 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 566 QGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP 465 +GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP Sbjct: 405 EGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP 438 Score = 54.8 bits (126), Expect = 1e-07 Identities = 31/45 (68%), Positives = 33/45 (73%) Frame = -1 Query: 529 GLFTVPGLLLAFCSHVLSCVIPLILWITVLPPLSELIPLAAAERP 395 G + GLLL CS + PLILWITVLPPLSELIPLAAAERP Sbjct: 421 GSWPFAGLLLT-CSFLR---YPLILWITVLPPLSELIPLAAAERP 461 >SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 901 Score = 80.6 bits (190), Expect = 2e-15 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 566 QGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP 465 +GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP Sbjct: 758 RGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP 791 Score = 54.8 bits (126), Expect = 1e-07 Identities = 31/45 (68%), Positives = 33/45 (73%) Frame = -1 Query: 529 GLFTVPGLLLAFCSHVLSCVIPLILWITVLPPLSELIPLAAAERP 395 G + GLLL CS + PLILWITVLPPLSELIPLAAAERP Sbjct: 774 GSWPFAGLLLT-CSFLR---YPLILWITVLPPLSELIPLAAAERP 814 >SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 80.6 bits (190), Expect = 2e-15 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 566 QGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP 465 +GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP Sbjct: 554 KGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP 587 Score = 54.8 bits (126), Expect = 1e-07 Identities = 31/45 (68%), Positives = 33/45 (73%) Frame = -1 Query: 529 GLFTVPGLLLAFCSHVLSCVIPLILWITVLPPLSELIPLAAAERP 395 G + GLLL CS + PLILWITVLPPLSELIPLAAAERP Sbjct: 570 GSWPFAGLLLT-CSFLR---YPLILWITVLPPLSELIPLAAAERP 610 >SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 80.2 bits (189), Expect = 2e-15 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 563 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP 465 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP Sbjct: 1 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP 33 Score = 54.8 bits (126), Expect = 1e-07 Identities = 31/45 (68%), Positives = 33/45 (73%) Frame = -1 Query: 529 GLFTVPGLLLAFCSHVLSCVIPLILWITVLPPLSELIPLAAAERP 395 G + GLLL CS + PLILWITVLPPLSELIPLAAAERP Sbjct: 16 GSWPFAGLLLT-CSFLR---YPLILWITVLPPLSELIPLAAAERP 56 >SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 80.2 bits (189), Expect = 2e-15 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 563 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP 465 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP Sbjct: 24 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP 56 Score = 54.8 bits (126), Expect = 1e-07 Identities = 31/45 (68%), Positives = 33/45 (73%) Frame = -1 Query: 529 GLFTVPGLLLAFCSHVLSCVIPLILWITVLPPLSELIPLAAAERP 395 G + GLLL CS + PLILWITVLPPLSELIPLAAAERP Sbjct: 39 GSWPFAGLLLT-CSFLR---YPLILWITVLPPLSELIPLAAAERP 79 >SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 80.2 bits (189), Expect = 2e-15 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 563 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP 465 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP Sbjct: 1 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP 33 Score = 54.8 bits (126), Expect = 1e-07 Identities = 31/45 (68%), Positives = 33/45 (73%) Frame = -1 Query: 529 GLFTVPGLLLAFCSHVLSCVIPLILWITVLPPLSELIPLAAAERP 395 G + GLLL CS + PLILWITVLPPLSELIPLAAAERP Sbjct: 16 GSWPFAGLLLT-CSFLR---YPLILWITVLPPLSELIPLAAAERP 56 >SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 77.8 bits (183), Expect = 1e-14 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -2 Query: 561 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 463 GRSLWKNASNAAFLRFLAFCWPFAHMF+PALSP Sbjct: 2 GRSLWKNASNAAFLRFLAFCWPFAHMFYPALSP 34 Score = 30.3 bits (65), Expect = 2.5 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = -3 Query: 512 WPFAGLLLTCSFLRYPPDSVDNRITAF 432 WPFA + + PDSVDNRITAF Sbjct: 22 WPFAHMF----YPALSPDSVDNRITAF 44 >SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) Length = 77 Score = 76.6 bits (180), Expect = 3e-14 Identities = 42/76 (55%), Positives = 50/76 (65%), Gaps = 3/76 (3%) Frame = -2 Query: 561 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP---*FCG*PYYRL*VS*YRSPQPNDRA 391 GRSLWKNASNAAFLRFLAFCWPF HMF PALSP C + R ++ RS + ++R Sbjct: 2 GRSLWKNASNAAFLRFLAFCWPFDHMFSPALSPDSVDICITAFERDDIA--RSSRMHERR 59 Query: 390 QRVSERGSGRAPNTQT 343 + VSE R+ QT Sbjct: 60 ESVSEEAEERSIRKQT 75 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 74.5 bits (175), Expect = 1e-13 Identities = 37/102 (36%), Positives = 38/102 (37%) Frame = +1 Query: 631 YPXCXPPXXPPXXPPPXXPPXXXXXXPXPPXPXWGXXGXXPXPPXXXXPXXGXGXPPXRG 810 YP PP P P P PP P PP P + P PP P PP Sbjct: 99 YPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPP 158 Query: 811 XXXXPPXTPPXPXXPXNXPXXPPPXKTXXPPXPPPXXPXSPP 936 PP PP P P P PPP PP PPP P PP Sbjct: 159 PLYPPPPNPPPPNAPYPPPPYPPPPN---PPYPPPPNPPYPP 197 Score = 66.1 bits (154), Expect = 4e-11 Identities = 36/98 (36%), Positives = 36/98 (36%), Gaps = 1/98 (1%) Frame = +1 Query: 634 PXCXPPXXPPXXPPPXXPPXXXXXXPXPPXPXWGXXGXXPXPPXXXXPXXGXGXPPXRGX 813 P PP PP PPP PP P PP P P PP P PP Sbjct: 150 PPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPP------PPNPPYPPPP--NPPYPPPPNA 201 Query: 814 XXXPPXTPPXPXXP-XNXPXXPPPXKTXXPPXPPPXXP 924 PP PP P P P PPP PP PPP P Sbjct: 202 PNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPPNP 239 Score = 63.3 bits (147), Expect = 3e-10 Identities = 33/97 (34%), Positives = 34/97 (35%) Frame = +1 Query: 646 PPXXPPXXPPPXXPPXXXXXXPXPPXPXWGXXGXXPXPPXXXXPXXGXGXPPXRGXXXXP 825 PP PPP PP P PP P P PP P PP P Sbjct: 141 PPSPNAPYPPPPNPPYPPPLYPPPPNPP---PPNAPYPPPPYPPPPNPPYPPPPNPPYPP 197 Query: 826 PXTPPXPXXPXNXPXXPPPXKTXXPPXPPPXXPXSPP 936 P P P P P PPP PP PPP +PP Sbjct: 198 PPNAPNPPPP--NPPYPPPPNAPNPPYPPPPNAPNPP 232 Score = 62.9 bits (146), Expect = 4e-10 Identities = 33/98 (33%), Positives = 33/98 (33%), Gaps = 2/98 (2%) Frame = +1 Query: 649 PXXPPXXPPPXXPPXXXXXXPXPPXPXWGXXGXXPXPPXXXXPXXGXGXPPXRGXXXXPP 828 P PP PP PP P PP P P P P PP PP Sbjct: 92 PPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPP 151 Query: 829 XTPPXPXXPXNXPXXPPPXKT--XXPPXPPPXXPXSPP 936 PP P P PPP PP PPP P PP Sbjct: 152 PNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPP 189 Score = 61.3 bits (142), Expect = 1e-09 Identities = 34/97 (35%), Positives = 34/97 (35%) Frame = +1 Query: 646 PPXXPPXXPPPXXPPXXXXXXPXPPXPXWGXXGXXPXPPXXXXPXXGXGXPPXRGXXXXP 825 PP PP PPP P P PP P P PP P PP P Sbjct: 126 PPPNPPYPPPPNAPYPPSPNAPYPPPPN------PPYPPPLYPPPPN---PPPPNAPYPP 176 Query: 826 PXTPPXPXXPXNXPXXPPPXKTXXPPXPPPXXPXSPP 936 P PP P P P PP P PPP P PP Sbjct: 177 PPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPP 213 Score = 51.6 bits (118), Expect = 9e-07 Identities = 31/104 (29%), Positives = 33/104 (31%) Frame = +2 Query: 605 GXXPXDYXXTPRVXPPXXPPXRPPXXXPPXXXTXXXSPXFPXGEXXGLXLYPPPXXXPXX 784 G P ++ P PP PP PP PP P YPPP P Sbjct: 82 GHPPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYP 141 Query: 785 GXXXPPXGGXXXTPPXPXPXXPXPXTXPXXPPRXKQXXPXAPPP 916 P PP P P P P P PP P PPP Sbjct: 142 PSPNAPY-PPPPNPPYPPPLYPPPPNPP--PPNAPYPPPPYPPP 182 Score = 51.6 bits (118), Expect = 9e-07 Identities = 31/100 (31%), Positives = 34/100 (34%), Gaps = 1/100 (1%) Frame = +1 Query: 646 PPXXPPXXPPPXXPPXXXXXXPXPPXPXWGXXGXXPXPPXXXXPXXGXGXPPXRGXXXXP 825 PP PP PP PP P + P PP P PP P Sbjct: 84 PPTNFSPNPPYPPPPYPPY----PPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAP 139 Query: 826 -PXTPPXPXXPXNXPXXPPPXKTXXPPXPPPXXPXSPPVF 942 P +P P P P PPP P PPP P PP + Sbjct: 140 YPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPY 179 Score = 48.4 bits (110), Expect = 9e-06 Identities = 30/95 (31%), Positives = 31/95 (32%) Frame = +2 Query: 647 PPXXPPXRPPXXXPPXXXTXXXSPXFPXGEXXGLXLYPPPXXXPXXGXXXPPXGGXXXTP 826 PP PP PP PP +P P YPPP P PP P Sbjct: 150 PPPNPPYPPPLYPPPPNPPPPNAPYPPPP-------YPPPPNPPYPPPPNPPY------P 196 Query: 827 PXPXPXXPXPXTXPXXPPRXKQXXPXAPPPGXRXP 931 P P P P P PP P PPP P Sbjct: 197 PPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNP 231 Score = 47.2 bits (107), Expect = 2e-05 Identities = 31/120 (25%), Positives = 32/120 (26%), Gaps = 3/120 (2%) Frame = +2 Query: 623 YXXTPRVXPPXXPPXRPPXXXP---PXXXTXXXSPXFPXGEXXGLXLYPPPXXXPXXGXX 793 Y P PP PP PP P P P P PPP Sbjct: 102 YPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLY 161 Query: 794 XPPXGGXXXTPPXPXPXXPXPXTXPXXPPRXKQXXPXAPPPGXRXPXXFFRXPPXXSXGP 973 PP P P P P P P PP P P P + PP P Sbjct: 162 PPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPP 221 Score = 44.0 bits (99), Expect = 2e-04 Identities = 30/108 (27%), Positives = 30/108 (27%) Frame = +3 Query: 588 PPNSDVAXPXXTIXIPXVXPPXXPPPXAPPXXXPPXXXPKXXPPXSPXGXXXXXSXTPXX 767 PPN P P PP PPP AP P P P P P Sbjct: 111 PPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPP 170 Query: 768 XXXXXGXXXPPPPGXXXXPPLXPXXXXLXRKXXLXXPPGXNXFXPXPP 911 PPPP PP P PP N P PP Sbjct: 171 NAPYPPPPYPPPPNPPYPPPPNPPYPP---PPNAPNPPPPNPPYPPPP 215 Score = 42.7 bits (96), Expect = 4e-04 Identities = 29/103 (28%), Positives = 31/103 (30%), Gaps = 3/103 (2%) Frame = +3 Query: 633 PXVXPPXXPPPXAPPXXXPPXXXPKXXPPXSPXGXXXXXSXTP---XXXXXXXGXXXPPP 803 P PP PP PP PP P PP +P P PPP Sbjct: 92 PPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPP 151 Query: 804 PGXXXXPPLXPXXXXLXRKXXLXXPPGXNXFXPXPPPXVXXFP 932 P PPL P PP P PPP +P Sbjct: 152 PNPPYPPPLYPPPPNPPPPNAPYPPP------PYPPPPNPPYP 188 Score = 40.7 bits (91), Expect = 0.002 Identities = 31/111 (27%), Positives = 33/111 (29%), Gaps = 2/111 (1%) Frame = +3 Query: 588 PPNSDVAXPXXTIXIPXVXPPXXPPPXAP--PXXXPPXXXPKXXPPXSPXGXXXXXSXTP 761 PPN+ P P P P P AP P PP P PP +P P Sbjct: 119 PPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPP--PPNAPYPP 176 Query: 762 XXXXXXXGXXXPPPPGXXXXPPLXPXXXXLXRKXXLXXPPGXNXFXPXPPP 914 PPPP PP P PP P PPP Sbjct: 177 PPYPPPPNPPYPPPPNPPYPPP--PNAPNPPPPNPPYPPPPNAPNPPYPPP 225 Score = 40.3 bits (90), Expect = 0.002 Identities = 29/114 (25%), Positives = 31/114 (27%) Frame = +2 Query: 614 PXDYXXTPRVXPPXXPPXRPPXXXPPXXXTXXXSPXFPXGEXXGLXLYPPPXXXPXXGXX 793 P Y P P PP P P +P +P YPP P Sbjct: 96 PPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAP---YPPSPNAPYPPPP 152 Query: 794 XPPXGGXXXTPPXPXPXXPXPXTXPXXPPRXKQXXPXAPPPGXRXPXXFFRXPP 955 PP PP P P P PP P P P P PP Sbjct: 153 NPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPP 206 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 4/53 (7%) Frame = +1 Query: 790 GXPPXRGXXXXPPXTPPXPXXPXNXPXXPPPXKTXXP----PXPPPXXPXSPP 936 G PP P PP P P P PPP P P PPP P PP Sbjct: 82 GHPPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPP 134 Score = 35.1 bits (77), Expect = 0.087 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = +3 Query: 588 PPNSDVAXPXXTIXIPXVXPPXXPPPXAP-PXXXPPXXXPKXXPPXSP 728 PPN P P PP PPP AP P PP P P P Sbjct: 190 PPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPP 237 Score = 33.1 bits (72), Expect = 0.35 Identities = 17/59 (28%), Positives = 18/59 (30%) Frame = +2 Query: 755 YPPPXXXPXXGXXXPPXGGXXXTPPXPXPXXPXPXTXPXXPPRXKQXXPXAPPPGXRXP 931 +PP P PP PP P P P P P P PPP P Sbjct: 83 HPPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYP 141 Score = 30.7 bits (66), Expect = 1.9 Identities = 22/75 (29%), Positives = 23/75 (30%), Gaps = 2/75 (2%) Frame = +3 Query: 588 PPNSDVAXPXXTIXIPXVXPPXXP-PPXAPPXXXPPXXXPKXXPPXSPXGXXXXXSXTP- 761 PPN+ P P PP P PP P PP P PP P P Sbjct: 169 PPNAPYPPP------PYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPY 222 Query: 762 XXXXXXXGXXXPPPP 806 PPPP Sbjct: 223 PPPPNAPNPPYPPPP 237 Score = 29.1 bits (62), Expect = 5.7 Identities = 19/60 (31%), Positives = 21/60 (35%), Gaps = 2/60 (3%) Frame = +3 Query: 555 SAPLXSIXKXXPPNSDVAXPXXTIXIPXVXPPXXPPPXAPPXXXPP--XXXPKXXPPXSP 728 +AP PPN P P P PPP PP PP P PP +P Sbjct: 171 NAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPN-PPYPPPPNAPNPPYPPPPNAP 229 Score = 29.1 bits (62), Expect = 5.7 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +1 Query: 631 YPXCXPPXXPPXXPPPXXPPXXXXXXPXPPXPXWGXXGXXPXPP 762 YP PP PP PP P PP P P PP Sbjct: 195 YPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPN-APNPPYPPPP 237 >SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.9 bits (171), Expect = 4e-13 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -2 Query: 564 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 463 GGRSLWKNASNAAFLRFLAF WPFAHMFF ALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFGWPFAHMFFRALSP 50 Score = 31.9 bits (69), Expect = 0.81 Identities = 21/53 (39%), Positives = 24/53 (45%), Gaps = 4/53 (7%) Frame = -3 Query: 578 GDAVQGGGAYGKTPATRPFYG----SWPFAGLLLTCSFLRYPPDSVDNRITAF 432 G V GG + K + F WPFA + F PD VDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFGWPFAHMF----FRALSPDCVDNRITAF 60 >SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 67.3 bits (157), Expect = 2e-11 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = -2 Query: 561 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 463 G KNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 18 GAEPMKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 512 WPFAGLLLTCSFLRYPPDSVDNRITAF 432 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 57.2 bits (132), Expect = 2e-08 Identities = 35/97 (36%), Positives = 37/97 (38%) Frame = -3 Query: 935 GGEXGXXGGGXGGKXVXXGGGXKGXFXGKXGXGGVKGGXXXXPRXGGXPXPXXGXXXXGG 756 GG+ G GGG GG GGG G + G GG GG GG G GG Sbjct: 782 GGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGG 841 Query: 755 XGXXPXXPXXGXGGXGFXXXXXGGXXGGGXXGGXXGG 645 G GG G GG GGG GG GG Sbjct: 842 YADGDGGGGGGGGGGG--GGGGGGGGGGGGGGGGGGG 876 Score = 49.2 bits (112), Expect = 5e-06 Identities = 32/94 (34%), Positives = 32/94 (34%) Frame = -3 Query: 914 GGGXGGKXVXXGGGXKGXFXGKXGXGGVKGGXXXXPRXGGXPXPXXGXXXXGGXGXXPXX 735 GGG GG GGG G G G GG GG G G GG G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGG 828 Query: 734 PXXGXGGXGFXXXXXGGXXGGGXXGGXXGGXHXG 633 GG G G GGG GG GG G Sbjct: 829 GYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGG 862 Score = 46.0 bits (104), Expect = 5e-05 Identities = 35/101 (34%), Positives = 35/101 (34%) Frame = -3 Query: 935 GGEXGXXGGGXGGKXVXXGGGXKGXFXGKXGXGGVKGGXXXXPRXGGXPXPXXGXXXXGG 756 GG G GG GG GGG G G G GG GG GG G GG Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGG----GGGGGGGG 824 Query: 755 XGXXPXXPXXGXGGXGFXXXXXGGXXGGGXXGGXXGGXHXG 633 G G G GG GGG GG GG G Sbjct: 825 GDGGGYGDGGGFGDGGGYADGDGGGGGGG--GGGGGGGGGG 863 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/65 (32%), Positives = 23/65 (35%) Frame = -1 Query: 826 GGXXXXPGGGGXXXPXXXXXXXGVXXKXXXFPXGEXGGXXXGXXXGGXXXGGAXGGGXXG 647 GG GGGG G + G+ GG G GG GG GGG G Sbjct: 812 GGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGG 871 Query: 646 GNTXG 632 G G Sbjct: 872 GGGGG 876 Score = 37.1 bits (82), Expect = 0.022 Identities = 30/96 (31%), Positives = 31/96 (32%) Frame = -3 Query: 833 VKGGXXXXPRXGGXPXPXXGXXXXGGXGXXPXXPXXGXGGXGFXXXXXGGXXGGGXXGGX 654 V GG GG G GG G G GG G GG GGG GG Sbjct: 768 VGGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDG-GGYGDGDGGGGGGGGGGGGGGD 826 Query: 653 XGGXHXGYXYSXXGXRHI*IGXXXFGDAVQGGGAYG 546 GG G + G G G GGG G Sbjct: 827 GGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGG 862 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = -3 Query: 932 GEXGXXGGGXGGKXVXXGGGXKGXFXGKXGXGGVK 828 G+ G GGG GG GGG G G G G +K Sbjct: 845 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVIK 879 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 56.4 bits (130), Expect = 3e-08 Identities = 34/102 (33%), Positives = 35/102 (34%) Frame = +1 Query: 646 PPXXPPXXPPPXXPPXXXXXXPXPPXPXWGXXGXXPXPPXXXXPXXGXGXPPXRGXXXXP 825 PP PP PPP PP P PP P P PP P PP P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPP--------PQPPPPPPP------PPPPPPPPPP 411 Query: 826 PXTPPXPXXPXNXPXXPPPXKTXXPPXPPPXXPXSPPVFSXA 951 P PP P P P PPP PP + PV A Sbjct: 412 PPPPPPPAPPPPPPPPPPPPPALRLACAPPRLRFTSPVLHLA 453 Score = 56.0 bits (129), Expect = 4e-08 Identities = 36/98 (36%), Positives = 37/98 (37%) Frame = +1 Query: 658 PPXXPPPXXPPXXXXXXPXPPXPXWGXXGXXPXPPXXXXPXXGXGXPPXRGXXXXPPXTP 837 PP PPP PP P PP P P PP P PP + PP P Sbjct: 365 PPPPPPPPPPP------PSPPPP--------PPPPPPSPP------PPPQ-----PPPPP 399 Query: 838 PXPXXPXNXPXXPPPXKTXXPPXPPPXXPXSPPVFSXA 951 P P P P PPP PP PPP P PP A Sbjct: 400 PPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLA 437 Score = 45.2 bits (102), Expect = 8e-05 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = +1 Query: 808 GXXXXPPXTPPXPXXPXNXPXXPPPXKTXXPPXPPPXXPXSPP 936 G PP PP P P + P PPP PP P P P PP Sbjct: 360 GINMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPP 402 Score = 42.7 bits (96), Expect = 4e-04 Identities = 22/71 (30%), Positives = 24/71 (33%) Frame = +2 Query: 743 GLXLYPPPXXXPXXGXXXPPXGGXXXTPPXPXPXXPXPXTXPXXPPRXKQXXPXAPPPGX 922 G+ + PPP P PP P P P P P P PP P PPP Sbjct: 360 GINMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPA 419 Query: 923 RXPXXFFRXPP 955 P PP Sbjct: 420 PPPPPPPPPPP 430 Score = 37.9 bits (84), Expect = 0.012 Identities = 21/66 (31%), Positives = 22/66 (33%) Frame = +2 Query: 758 PPPXXXPXXGXXXPPXGGXXXTPPXPXPXXPXPXTXPXXPPRXKQXXPXAPPPGXRXPXX 937 PPP P PP +PP P P P P PP P PPP P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPP-PPPPPPPPPPPAPPPPPP 425 Query: 938 FFRXPP 955 PP Sbjct: 426 PPPPPP 431 Score = 37.9 bits (84), Expect = 0.012 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +3 Query: 588 PPNSDVAXPXXTIXIPXVXPPXXPPPXAPPXXXPPXXXPKXXPPXSP 728 PP + P P PP PPP PP PP P PP P Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 37.5 bits (83), Expect = 0.016 Identities = 19/59 (32%), Positives = 20/59 (33%) Frame = +2 Query: 797 PPXGGXXXTPPXPXPXXPXPXTXPXXPPRXKQXXPXAPPPGXRXPXXFFRXPPXXSXGP 973 PP PP P P P P P PP+ P PPP P PP P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 37.5 bits (83), Expect = 0.016 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 588 PPNSDVAXPXXTIXIPXVXPPXXPPPXAPPXXXPPXXXPKXXPPXSP 728 PP P P PP PPP PP PP P PP P Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 37.1 bits (82), Expect = 0.022 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 588 PPNSDVAXPXXTIXIPXVXPPXXPPPXAPPXXXPPXXXPKXXPPXSP 728 PP P P PP PPP PP PP P PP P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 37.1 bits (82), Expect = 0.022 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 588 PPNSDVAXPXXTIXIPXVXPPXXPPPXAPPXXXPPXXXPKXXPPXSP 728 PP P P PP PPP PP PP P PP P Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 37.1 bits (82), Expect = 0.022 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +3 Query: 588 PPNSDVAXPXXTIXIPXVXPPXXPPPXAPPXXXPPXXXPKXXPPXSP 728 PP S P P P PPP PP PP P PP +P Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 Score = 37.1 bits (82), Expect = 0.022 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 588 PPNSDVAXPXXTIXIPXVXPPXXPPPXAPPXXXPPXXXPKXXPPXSP 728 PP P P PP PPP PP PP P PP P Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 37.1 bits (82), Expect = 0.022 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 588 PPNSDVAXPXXTIXIPXVXPPXXPPPXAPPXXXPPXXXPKXXPPXSP 728 PP P P PP PPP PP PP P PP P Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 36.7 bits (81), Expect = 0.029 Identities = 20/65 (30%), Positives = 20/65 (30%) Frame = +3 Query: 633 PXVXPPXXPPPXAPPXXXPPXXXPKXXPPXSPXGXXXXXSXTPXXXXXXXGXXXPPPPGX 812 P PP PP PP PP P PP P P PPPP Sbjct: 369 PPPPPPPPSPP-PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Query: 813 XXXPP 827 PP Sbjct: 428 PPPPP 432 Score = 35.9 bits (79), Expect = 0.050 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 588 PPNSDVAXPXXTIXIPXVXPPXXPPPXAPPXXXPPXXXPKXXPPXSP 728 PP S P P PP PPP PP P P PP P Sbjct: 385 PPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 35.1 bits (77), Expect = 0.087 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +3 Query: 588 PPNSDVAXPXXTIXIPXVXPPXXPPPXAPPXXXPPXXXPKXXPPXSP 728 PP+ P P P PPP PP PP P PP P Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 35.1 bits (77), Expect = 0.087 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 588 PPNSDVAXPXXTIXIPXVXPPXXPPPXAPPXXXPPXXXPKXXPP 719 PP P P PP PPP PP PP P PP Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 34.7 bits (76), Expect = 0.12 Identities = 21/71 (29%), Positives = 23/71 (32%) Frame = +3 Query: 516 TVKRPRCWRFSIGSAPLXSIXKXXPPNSDVAXPXXTIXIPXVXPPXXPPPXAPPXXXPPX 695 +V PR I + S PP P P PP P P PP PP Sbjct: 346 SVVNPRAIVTDISAGINMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPP 405 Query: 696 XXPKXXPPXSP 728 P PP P Sbjct: 406 PPPPPPPPPPP 416 Score = 34.7 bits (76), Expect = 0.12 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +3 Query: 588 PPNSDVAXPXXTIXIPXVXPPXXPPPXAPPXXXPPXXXPKXXPPXSP 728 PP + P P PP PP PP PP P PP P Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 588 PPNSDVAXPXXTIXIPXVXPPXXPPPXAPPXXXPPXXXPKXXPPXSP 728 PP P P PP PPP PP PP PP P Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 588 PPNSDVAXPXXTIXIPXVXPPXXPPPXAPPXXXPPXXXPKXXPP 719 PP P P PP PPP PP PP PP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 56.4 bits (130), Expect = 3e-08 Identities = 35/108 (32%), Positives = 36/108 (33%), Gaps = 10/108 (9%) Frame = +1 Query: 658 PPXXPPPXXPPXXXXXXPXPPXPXWGXXGXXPXPPXXXXPXXGXGXPP------XRGXXX 819 P PPP P P PP P P PP P G PP G Sbjct: 108 PTPPPPP-RAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPP 166 Query: 820 XPPXTP----PXPXXPXNXPXXPPPXKTXXPPXPPPXXPXSPPVFSXA 951 PP P P P P PPP PP PPP P PP+ A Sbjct: 167 PPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILELA 214 Score = 50.0 bits (114), Expect = 3e-06 Identities = 31/100 (31%), Positives = 31/100 (31%), Gaps = 3/100 (3%) Frame = +1 Query: 634 PXCXPPXXPPXXPPPXXPPXXXXXXPXPPXPXWGXXGXXPXPPXXXXPXXGXGXPPXRGX 813 P P P P P PP PP P P PP P G PP Sbjct: 112 PPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPP--- 168 Query: 814 XXXPPXTPPXPXXPXNXPXXPPPX---KTXXPPXPPPXXP 924 P T P P P PPP PP PPP P Sbjct: 169 PIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPP 208 Score = 50.0 bits (114), Expect = 3e-06 Identities = 28/91 (30%), Positives = 28/91 (30%), Gaps = 2/91 (2%) Frame = +1 Query: 646 PPXXPPXXPPPXXPPXXXXXXPXPPXPXWGXXGXXPXPPXXXXPXXGXGXP--PXRGXXX 819 PP P PP PP PP P P PP P P P Sbjct: 129 PPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASP 188 Query: 820 XPPXTPPXPXXPXNXPXXPPPXKTXXPPXPP 912 PP P P P P PPP P PP Sbjct: 189 PPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 37.1 bits (82), Expect = 0.022 Identities = 33/120 (27%), Positives = 34/120 (28%), Gaps = 12/120 (10%) Frame = +2 Query: 632 TPRVXPPXXPPXRPPXXXPPXXXTXXXSPXFPXGEXXGLXLYPPPXXXPXXGXXXPP--- 802 TP V P PP P + SP P PPP P G PP Sbjct: 99 TPMVAQSVAPTPPPP-PRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPI 157 Query: 803 ---XGGXXXTPP------XPXPXXPXPXTXPXXPPRXKQXXPXAPPPGXRXPXXFFRXPP 955 GG PP P P P P P P PPP P PP Sbjct: 158 APATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAPP 217 Score = 35.1 bits (77), Expect = 0.087 Identities = 24/82 (29%), Positives = 26/82 (31%), Gaps = 2/82 (2%) Frame = +3 Query: 588 PPNSDV--AXPXXTIXIPXVXPPXXPPPXAPPXXXPPXXXPKXXPPXSPXGXXXXXSXTP 761 PP S A P P P PPP AP PP P P + +P Sbjct: 129 PPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASP 188 Query: 762 XXXXXXXGXXXPPPPGXXXXPP 827 G PPPP PP Sbjct: 189 --PPPSGGPPPPPPPPPPPPPP 208 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 634 PXCXPPXXPPXXPPPXXPPXXXXXXPXPPXPXWG 735 P PP PP PPP PP P PP G Sbjct: 191 PSGGPPPPPPPPPPPPPPPILELAAPPPPGSVLG 224 Score = 33.5 bits (73), Expect = 0.27 Identities = 27/100 (27%), Positives = 29/100 (29%), Gaps = 8/100 (8%) Frame = +3 Query: 639 VXPPXXPPPXAP------PXXXPPXXXP--KXXPPXSPXGXXXXXSXTPXXXXXXXGXXX 794 V P PPP AP P PP P + PP P P G Sbjct: 106 VAPTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPP 165 Query: 795 PPPPGXXXXPPLXPXXXXLXRKXXLXXPPGXNXFXPXPPP 914 PPPP P + PP P PPP Sbjct: 166 PPPP---IAPAATVPAPAVPLAAASPPPPSGGPPPPPPPP 202 Score = 29.9 bits (64), Expect = 3.3 Identities = 21/70 (30%), Positives = 23/70 (32%), Gaps = 8/70 (11%) Frame = +1 Query: 751 PXPPXXXXPXXGXGXPPXRGXXXXPPXTPPXPXXPXN----XPXXPPP--XKTXXPPXPP 912 P P PP P P P P + P PPP T PP PP Sbjct: 96 PTPTPMVAQSVAPTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPP 155 Query: 913 PXXPXS--PP 936 P P + PP Sbjct: 156 PIAPATGGPP 165 Score = 28.7 bits (61), Expect = 7.6 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 633 PXVXPPXXPPPXAPPXXXPPXXXPKXXPPXSPXG 734 P PP PPP PP P PP S G Sbjct: 191 PSGGPPPPPPPPPPPPPPPILELAAPPPPGSVLG 224 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 55.6 bits (128), Expect = 6e-08 Identities = 33/102 (32%), Positives = 34/102 (33%), Gaps = 5/102 (4%) Frame = +1 Query: 646 PPXXPPXXPPPXXPPXXXXXXPXPPXPXWGXXGXXPXPPXXXXPXX---GXGXPPXRGXX 816 PP P P PP P PP P P PP P G PP G Sbjct: 305 PPPPPSRGSAPPPPPARMGTAPPPPPP--SRSSQRPPPPSRGAPPPPSMGMAPPPVGGAA 362 Query: 817 XXPPXTPPXPXXPXNXPXXP--PPXKTXXPPXPPPXXPXSPP 936 PP PP P P PP PP PPP +PP Sbjct: 363 PPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPP 404 Score = 44.0 bits (99), Expect = 2e-04 Identities = 32/106 (30%), Positives = 32/106 (30%), Gaps = 7/106 (6%) Frame = +2 Query: 635 PRVXPPXXPPXRPPXXXPPXXXTXXXSPXFPXGEXXGLXLYPPP----XXXPXXGXXXPP 802 P P PP R PP P P PPP P G PP Sbjct: 300 PSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRP--PPPSRGAPPPPSMGMAPPP 357 Query: 803 XGGXXXTPPXPXP---XXPXPXTXPXXPPRXKQXXPXAPPPGXRXP 931 GG PP P P P P PP P PPPG P Sbjct: 358 VGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAP 403 Score = 40.7 bits (91), Expect = 0.002 Identities = 27/84 (32%), Positives = 29/84 (34%), Gaps = 5/84 (5%) Frame = +1 Query: 742 GXXPXPPXXXXPXXGXGXPPX-RGXXXXPPXT----PPXPXXPXNXPXXPPPXKTXXPPX 906 G P PP P G PP RG PP PP P P PPP ++ P Sbjct: 284 GIQPPPP----PSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPP 339 Query: 907 PPPXXPXSPPVFSXAXXXXXXAXP 978 PP PP A A P Sbjct: 340 PPSRGAPPPPSMGMAPPPVGGAAP 363 Score = 40.7 bits (91), Expect = 0.002 Identities = 27/94 (28%), Positives = 28/94 (29%), Gaps = 1/94 (1%) Frame = +1 Query: 658 PPXXPPPXXPPXXXXXXPXPPXPXWGXXGXXPXPPXXXXPXXGXGXPPXRGXXXXPPXTP 837 PP P P PP P G P PP PP R PP + Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPS---RGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSR 343 Query: 838 PXPXXPXNXPXXPPPX-KTXXPPXPPPXXPXSPP 936 P P PP PP PPP PP Sbjct: 344 GAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPP 377 Score = 38.3 bits (85), Expect = 0.009 Identities = 27/95 (28%), Positives = 30/95 (31%) Frame = +2 Query: 647 PPXXPPXRPPXXXPPXXXTXXXSPXFPXGEXXGLXLYPPPXXXPXXGXXXPPXGGXXXTP 826 PP PP R PP P + + PPP PP G P Sbjct: 326 PPPPPPSRSSQRPPPPSRGAPPPP--------SMGMAPPPVGGAAPPPPPPPPVGGP--P 375 Query: 827 PXPXPXXPXPXTXPXXPPRXKQXXPXAPPPGXRXP 931 P P P P + PP APPPG P Sbjct: 376 PPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGPMIP 410 Score = 33.9 bits (74), Expect = 0.20 Identities = 32/119 (26%), Positives = 35/119 (29%), Gaps = 9/119 (7%) Frame = +2 Query: 641 VXPPXXP-----PXRPPXXXPPXXXTXXXSPXFPXGEXXGLXLYPPPXXXPXXGXXXPPX 805 + PP P P P PP + +P P G PPP P PP Sbjct: 285 IQPPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARM-GTAPPPPP---PSRSSQRPPP 340 Query: 806 GGXXXTPPXPXPXXPXPX---TXPXXPPRXKQXXPXAPPP-GXRXPXXFFRXPPXXSXG 970 PP P P P PP P PPP R P PP G Sbjct: 341 PSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPG 399 Score = 33.9 bits (74), Expect = 0.20 Identities = 31/115 (26%), Positives = 33/115 (28%), Gaps = 6/115 (5%) Frame = +3 Query: 588 PPNSDVAXPXXTIXIPXVXP---PXXPPPXAPPXXXPPXXXP---KXXPPXSPXGXXXXX 749 PP+ A P + P P PPP A PP P PP G Sbjct: 290 PPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPP 349 Query: 750 SXTPXXXXXXXGXXXPPPPGXXXXPPLXPXXXXLXRKXXLXXPPGXNXFXPXPPP 914 S PPPP PP P L PP P PPP Sbjct: 350 SMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPP------PPPPP 398 Score = 31.1 bits (67), Expect = 1.4 Identities = 25/78 (32%), Positives = 27/78 (34%), Gaps = 3/78 (3%) Frame = +2 Query: 746 LXLYPPPXXXPXXGXXXPPXGGXXXTPPXPXPXXPXPXTXPXXPPRXKQXXPXAPPP--- 916 L + PPP P G PP PP P P + P PP P PPP Sbjct: 283 LGIQPPP--PPSRGAAPPPPS--RGAPPPP----PSRGSAPPPPPARMGTAPPPPPPSRS 334 Query: 917 GXRXPXXFFRXPPXXSXG 970 R P PP S G Sbjct: 335 SQRPPPPSRGAPPPPSMG 352 Score = 31.1 bits (67), Expect = 1.4 Identities = 22/77 (28%), Positives = 23/77 (29%), Gaps = 5/77 (6%) Frame = +2 Query: 758 PPPXXXPXXGXXXPPXGGXXXTPPXPX-----PXXPXPXTXPXXPPRXKQXXPXAPPPGX 922 PPP P G PP PP P P P P PP + P P G Sbjct: 297 PPP---PSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGM 353 Query: 923 RXPXXFFRXPPXXSXGP 973 P PP P Sbjct: 354 APPPVGGAAPPPPPPPP 370 Score = 30.7 bits (66), Expect = 1.9 Identities = 20/63 (31%), Positives = 22/63 (34%) Frame = +3 Query: 546 SIGSAPLXSIXKXXPPNSDVAXPXXTIXIPXVXPPXXPPPXAPPXXXPPXXXPKXXPPXS 725 S G+ P S+ PP A P P P PPP PP P PP Sbjct: 342 SRGAPPPPSMGMAPPPVGGAAPPP-----PPPPPVGGPPPPPPPIEGRPPSSLGNPPPPP 396 Query: 726 PXG 734 P G Sbjct: 397 PPG 399 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 2/45 (4%) Frame = +1 Query: 634 PXCXPPXXPPXXPPP--XXPPXXXXXXPXPPXPXWGXXGXXPXPP 762 P P PP PPP PP P PP P G P P Sbjct: 366 PPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGPMIP 410 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 54.0 bits (124), Expect = 2e-07 Identities = 32/92 (34%), Positives = 33/92 (35%), Gaps = 3/92 (3%) Frame = +1 Query: 673 PPXXPPXXXXXXPXPPXPXWGXXGXXPXPPXXXXPXXGXGXPPXRGXXXXPPXTPPXPXX 852 P PP P PP P G P PP P PP G PP PP Sbjct: 910 PSASPPGGSV--PPPPPPPGGNAPLPPPPPGGSAP----SQPPPPGGNAPPPPPPPGGSA 963 Query: 853 PX---NXPXXPPPXKTXXPPXPPPXXPXSPPV 939 P P PPP PP PPP P PP+ Sbjct: 964 PPPGGGAPPLPPPPGGSAPPPPPPPPPPPPPM 995 Score = 54.0 bits (124), Expect = 2e-07 Identities = 32/92 (34%), Positives = 32/92 (34%), Gaps = 2/92 (2%) Frame = +1 Query: 646 PPXXPPXXPPPXXPPXXXXXXPXPPXPXWGXXGXXPXPPXXXXPXXGXGXPPXRGXXXXP 825 P PP P PP P PP P G P PP P PP G P Sbjct: 910 PSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPP----PPPPPGGSAPP 965 Query: 826 P--XTPPXPXXPXNXPXXPPPXKTXXPPXPPP 915 P PP P P PPP PP PPP Sbjct: 966 PGGGAPPLPPPPGGSAPPPPP---PPPPPPPP 994 Score = 39.9 bits (89), Expect = 0.003 Identities = 32/96 (33%), Positives = 33/96 (34%), Gaps = 1/96 (1%) Frame = +2 Query: 641 VXPPXXPPX-RPPXXXPPXXXTXXXSPXFPXGEXXGLXLYPPPXXXPXXGXXXPPXGGXX 817 V PP PP P PP + P P G PP P G PP GG Sbjct: 919 VPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNA-------PPPPPPPGGSAPPPGGG-- 969 Query: 818 XTPPXPXPXXPXPXTXPXXPPRXKQXXPXAPPPGXR 925 PP P P P P PP P PPP R Sbjct: 970 -APPLPPP--PGGSAPPPPPP------PPPPPPPMR 996 Score = 36.7 bits (81), Expect = 0.029 Identities = 22/68 (32%), Positives = 22/68 (32%), Gaps = 2/68 (2%) Frame = +2 Query: 758 PPPXXXPXXGXXXPPXGGXXXTPPXPXPXXPXPXTXPXX--PPRXKQXXPXAPPPGXRXP 931 PPP PP G PP P P P P PP P PPPG P Sbjct: 923 PPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAP 982 Query: 932 XXFFRXPP 955 PP Sbjct: 983 PPPPPPPP 990 Score = 35.5 bits (78), Expect = 0.066 Identities = 26/90 (28%), Positives = 28/90 (31%) Frame = +3 Query: 645 PPXXPPPXAPPXXXPPXXXPKXXPPXSPXGXXXXXSXTPXXXXXXXGXXXPPPPGXXXXP 824 P PP + P PP PP P G P PPPPG P Sbjct: 910 PSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPP----GGNAPPPPPPPGGSAPP 965 Query: 825 PLXPXXXXLXRKXXLXXPPGXNXFXPXPPP 914 P L PPG + P PPP Sbjct: 966 P-------GGGAPPLPPPPGGSAPPPPPPP 988 Score = 34.7 bits (76), Expect = 0.12 Identities = 21/80 (26%), Positives = 21/80 (26%) Frame = +3 Query: 588 PPNSDVAXPXXTIXIPXVXPPXXPPPXAPPXXXPPXXXPKXXPPXSPXGXXXXXSXTPXX 767 PP V P PP P AP PP PP P Sbjct: 914 PPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPL 973 Query: 768 XXXXXGXXXPPPPGXXXXPP 827 G PPPP PP Sbjct: 974 PPPPGGSAPPPPPPPPPPPP 993 Score = 33.5 bits (73), Expect = 0.27 Identities = 25/91 (27%), Positives = 25/91 (27%) Frame = +2 Query: 659 PPXRPPXXXPPXXXTXXXSPXFPXGEXXGLXLYPPPXXXPXXGXXXPPXGGXXXTPPXPX 838 P P P S P G PPP PP GG PP P Sbjct: 900 PSQTPGGSESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGN-APPPPPP 958 Query: 839 PXXPXPXTXPXXPPRXKQXXPXAPPPGXRXP 931 P P PP APPP P Sbjct: 959 PGGSAPPPGGGAPPLPPPPGGSAPPPPPPPP 989 Score = 32.3 bits (70), Expect = 0.62 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 6/59 (10%) Frame = +2 Query: 797 PPXGGXXXTPPXPXPXXPXPXTXP------XXPPRXKQXXPXAPPPGXRXPXXFFRXPP 955 PP G PP P P P P PP P PPPG P PP Sbjct: 914 PPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPP 972 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +1 Query: 646 PPXXPPXXPPPXXPPXXXXXXPXPPXPXWGXXGXXPXPPXXXXPXXGXG 792 PP PP P PP P PP P P PP P G Sbjct: 953 PPPPPP--PGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPPMRKLG 999 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 52.8 bits (121), Expect = 4e-07 Identities = 43/142 (30%), Positives = 44/142 (30%) Frame = -3 Query: 935 GGEXGXXGGGXGGKXVXXGGGXKGXFXGKXGXGGVKGGXXXXPRXGGXPXPXXGXXXXGG 756 GG G GG GG GGG G G G GG G GG G GG Sbjct: 40 GGATGGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGG 99 Query: 755 XGXXPXXPXXGXGGXGFXXXXXGGXXGGGXXGGXXGGXHXGYXYSXXGXRHI*IGXXXFG 576 G GG G GG G GG GG H G G G G Sbjct: 100 GGGATGGGGGATGGHG--GATGGGVGATGGHGGATGG-HGGATGGHGGATGGGGGATGGG 156 Query: 575 DAVQGGGAYGKTPATRPFYGSW 510 GGG T + SW Sbjct: 157 GGATGGGGGATGGVTMTCFISW 178 Score = 37.9 bits (84), Expect = 0.012 Identities = 32/111 (28%), Positives = 32/111 (28%) Frame = -2 Query: 972 GPXXXXGGXRKNXXGXRXPGGGAXGXXCFXRGGXXGXVXGXGXXGXGXGGVXXXPPXGGX 793 G GG G GGGA G GG G G G G GG GG Sbjct: 67 GATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGA-----TGGG 121 Query: 792 XXPXXGXXXGGGXRXXPXXSPXGXXGXXXXVXXXGGXXXGGRXGGXXGGXT 640 G G G G GG GG GG GG T Sbjct: 122 VGATGGHGGATGGHGGATGGHGGATGGGGGATGGGGGATGG-GGGATGGVT 171 Score = 35.1 bits (77), Expect = 0.087 Identities = 29/89 (32%), Positives = 29/89 (32%) Frame = -3 Query: 899 GKXVXXGGGXKGXFXGKXGXGGVKGGXXXXPRXGGXPXPXXGXXXXGGXGXXPXXPXXGX 720 G V GG G G GG GG GG G GG G Sbjct: 34 GVVVGHGGATGGHGGATGGGGGATGG---GATGGGGGATGGGGGATGGHGGATGGGGGAT 90 Query: 719 GGXGFXXXXXGGXXGGGXXGGXXGGXHXG 633 G G GG GGG GG GG H G Sbjct: 91 GDGGGATGGGGGATGGG--GGATGG-HGG 116 Score = 35.1 bits (77), Expect = 0.087 Identities = 35/121 (28%), Positives = 36/121 (29%), Gaps = 11/121 (9%) Frame = -2 Query: 954 GGXRKNXXGXRXPGGGAXGXXCFXRGGXXGXVXG----XGXXGXGXGGVXXXPPXGGXXX 787 GG G GGGA G GG G G G G GG GG Sbjct: 52 GGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGAT 111 Query: 786 PXXGXXXGG-----GXRXXPXXSPXGXXGXXXXVXXXGGXXXGGRXG--GXXGGXTRGVX 628 G GG G G G GG GG G G GG T GV Sbjct: 112 GGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGGGGGATGGGGGATGGVT 171 Query: 627 L 625 + Sbjct: 172 M 172 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 52.8 bits (121), Expect = 4e-07 Identities = 45/131 (34%), Positives = 48/131 (36%) Frame = -3 Query: 941 KTGGEXGXXGGGXGGKXVXXGGGXKGXFXGKXGXGGVKGGXXXXPRXGGXPXPXXGXXXX 762 K G G GGG GG GG G G G GG +GG GG G Sbjct: 120 KDSGGGGRRGGGYGGGRGGGGGYRSGG--GYRGGGGYRGG------GGGYRGRGRGGGGY 171 Query: 761 GGXGXXPXXPXXGXGGXGFXXXXXGGXXGGGXXGGXXGGXHXGYXYSXXGXRHI*IGXXX 582 GG G G GG G GG GGG GG GG + G Y G G Sbjct: 172 GGGG-------YGGGGYGGGGHGGGGYGGGGYGGG--GGGYGGSGYGGGGG----YGGGG 218 Query: 581 FGDAVQGGGAY 549 +G GGG Y Sbjct: 219 YGGGRSGGGGY 229 Score = 46.0 bits (104), Expect = 5e-05 Identities = 36/105 (34%), Positives = 38/105 (36%) Frame = -3 Query: 935 GGEXGXXGGGXGGKXVXXGGGXKGXFXGKXGXGGVKGGXXXXPRXGGXPXPXXGXXXXGG 756 GG G GG G GGG +G G G G GG GG G G Sbjct: 133 GGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGR-GGGGYGGGGYGGGGYGGGGHGGGGY 191 Query: 755 XGXXPXXPXXGXGGXGFXXXXXGGXXGGGXXGGXXGGXHXGYXYS 621 G G GG G+ GG GGG GG GG GY S Sbjct: 192 GGGGYGGGGGGYGGSGY--GGGGGYGGGGYGGGRSGG--GGYEVS 232 Score = 36.7 bits (81), Expect = 0.029 Identities = 31/103 (30%), Positives = 31/103 (30%) Frame = -2 Query: 954 GGXRKNXXGXRXPGGGAXGXXCFXRGGXXGXVXGXGXXGXGXGGVXXXPPXGGXXXPXXG 775 GG R G GGG RGG G G G G GG G G Sbjct: 125 GGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGG 184 Query: 774 XXXGGGXRXXPXXSPXGXXGXXXXVXXXGGXXXGGRXGGXXGG 646 GGG G G GG GG GG GG Sbjct: 185 GHGGGGYGGGGYGGGGGGYG-GSGYGGGGGYGGGGYGGGRSGG 226 Score = 35.1 bits (77), Expect = 0.087 Identities = 33/102 (32%), Positives = 35/102 (34%), Gaps = 2/102 (1%) Frame = -3 Query: 845 GXGGVKGGXXXXPRXGGXPXPXXGXXXXGGX--GXXPXXPXXGXGGXGFXXXXXGGXXGG 672 G GG +GG R GG G GG G G GG G+ GG GG Sbjct: 123 GGGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGG---GGYGGG 179 Query: 671 GXXGGXXGGXHXGYXYSXXGXRHI*IGXXXFGDAVQGGGAYG 546 G GG GG GY G G GG YG Sbjct: 180 GYGGGGHGGG--GYGGGGYGG----------GGGGYGGSGYG 209 Score = 32.3 bits (70), Expect = 0.62 Identities = 26/78 (33%), Positives = 28/78 (35%), Gaps = 4/78 (5%) Frame = -3 Query: 719 GGXGFXXXXXGGXXGGGXX----GGXXGGXHXGYXYSXXGXRHI*IGXXXFGDAVQGGGA 552 GG G GG GGG GG GG GY G R G +G GGG Sbjct: 123 GGGGRRGGGYGGGRGGGGGYRSGGGYRGGG--GYRGGGGGYRGRGRGGGGYGGGGYGGGG 180 Query: 551 YGKTPATRPFYGSWPFAG 498 YG YG + G Sbjct: 181 YGGGGHGGGGYGGGGYGG 198 Score = 29.5 bits (63), Expect = 4.3 Identities = 22/69 (31%), Positives = 23/69 (33%), Gaps = 3/69 (4%) Frame = -2 Query: 954 GGXRKNXXGXRXPGGGAXGXXCFXRGGXXGXVXGXGXXG---XGXGGVXXXPPXGGXXXP 784 GG R G GGG G + GG G G G G G GG G Sbjct: 159 GGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGG 218 Query: 783 XXGXXXGGG 757 G GGG Sbjct: 219 YGGGRSGGG 227 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 52.4 bits (120), Expect = 5e-07 Identities = 27/70 (38%), Positives = 27/70 (38%), Gaps = 2/70 (2%) Frame = +1 Query: 733 GXXGXXPXPPXXXXPXXGXGXPPXRGXXXXPPXT--PPXPXXPXNXPXXPPPXKTXXPPX 906 G G P PP P PP PP T PP P P N P PPP PP Sbjct: 340 GGGGVNPPPPPTNNPPSPP--PPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPP 397 Query: 907 PPPXXPXSPP 936 PPP PP Sbjct: 398 PPPTNGPPPP 407 Score = 46.0 bits (104), Expect = 5e-05 Identities = 25/69 (36%), Positives = 25/69 (36%), Gaps = 2/69 (2%) Frame = +1 Query: 715 PPXPXWGXXGXXPXPPXXXXPXXGXGXPPXRGXXXXPPXT--PPXPXXPXNXPXXPPPXK 888 PP P P P P PP PP T PP P P N P PPP Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPP----PPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPT 401 Query: 889 TXXPPXPPP 915 PP PPP Sbjct: 402 NGPPPPPPP 410 Score = 43.2 bits (97), Expect = 3e-04 Identities = 32/88 (36%), Positives = 32/88 (36%), Gaps = 2/88 (2%) Frame = +1 Query: 646 PPXXPPXXPPPXXPPXXXXXXPXPPXPXWGXXGXXPXPPXXXXPXXGXGXPPXRGXXXXP 825 PP PP P PP P PP P P PP PP G P Sbjct: 346 PP--PPPTNNPPSPPPPTNNTPPPPPP----TNKPPPPP-----------PPTNGPPPPP 388 Query: 826 PXT--PPXPXXPXNXPXXPPPXKTXXPP 903 P T PP P P N P PPP T PP Sbjct: 389 PPTNGPPPPPPPTNGP-PPPPPPTNGPP 415 Score = 38.3 bits (85), Expect = 0.009 Identities = 28/81 (34%), Positives = 28/81 (34%), Gaps = 3/81 (3%) Frame = +1 Query: 634 PXCXPPXXPPXXPPPXX---PPXXXXXXPXPPXPXWGXXGXXPXPPXXXXPXXGXGXPPX 804 P P PP PPP PP P PP P G P PP P G PP Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPP--TNGPPPPPP----PTNGPPPPP- 398 Query: 805 RGXXXXPPXTPPXPXXPXNXP 867 P PP P P N P Sbjct: 399 -----PPTNGPPPPPPPTNGP 414 Score = 37.1 bits (82), Expect = 0.022 Identities = 29/97 (29%), Positives = 31/97 (31%) Frame = +2 Query: 641 VXPPXXPPXRPPXXXPPXXXTXXXSPXFPXGEXXGLXLYPPPXXXPXXGXXXPPXGGXXX 820 V PP P PP PP T P P + PPP P G PP Sbjct: 344 VNPPPPPTNNPPSPPPPTNNTPPPPP--PTNK-------PPPPPPPTNGPPPPP------ 388 Query: 821 TPPXPXPXXPXPXTXPXXPPRXKQXXPXAPPPGXRXP 931 PP P P P T PP P + R P Sbjct: 389 -PPTNGPPPPPPPTNGPPPPPPPTNGPPSEGKCGRKP 424 Score = 36.3 bits (80), Expect = 0.038 Identities = 24/83 (28%), Positives = 26/83 (31%), Gaps = 2/83 (2%) Frame = +2 Query: 731 GEXXGLXLYPPPXXXPXXGXXXPPXGGXXXTPP--XPXPXXPXPXTXPXXPPRXKQXXPX 904 G G + PPP PP PP P P P P PP P Sbjct: 337 GTSGGGGVNPPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPP 396 Query: 905 APPPGXRXPXXFFRXPPXXSXGP 973 PPP P PP + GP Sbjct: 397 PPPPTNGPP-----PPPPPTNGP 414 Score = 33.9 bits (74), Expect = 0.20 Identities = 21/68 (30%), Positives = 22/68 (32%) Frame = +3 Query: 633 PXVXPPXXPPPXAPPXXXPPXXXPKXXPPXSPXGXXXXXSXTPXXXXXXXGXXXPPPPGX 812 P P PPP P PP P PP P + P G PPPP Sbjct: 349 PPTNNPPSPPP--PTNNTPPPPPPTNKPPPPP----PPTNGPPPPPPPTNGPPPPPPPTN 402 Query: 813 XXXPPLXP 836 PP P Sbjct: 403 GPPPPPPP 410 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = +3 Query: 588 PPNSDVAXPXXTIXIPXVXPPXX-PPPXAPPXXXPPXXXPKXXPPXSP 728 P N+ + P T P PP PPP PP PP P P P Sbjct: 350 PTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPP 397 Score = 32.3 bits (70), Expect = 0.62 Identities = 18/65 (27%), Positives = 18/65 (27%) Frame = +1 Query: 634 PXCXPPXXPPXXPPPXXPPXXXXXXPXPPXPXWGXXGXXPXPPXXXXPXXGXGXPPXRGX 813 P P PP P PP P PP P G P P PP G Sbjct: 360 PTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPSEGK 419 Query: 814 XXXPP 828 P Sbjct: 420 CGRKP 424 Score = 32.3 bits (70), Expect = 0.62 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = +3 Query: 588 PPNSDVAXPXXTIXIPXVXPPXX-PPPXAPPXXXPPXXXPKXXPPXSP 728 P N+ P T P PP PPP PP PP P P P Sbjct: 360 PTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPP 407 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = +3 Query: 588 PPNSDVAXPXXTIXIPXVXPPXX-PPPXAPPXXXPPXXXPKXXPPXS 725 P N P T P PP PPP PP PP P P S Sbjct: 370 PTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPS 416 Score = 30.3 bits (65), Expect = 2.5 Identities = 16/45 (35%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +3 Query: 588 PPNSDVAXPXXTIXIPXVXPPXXPPP-XAPPXXXPPXXXPKXXPP 719 PP ++ P P PP PPP PP PP P PP Sbjct: 359 PPTNNTPPPPP----PTNKPPPPPPPTNGPPPPPPPTNGPPPPPP 399 Score = 29.5 bits (63), Expect = 4.3 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 2/58 (3%) Frame = +2 Query: 635 PRVXPPXX--PPXRPPXXXPPXXXTXXXSPXFPXGEXXGLXLYPPPXXXPXXGXXXPP 802 P PP PP PP PP P P G PPP P G PP Sbjct: 355 PSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNG----PPPPPPPTNGPPPPP 408 Score = 29.1 bits (62), Expect = 5.7 Identities = 20/67 (29%), Positives = 21/67 (31%), Gaps = 2/67 (2%) Frame = +3 Query: 612 PXXTIXIPXVXPPXXPPPXAPP--XXXPPXXXPKXXPPXSPXGXXXXXSXTPXXXXXXXG 785 P T P PP P PP PP P PP P + P G Sbjct: 348 PPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPP----PPTNGPPPPPPPTNG 403 Query: 786 XXXPPPP 806 PPPP Sbjct: 404 PPPPPPP 410 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 51.2 bits (117), Expect = 1e-06 Identities = 35/98 (35%), Positives = 35/98 (35%) Frame = -3 Query: 938 TGGEXGXXGGGXGGKXVXXGGGXKGXFXGKXGXGGVKGGXXXXPRXGGXPXPXXGXXXXG 759 TGG G GGG G GGG G G G GG G GG G G Sbjct: 261 TGGGGGATGGGGGA--TGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATG 318 Query: 758 GXGXXPXXPXXGXGGXGFXXXXXGGXXGGGXXGGXXGG 645 G G GG G GG GGG GG GG Sbjct: 319 GGGGATGGGVGATGGGGGATGGGGGVTGGG--GGATGG 354 Score = 50.4 bits (115), Expect = 2e-06 Identities = 34/102 (33%), Positives = 34/102 (33%) Frame = -3 Query: 938 TGGEXGXXGGGXGGKXVXXGGGXKGXFXGKXGXGGVKGGXXXXPRXGGXPXPXXGXXXXG 759 TGG G GGG GG GG G G GG GG GG G G Sbjct: 247 TGGGGGATGGG-GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGG 305 Query: 758 GXGXXPXXPXXGXGGXGFXXXXXGGXXGGGXXGGXXGGXHXG 633 G G GG G G GGG G GG G Sbjct: 306 GGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGG 347 Score = 47.2 bits (107), Expect = 2e-05 Identities = 32/98 (32%), Positives = 32/98 (32%) Frame = -3 Query: 938 TGGEXGXXGGGXGGKXVXXGGGXKGXFXGKXGXGGVKGGXXXXPRXGGXPXPXXGXXXXG 759 TGG G GGG GG GG G G GG GG GG G G Sbjct: 268 TGGGGGATGGG-GGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGG 326 Query: 758 GXGXXPXXPXXGXGGXGFXXXXXGGXXGGGXXGGXXGG 645 G G GG G G GGG G G Sbjct: 327 GVGATGGGGGATGGGGGVTGGGGGATGGGGGPGSGGCG 364 Score = 46.8 bits (106), Expect = 3e-05 Identities = 33/102 (32%), Positives = 33/102 (32%) Frame = -3 Query: 938 TGGEXGXXGGGXGGKXVXXGGGXKGXFXGKXGXGGVKGGXXXXPRXGGXPXPXXGXXXXG 759 TGG G GGG GG GG G G GG GG GG G Sbjct: 254 TGGGGGATGGG-GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGV 312 Query: 758 GXGXXPXXPXXGXGGXGFXXXXXGGXXGGGXXGGXXGGXHXG 633 G G GG G G GGG G GG G Sbjct: 313 GGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGG 354 Score = 44.4 bits (100), Expect = 1e-04 Identities = 34/102 (33%), Positives = 34/102 (33%) Frame = -3 Query: 938 TGGEXGXXGGGXGGKXVXXGGGXKGXFXGKXGXGGVKGGXXXXPRXGGXPXPXXGXXXXG 759 TGG G GGG G GGG G G G GG G GG G G Sbjct: 275 TGGGGGATGGGGGA--TGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATG 332 Query: 758 GXGXXPXXPXXGXGGXGFXXXXXGGXXGGGXXGGXXGGXHXG 633 G G GG G GG GGG G G G Sbjct: 333 GGG-------GATGGGGGVTGGGGGATGGGGGPGSGGCGEDG 367 Score = 42.7 bits (96), Expect = 4e-04 Identities = 39/134 (29%), Positives = 44/134 (32%), Gaps = 1/134 (0%) Frame = -3 Query: 944 EKTGGEXGXXGG-GXGGKXVXXGGGXKGXFXGKXGXGGVKGGXXXXPRXGGXPXPXXGXX 768 +++ G G G G GG GGG G G GG GG GG G Sbjct: 235 DRSNGRLGGGGATGGGGGATGGGGGATG------GGGGATGGGGGATGGGGGATGGGGGA 288 Query: 767 XXGGXGXXPXXPXXGXGGXGFXXXXXGGXXGGGXXGGXXGGXHXGYXYSXXGXRHI*IGX 588 GG G GG G G GGG G G G + G + G Sbjct: 289 TGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGG 348 Query: 587 XXFGDAVQGGGAYG 546 G A GGG G Sbjct: 349 ---GGATGGGGGPG 359 Score = 31.9 bits (69), Expect = 0.81 Identities = 23/71 (32%), Positives = 23/71 (32%) Frame = -2 Query: 972 GPXXXXGGXRKNXXGXRXPGGGAXGXXCFXRGGXXGXVXGXGXXGXGXGGVXXXPPXGGX 793 G GG G GGGA G GG G G G G GGV GG Sbjct: 294 GATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGG--GGGA 351 Query: 792 XXPXXGXXXGG 760 G GG Sbjct: 352 TGGGGGPGSGG 362 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 49.6 bits (113), Expect = 4e-06 Identities = 29/90 (32%), Positives = 29/90 (32%) Frame = +1 Query: 646 PPXXPPXXPPPXXPPXXXXXXPXPPXPXWGXXGXXPXPPXXXXPXXGXGXPPXRGXXXXP 825 P PP P PP P PP P G P PP P PP Sbjct: 308 PAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIA-PPPPPISKPPTSTRSAPPPPPGRAPQ 366 Query: 826 PXTPPXPXXPXNXPXXPPPXKTXXPPXPPP 915 P P P P PP K PP PPP Sbjct: 367 PLGGPPPPPPGR---RPPSGKINPPPPPPP 393 Score = 46.8 bits (106), Expect = 3e-05 Identities = 28/100 (28%), Positives = 31/100 (31%), Gaps = 6/100 (6%) Frame = +1 Query: 634 PXCXPPXXPPXXPPPXXPPXXXXXXPXPPXPXWGXX------GXXPXPPXXXXPXXGXGX 795 P PP PPP PP G G P PP P G Sbjct: 121 PALKPPGFRTTAPPPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGN 180 Query: 796 PPXRGXXXXPPXTPPXPXXPXNXPXXPPPXKTXXPPXPPP 915 P G PP P + PPP ++ PP PPP Sbjct: 181 KPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPP 220 Score = 41.1 bits (92), Expect = 0.001 Identities = 28/98 (28%), Positives = 30/98 (30%), Gaps = 3/98 (3%) Frame = +1 Query: 646 PPXXPPXXPPPXXPPXXXXXXPXPPXPXWGXXGXXPXPPXXXXPXXGXGXPPXRGXXXXP 825 PP P PP P PP P G PP PP P Sbjct: 194 PPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPP 253 Query: 826 ---PXTPPXPXXPXNXPXXPPPXKTXXPPXPPPXXPXS 930 P + P P N P PP + PP PP P S Sbjct: 254 MRGPTSGGEPPPPKNAP-PPPKRGSSNPPPPPTRGPPS 290 Score = 40.3 bits (90), Expect = 0.002 Identities = 28/101 (27%), Positives = 29/101 (28%), Gaps = 9/101 (8%) Frame = +1 Query: 661 PXXPPPXXPPXXXXXXPXPPXPXWGXXGXXPXPPXXXXPXXGXGX--------PPXRGXX 816 P PP PP PP P P PP P PP RG Sbjct: 280 PPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQI 339 Query: 817 XXPPXTPPXPXXPXNXPXXPPPXKTXXP-PXPPPXXPXSPP 936 PP P PPP + P PPP P P Sbjct: 340 APPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRP 380 Score = 39.9 bits (89), Expect = 0.003 Identities = 28/91 (30%), Positives = 30/91 (32%), Gaps = 2/91 (2%) Frame = +1 Query: 670 PPPXXPPXXXXXXPXPPXPXWGXXGXXPX-PPXXXXPXXGXGXPPXRGXXXXPPXTPPXP 846 PPP PP P P +G PP G PP PP PP Sbjct: 166 PPP--PPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPP--PPPG 221 Query: 847 XXPXNXPXXPPPXKTXXP-PXPPPXXPXSPP 936 P PPP + P P PPP PP Sbjct: 222 RGPSQRSLAPPPTGSSRPLPAPPPGENRPPP 252 Score = 39.1 bits (87), Expect = 0.005 Identities = 32/104 (30%), Positives = 33/104 (31%), Gaps = 2/104 (1%) Frame = +2 Query: 650 PXXPPXRPPXXXPPXXXTXXXSPXFPXGEXXGLXLYPPPXXXPXXGXXXPPXGGXXXTPP 829 P PP R PP P P + L PPP P G PP PP Sbjct: 298 PPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPL---PPP---PLRGQIAPPP------PP 345 Query: 830 XPXPXXPXPXTXPXXPPRXKQXX--PXAPPPGXRXPXXFFRXPP 955 P P P R Q P PPPG R P PP Sbjct: 346 ISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPP 389 Score = 38.7 bits (86), Expect = 0.007 Identities = 33/106 (31%), Positives = 34/106 (32%), Gaps = 8/106 (7%) Frame = +1 Query: 646 PPXXPPXXPPPXXPPXXXXXXPXPPXPXWGXX-GXXPXPPXXXXPXXGXGX-----PPXR 807 PP P P PP PP P G G P PP P G PP R Sbjct: 231 PPPTGSSRPLPAPPPGENR----PPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTR 286 Query: 808 GXXXXPPXT--PPXPXXPXNXPXXPPPXKTXXPPXPPPXXPXSPPV 939 G T PP P P PPP PP PP P+ Sbjct: 287 GPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSR--DQVPL 330 Score = 37.9 bits (84), Expect = 0.012 Identities = 28/106 (26%), Positives = 29/106 (27%), Gaps = 9/106 (8%) Frame = +1 Query: 646 PPXXPPXXPPPXXPPXXXXXXPXPPXPXWGXXGXXPXPPXXXXPXXGXGXPPXRGXXXXP 825 PP PPP P P P PP P P G P Sbjct: 207 PPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPP 266 Query: 826 PXTPPXPXXPXNXPXXPPPX-------KTXXPPXPP--PXXPXSPP 936 PP P + P PP T PP PP P PP Sbjct: 267 KNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPP 312 Score = 37.1 bits (82), Expect = 0.022 Identities = 28/109 (25%), Positives = 29/109 (26%) Frame = +2 Query: 647 PPXXPPXRPPXXXPPXXXTXXXSPXFPXGEXXGLXLYPPPXXXPXXGXXXPPXGGXXXTP 826 PP PP PP P G PPP P P G T Sbjct: 134 PPKNSSPPPPFGAPPPPDRGGQLAKKPS---QGSFPPPPPMGKPPPPSGNKPTFGNSRTS 190 Query: 827 PXPXPXXPXPXTXPXXPPRXKQXXPXAPPPGXRXPXXFFRXPPXXSXGP 973 P P PP + P PPPG PP S P Sbjct: 191 TNGPPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRP 239 Score = 37.1 bits (82), Expect = 0.022 Identities = 29/104 (27%), Positives = 31/104 (29%) Frame = +2 Query: 662 PXRPPXXXPPXXXTXXXSPXFPXGEXXGLXLYPPPXXXPXXGXXXPPXGGXXXTPPXPXP 841 P PP PP P F G PPP G PP PP P Sbjct: 166 PPPPPMGKPPPPS--GNKPTF--GNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPPG 221 Query: 842 XXPXPXTXPXXPPRXKQXXPXAPPPGXRXPXXFFRXPPXXSXGP 973 P + P + P APPPG P R P P Sbjct: 222 RGPSQRSLAPPPTGSSRPLP-APPPGENRPPPPMRGPTSGGEPP 264 Score = 35.5 bits (78), Expect = 0.066 Identities = 29/108 (26%), Positives = 30/108 (27%), Gaps = 6/108 (5%) Frame = +2 Query: 650 PXXPPXRPPXXXPPXXXTXXXSPXFPXGEXXGLXLYPPPXXXPXXGXXXPPXGGXXXTPP 829 P PP PP P P G PP PP G PP Sbjct: 194 PPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPP 253 Query: 830 XPXPXX----PXPXTXPXXPPRXKQXXPXAPPPGXRXPXXFF--RXPP 955 P P P P P R P PPP P F + PP Sbjct: 254 MRGPTSGGEPPPPKNAPPPPKRGSSNPP--PPPTRGPPSNSFTTQGPP 299 Score = 30.7 bits (66), Expect = 1.9 Identities = 27/109 (24%), Positives = 29/109 (26%) Frame = +3 Query: 588 PPNSDVAXPXXTIXIPXVXPPXXPPPXAPPXXXPPXXXPKXXPPXSPXGXXXXXSXTPXX 767 PP + P PP PP APP P P P P Sbjct: 244 PPGENRPPPPMRGPTSGGEPP--PPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLP 301 Query: 768 XXXXXGXXXPPPPGXXXXPPLXPXXXXLXRKXXLXXPPGXNXFXPXPPP 914 PPP PP P + L PP P PPP Sbjct: 302 PSRDQAPAPPPPLNATPPPP-PPSRD----QVPLPPPPLRGQIAPPPPP 345 Score = 30.3 bits (65), Expect = 2.5 Identities = 23/92 (25%), Positives = 25/92 (27%) Frame = +2 Query: 605 GXXPXDYXXTPRVXPPXXPPXRPPXXXPPXXXTXXXSPXFPXGEXXGLXLYPPPXXXPXX 784 G P + PP PP P + P G L PP P Sbjct: 193 GPPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPP 252 Query: 785 GXXXPPXGGXXXTPPXPXPXXPXPXTXPXXPP 880 P GG PP P P P PP Sbjct: 253 PMRGPTSGG---EPPPPKNAPPPPKRGSSNPP 281 Score = 29.1 bits (62), Expect = 5.7 Identities = 17/64 (26%), Positives = 19/64 (29%) Frame = +1 Query: 742 GXXPXPPXXXXPXXGXGXPPXRGXXXXPPXTPPXPXXPXNXPXXPPPXKTXXPPXPPPXX 921 G P P P PP + PP P P P + PP PP Sbjct: 115 GAGPRGPALKPPGFRTTAPPPKNSSPPPPFGAP-PPPDRGGQLAKKPSQGSFPPPPPMGK 173 Query: 922 PXSP 933 P P Sbjct: 174 PPPP 177 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 49.6 bits (113), Expect = 4e-06 Identities = 29/90 (32%), Positives = 29/90 (32%) Frame = +1 Query: 646 PPXXPPXXPPPXXPPXXXXXXPXPPXPXWGXXGXXPXPPXXXXPXXGXGXPPXRGXXXXP 825 P PP P PP P PP P G P PP P PP Sbjct: 220 PAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIA-PPPPPISKPPTSTRSAPPPPPGRAPQ 278 Query: 826 PXTPPXPXXPXNXPXXPPPXKTXXPPXPPP 915 P P P P PP K PP PPP Sbjct: 279 PLGGPPPPPPGR---RPPSGKINPPPPPPP 305 Score = 46.8 bits (106), Expect = 3e-05 Identities = 28/100 (28%), Positives = 31/100 (31%), Gaps = 6/100 (6%) Frame = +1 Query: 634 PXCXPPXXPPXXPPPXXPPXXXXXXPXPPXPXWGXX------GXXPXPPXXXXPXXGXGX 795 P PP PPP PP G G P PP P G Sbjct: 33 PALKPPGFRTTAPPPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGN 92 Query: 796 PPXRGXXXXPPXTPPXPXXPXNXPXXPPPXKTXXPPXPPP 915 P G PP P + PPP ++ PP PPP Sbjct: 93 KPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPP 132 Score = 41.1 bits (92), Expect = 0.001 Identities = 28/98 (28%), Positives = 30/98 (30%), Gaps = 3/98 (3%) Frame = +1 Query: 646 PPXXPPXXPPPXXPPXXXXXXPXPPXPXWGXXGXXPXPPXXXXPXXGXGXPPXRGXXXXP 825 PP P PP P PP P G PP PP P Sbjct: 106 PPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPP 165 Query: 826 ---PXTPPXPXXPXNXPXXPPPXKTXXPPXPPPXXPXS 930 P + P P N P PP + PP PP P S Sbjct: 166 MRGPTSGGEPPPPKNAP-PPPKRGSSNPPPPPTRGPPS 202 Score = 40.3 bits (90), Expect = 0.002 Identities = 28/101 (27%), Positives = 29/101 (28%), Gaps = 9/101 (8%) Frame = +1 Query: 661 PXXPPPXXPPXXXXXXPXPPXPXWGXXGXXPXPPXXXXPXXGXGX--------PPXRGXX 816 P PP PP PP P P PP P PP RG Sbjct: 192 PPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQI 251 Query: 817 XXPPXTPPXPXXPXNXPXXPPPXKTXXP-PXPPPXXPXSPP 936 PP P PPP + P PPP P P Sbjct: 252 APPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRP 292 Score = 39.9 bits (89), Expect = 0.003 Identities = 28/91 (30%), Positives = 30/91 (32%), Gaps = 2/91 (2%) Frame = +1 Query: 670 PPPXXPPXXXXXXPXPPXPXWGXXGXXPX-PPXXXXPXXGXGXPPXRGXXXXPPXTPPXP 846 PPP PP P P +G PP G PP PP PP Sbjct: 78 PPP--PPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPP--PPPG 133 Query: 847 XXPXNXPXXPPPXKTXXP-PXPPPXXPXSPP 936 P PPP + P P PPP PP Sbjct: 134 RGPSQRSLAPPPTGSSRPLPAPPPGENRPPP 164 Score = 39.1 bits (87), Expect = 0.005 Identities = 32/104 (30%), Positives = 33/104 (31%), Gaps = 2/104 (1%) Frame = +2 Query: 650 PXXPPXRPPXXXPPXXXTXXXSPXFPXGEXXGLXLYPPPXXXPXXGXXXPPXGGXXXTPP 829 P PP R PP P P + L PPP P G PP PP Sbjct: 210 PPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPL---PPP---PLRGQIAPPP------PP 257 Query: 830 XPXPXXPXPXTXPXXPPRXKQXX--PXAPPPGXRXPXXFFRXPP 955 P P P R Q P PPPG R P PP Sbjct: 258 ISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPP 301 Score = 38.7 bits (86), Expect = 0.007 Identities = 33/106 (31%), Positives = 34/106 (32%), Gaps = 8/106 (7%) Frame = +1 Query: 646 PPXXPPXXPPPXXPPXXXXXXPXPPXPXWGXX-GXXPXPPXXXXPXXGXGX-----PPXR 807 PP P P PP PP P G G P PP P G PP R Sbjct: 143 PPPTGSSRPLPAPPPGENR----PPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTR 198 Query: 808 GXXXXPPXT--PPXPXXPXNXPXXPPPXKTXXPPXPPPXXPXSPPV 939 G T PP P P PPP PP PP P+ Sbjct: 199 GPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSR--DQVPL 242 Score = 37.9 bits (84), Expect = 0.012 Identities = 28/106 (26%), Positives = 29/106 (27%), Gaps = 9/106 (8%) Frame = +1 Query: 646 PPXXPPXXPPPXXPPXXXXXXPXPPXPXWGXXGXXPXPPXXXXPXXGXGXPPXRGXXXXP 825 PP PPP P P P PP P P G P Sbjct: 119 PPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPP 178 Query: 826 PXTPPXPXXPXNXPXXPPPX-------KTXXPPXPP--PXXPXSPP 936 PP P + P PP T PP PP P PP Sbjct: 179 KNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPP 224 Score = 37.1 bits (82), Expect = 0.022 Identities = 28/109 (25%), Positives = 29/109 (26%) Frame = +2 Query: 647 PPXXPPXRPPXXXPPXXXTXXXSPXFPXGEXXGLXLYPPPXXXPXXGXXXPPXGGXXXTP 826 PP PP PP P G PPP P P G T Sbjct: 46 PPKNSSPPPPFGAPPPPDRGGQLAKKPS---QGSFPPPPPMGKPPPPSGNKPTFGNSRTS 102 Query: 827 PXPXPXXPXPXTXPXXPPRXKQXXPXAPPPGXRXPXXFFRXPPXXSXGP 973 P P PP + P PPPG PP S P Sbjct: 103 TNGPPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRP 151 Score = 37.1 bits (82), Expect = 0.022 Identities = 29/104 (27%), Positives = 31/104 (29%) Frame = +2 Query: 662 PXRPPXXXPPXXXTXXXSPXFPXGEXXGLXLYPPPXXXPXXGXXXPPXGGXXXTPPXPXP 841 P PP PP P F G PPP G PP PP P Sbjct: 78 PPPPPMGKPPPPS--GNKPTF--GNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPPG 133 Query: 842 XXPXPXTXPXXPPRXKQXXPXAPPPGXRXPXXFFRXPPXXSXGP 973 P + P + P APPPG P R P P Sbjct: 134 RGPSQRSLAPPPTGSSRPLP-APPPGENRPPPPMRGPTSGGEPP 176 Score = 35.5 bits (78), Expect = 0.066 Identities = 29/108 (26%), Positives = 30/108 (27%), Gaps = 6/108 (5%) Frame = +2 Query: 650 PXXPPXRPPXXXPPXXXTXXXSPXFPXGEXXGLXLYPPPXXXPXXGXXXPPXGGXXXTPP 829 P PP PP P P G PP PP G PP Sbjct: 106 PPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPP 165 Query: 830 XPXPXX----PXPXTXPXXPPRXKQXXPXAPPPGXRXPXXFF--RXPP 955 P P P P P R P PPP P F + PP Sbjct: 166 MRGPTSGGEPPPPKNAPPPPKRGSSNPP--PPPTRGPPSNSFTTQGPP 211 Score = 30.7 bits (66), Expect = 1.9 Identities = 27/109 (24%), Positives = 29/109 (26%) Frame = +3 Query: 588 PPNSDVAXPXXTIXIPXVXPPXXPPPXAPPXXXPPXXXPKXXPPXSPXGXXXXXSXTPXX 767 PP + P PP PP APP P P P P Sbjct: 156 PPGENRPPPPMRGPTSGGEPP--PPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLP 213 Query: 768 XXXXXGXXXPPPPGXXXXPPLXPXXXXLXRKXXLXXPPGXNXFXPXPPP 914 PPP PP P + L PP P PPP Sbjct: 214 PSRDQAPAPPPPLNATPPPP-PPSRD----QVPLPPPPLRGQIAPPPPP 257 Score = 30.3 bits (65), Expect = 2.5 Identities = 23/92 (25%), Positives = 25/92 (27%) Frame = +2 Query: 605 GXXPXDYXXTPRVXPPXXPPXRPPXXXPPXXXTXXXSPXFPXGEXXGLXLYPPPXXXPXX 784 G P + PP PP P + P G L PP P Sbjct: 105 GPPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPP 164 Query: 785 GXXXPPXGGXXXTPPXPXPXXPXPXTXPXXPP 880 P GG PP P P P PP Sbjct: 165 PMRGPTSGG---EPPPPKNAPPPPKRGSSNPP 193 Score = 29.1 bits (62), Expect = 5.7 Identities = 17/64 (26%), Positives = 19/64 (29%) Frame = +1 Query: 742 GXXPXPPXXXXPXXGXGXPPXRGXXXXPPXTPPXPXXPXNXPXXPPPXKTXXPPXPPPXX 921 G P P P PP + PP P P P + PP PP Sbjct: 27 GAGPRGPALKPPGFRTTAPPPKNSSPPPPFGAP-PPPDRGGQLAKKPSQGSFPPPPPMGK 85 Query: 922 PXSP 933 P P Sbjct: 86 PPPP 89 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 49.6 bits (113), Expect = 4e-06 Identities = 38/103 (36%), Positives = 39/103 (37%) Frame = -3 Query: 938 TGGEXGXXGGGXGGKXVXXGGGXKGXFXGKXGXGGVKGGXXXXPRXGGXPXPXXGXXXXG 759 TGG G GGG GG + GGG G G G G GG GG G G Sbjct: 1755 TGGFGG--GGGGGG--MGGGGGMAGGGGGMGGGGMAAGGG----EFGGGEGMGGGGMAGG 1806 Query: 758 GXGXXPXXPXXGXGGXGFXXXXXGGXXGGGXXGGXXGGXHXGY 630 G G G GG G GG G G GG GG GY Sbjct: 1807 GGGMGGGGGGMGGGGEGM--GAAGGGMGAGGEGGGAGGGGGGY 1847 Score = 31.1 bits (67), Expect = 1.4 Identities = 25/87 (28%), Positives = 27/87 (31%), Gaps = 2/87 (2%) Frame = -3 Query: 800 GGXPXPXXGXXXXGGXGXXPXXPXXGXGGXGFXXXXXGGXXG--GGXXGGXXGGXHXGYX 627 GG G GG G G GG GG G GG G GG G Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGG 1815 Query: 626 YSXXGXRHI*IGXXXFGDAVQGGGAYG 546 G + G +GGGA G Sbjct: 1816 GMGGGGEGMGAAGGGMGAGGEGGGAGG 1842 Score = 28.7 bits (61), Expect = 7.6 Identities = 23/82 (28%), Positives = 24/82 (29%) Frame = -3 Query: 800 GGXPXPXXGXXXXGGXGXXPXXPXXGXGGXGFXXXXXGGXXGGGXXGGXXGGXHXGYXYS 621 GG G GG G G G G GG GG G GG G Sbjct: 1763 GGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGE 1822 Query: 620 XXGXRHI*IGXXXFGDAVQGGG 555 G +G G GGG Sbjct: 1823 GMGAAGGGMGAGGEGGGAGGGG 1844 >SB_36015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 47.2 bits (107), Expect = 2e-05 Identities = 22/46 (47%), Positives = 29/46 (63%), Gaps = 6/46 (13%) Frame = +3 Query: 237 KQVNNNNCIHFMFQVQGEVW------EVFSALMNRPTRGERRFAYW 356 + ++ N C+ F GE++ V +ALMNRPTRGERRFAYW Sbjct: 102 EDIDGNYCLQFYLHKSGEIYWLVGKPVVPAALMNRPTRGERRFAYW 147 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 183 ICDTGYIPLPRSLTRYARSFDCGERKWLT 211 >SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 46.8 bits (106), Expect = 3e-05 Identities = 21/31 (67%), Positives = 23/31 (74%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLTQR 436 +C G +PLPRSLTR ARSF CGER LT R Sbjct: 74 ICDTGYIPLPRSLTRYARSFDCGERKWLTNR 104 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 22 AALMNRPTRGERRFAYW 38 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 45.6 bits (103), Expect = 6e-05 Identities = 32/100 (32%), Positives = 33/100 (33%), Gaps = 1/100 (1%) Frame = +1 Query: 646 PPXXPPXXPPPXXPPXXXXXXPXPPXPXWGXXGXXPXPPXXXXPXXG-XGXPPXRGXXXX 822 PP PP P P PP P G P PP P G G PP Sbjct: 677 PPPPPPL--PVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPP------P 728 Query: 823 PPXTPPXPXXPXNXPXXPPPXKTXXPPXPPPXXPXSPPVF 942 PP P P PPP PP PPP P+F Sbjct: 729 PPSPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVPMKPLF 768 Score = 37.9 bits (84), Expect = 0.012 Identities = 24/80 (30%), Positives = 26/80 (32%) Frame = +2 Query: 716 PXFPXGEXXGLXLYPPPXXXPXXGXXXPPXGGXXXTPPXPXPXXPXPXTXPXXPPRXKQX 895 P P E L + PPP P P G PP P P P P PP + Sbjct: 681 PPLPVIEGSSLSVPPPPPPPPP-----PLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPG 735 Query: 896 XPXAPPPGXRXPXXFFRXPP 955 PPP P PP Sbjct: 736 CAGLPPPPPPPPPGCAGLPP 755 Score = 35.1 bits (77), Expect = 0.087 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = +1 Query: 634 PXCXPPXXPPXXPPPXXP-PXXXXXXPXPPXPXWGXXGXXPXPPXXXXP 777 P PP PPP P P P PP P G G P PP P Sbjct: 715 PPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVP 763 Score = 30.3 bits (65), Expect = 2.5 Identities = 26/95 (27%), Positives = 26/95 (27%), Gaps = 3/95 (3%) Frame = +3 Query: 639 VXPPXXPPPXAPPXXXPPXXXPKXXPPXSPXGXXXXXSXTPXXXXXXXGXXXPPP---PG 809 V PP P P P PP G P G PPP PG Sbjct: 676 VPPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPG 735 Query: 810 XXXXPPLXPXXXXLXRKXXLXXPPGXNXFXPXPPP 914 PP P PPG P PPP Sbjct: 736 CAGLPPPPP-----------PPPPGCAGLPPPPPP 759 Score = 29.9 bits (64), Expect = 3.3 Identities = 25/90 (27%), Positives = 28/90 (31%), Gaps = 9/90 (10%) Frame = +3 Query: 588 PPNSDVAXPXXTIXIPXVXPPXXPP--------PXAPPXXXPPXXXPKXXPPXSP-XGXX 740 PP ++ +P PP PP P PP PP PP SP G Sbjct: 679 PPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPP-PPPPGCAGLPPPPPSPQPGCA 737 Query: 741 XXXSXTPXXXXXXXGXXXPPPPGXXXXPPL 830 P G PPPP PL Sbjct: 738 GLPPPPPPPPPGCAGLPPPPPPIDVPMKPL 767 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 45.2 bits (102), Expect = 8e-05 Identities = 30/101 (29%), Positives = 33/101 (32%), Gaps = 1/101 (0%) Frame = +1 Query: 646 PPXXPPXXPPPXXPPXXXXXXPXPPXPXWGXXGXXPXPPXXXXPXXGXGXPPXRGXXXXP 825 PP PP PPP P P PP + P PP P G PP RG P Sbjct: 451 PPQLPPNLPPP---PGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPPPP 507 Query: 826 PXTPPXPXXP-XNXPXXPPPXKTXXPPXPPPXXPXSPPVFS 945 P P + P P P +PPV S Sbjct: 508 RQRMPSQGPPQVHYPSQDPQRLGAVKAMEKGEPPKAPPVGS 548 Score = 38.7 bits (86), Expect = 0.007 Identities = 27/91 (29%), Positives = 27/91 (29%), Gaps = 2/91 (2%) Frame = +1 Query: 670 PPPXXPPXXXXXXPXPPXPXWGXXGXXPXPPXXXXPXXGXG--XPPXRGXXXXPPXTPPX 843 PPP P P PP G PP P G PP G P PP Sbjct: 428 PPP--PQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPP 485 Query: 844 PXXPXNXPXXPPPXKTXXPPXPPPXXPXSPP 936 P P PP PP P P P Sbjct: 486 PFGPPPPFYRGPPPPRGMPPPPRQRMPSQGP 516 Score = 36.7 bits (81), Expect = 0.029 Identities = 28/93 (30%), Positives = 29/93 (31%), Gaps = 2/93 (2%) Frame = +2 Query: 659 PPXRPPXXXPPXXXTXXXSPXFPXGEXXGLXLYPPP--XXXPXXGXXXPPXGGXXXTPPX 832 P RPP P P P + PPP P G PP G PP Sbjct: 437 PQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFG-----PPP 491 Query: 833 PXPXXPXPXTXPXXPPRXKQXXPXAPPPGXRXP 931 P P P PPR Q P PP P Sbjct: 492 PFYRGPPPPRGMPPPPR--QRMPSQGPPQVHYP 522 Score = 33.9 bits (74), Expect = 0.20 Identities = 22/66 (33%), Positives = 23/66 (34%), Gaps = 1/66 (1%) Frame = +2 Query: 761 PPXXXPXXGXXXPPXGGXXXTPPXPXPXXPXPXTXPXXPPRXKQXXPXA-PPPGXRXPXX 937 PP P G P GG PP P P PP P PPP P Sbjct: 436 PPQPRPPHGM--PQGGGPPQLPPN-LPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPP 492 Query: 938 FFRXPP 955 F+R PP Sbjct: 493 FYRGPP 498 Score = 29.9 bits (64), Expect = 3.3 Identities = 17/76 (22%), Positives = 22/76 (28%) Frame = +3 Query: 600 DVAXPXXTIXIPXVXPPXXPPPXAPPXXXPPXXXPKXXPPXSPXGXXXXXSXTPXXXXXX 779 +++ P + +P PP PP P P PP P P Sbjct: 417 NLSTPAANMRLPPPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMY 476 Query: 780 XGXXXPPPPGXXXXPP 827 PPP PP Sbjct: 477 PPPRGFPPPPFGPPPP 492 Score = 28.7 bits (61), Expect = 7.6 Identities = 25/96 (26%), Positives = 29/96 (30%), Gaps = 6/96 (6%) Frame = +2 Query: 614 PXDYXXTPRVXPPXX------PPXRPPXXXPPXXXTXXXSPXFPXGEXXGLXLYPPPXXX 775 P + P+ PP PP PP PP P P G +PPP Sbjct: 430 PPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPP-PMGMYPPPRGFPPPPFG 488 Query: 776 PXXGXXXPPXGGXXXTPPXPXPXXPXPXTXPXXPPR 883 P PP PP P P PP+ Sbjct: 489 P------PPPFYRGPPPPRGMPPPPRQRMPSQGPPQ 518 >SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) Length = 217 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 172 ICDTGYIPLPRSLTRYARSFDCGERKWLT 200 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 120 AALMNRPTRGERRFAYW 136 >SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) Length = 341 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 296 ICDTGYIPLPRSLTRYARSFDCGERKWLT 324 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 244 AALMNRPTRGERRFAYW 260 >SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 134 ICDTGYIPLPRSLTRYARSFDCGERKWLT 162 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 82 AALMNRPTRGERRFAYW 98 >SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 121 ICDTGYIPLPRSLTRYARSFDCGERKWLT 149 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 69 AALMNRPTRGERRFAYW 85 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 146 ICDTGYIPLPRSLTRYARSFDCGERKWLT 174 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 94 AALMNRPTRGERRFAYW 110 >SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) Length = 148 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 103 ICDTGYIPLPRSLTRYARSFDCGERKWLT 131 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 51 AALMNRPTRGERRFAYW 67 >SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 133 ICDTGYIPLPRSLTRYARSFDCGERKWLT 161 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 81 AALMNRPTRGERRFAYW 97 >SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) Length = 653 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 251 ICDTGYIPLPRSLTRYARSFDCGERKWLT 279 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 199 AALMNRPTRGERRFAYW 215 >SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGERKWLT 121 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 41 AALMNRPTRGERRFAYW 57 >SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 92 ICDTGYIPLPRSLTRYARSFDCGERKWLT 120 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 40 AALMNRPTRGERRFAYW 56 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 393 ICDTGYIPLPRSLTRYARSFDCGERKWLT 421 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 341 AALMNRPTRGERRFAYW 357 Score = 38.3 bits (85), Expect = 0.009 Identities = 29/99 (29%), Positives = 30/99 (30%), Gaps = 7/99 (7%) Frame = +1 Query: 658 PPXXPPPXXPPXXXXXXPXPPXPXWGXXGXXPXPPXXXXPXXGX-------GXPPXRGXX 816 PP P P P P G PP G G PP Sbjct: 724 PPPKPAPPARPGSVANVLGERKPLPGRRPGVEWPPLAKSSSDGAAIDKKALGAPPP---- 779 Query: 817 XXPPXTPPXPXXPXNXPXXPPPXKTXXPPXPPPXXPXSP 933 PP P P P N P PP + PP PPP P P Sbjct: 780 PPPPTKPATPRVPPNIPSRPPGAR-PTPPPPPPGKPTKP 817 Score = 29.9 bits (64), Expect = 3.3 Identities = 22/78 (28%), Positives = 24/78 (30%), Gaps = 4/78 (5%) Frame = +2 Query: 659 PPXRPPXXXPPXXXTXXXSPXFPXGEXXGLXLYPPPXXXPXXGXXXPPXG----GXXXTP 826 P RP PP + + G PPP P P G TP Sbjct: 748 PGRRPGVEWPPLAKSSSDGAAIDK-KALGAPPPPPPPTKPATPRVPPNIPSRPPGARPTP 806 Query: 827 PXPXPXXPXPXTXPXXPP 880 P P P P T P PP Sbjct: 807 PPPPPGKPTKPTKPSLPP 824 Score = 29.5 bits (63), Expect = 4.3 Identities = 22/78 (28%), Positives = 25/78 (32%), Gaps = 3/78 (3%) Frame = +3 Query: 504 KRPGTVKRPRCWRFSIGSA---PLXSIXKXXPPNSDVAXPXXTIXIPXVXPPXXPPPXAP 674 +RPG P S G+A PP + A P IP P P P P Sbjct: 750 RRPGVEWPPLAKSSSDGAAIDKKALGAPPPPPPPTKPATPRVPPNIPSRPPGARPTPPPP 809 Query: 675 PXXXPPXXXPKXXPPXSP 728 P P PP P Sbjct: 810 PPGKPTKPTKPSLPPVPP 827 Score = 29.1 bits (62), Expect = 5.7 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 2/36 (5%) Frame = +1 Query: 823 PPXTPPXPXXPXNXPXXPPPXKTXXPPXP--PPXXP 924 PP P P P PPP K P P PP P Sbjct: 792 PPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVPP 827 >SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) Length = 293 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 248 ICDTGYIPLPRSLTRYARSFDCGERKWLT 276 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 196 AALMNRPTRGERRFAYW 212 >SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 148 ICDTGYIPLPRSLTRYARSFDCGERKWLT 176 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 96 AALMNRPTRGERRFAYW 112 >SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 134 ICDTGYIPLPRSLTRYARSFDCGERKWLT 162 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 82 AALMNRPTRGERRFAYW 98 >SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 940 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 611 ICDTGYIPLPRSLTRYARSFDCGERKWLT 639 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 559 AALMNRPTRGERRFAYW 575 >SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) Length = 491 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 367 ICDTGYIPLPRSLTRYARSFDCGERKWLT 395 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 315 AALMNRPTRGERRFAYW 331 >SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) Length = 255 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 210 ICDTGYIPLPRSLTRYARSFDCGERKWLT 238 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 158 AALMNRPTRGERRFAYW 174 >SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 168 ICDTGYIPLPRSLTRYARSFDCGERKWLT 196 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 116 AALMNRPTRGERRFAYW 132 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGERKWLT 160 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 80 AALMNRPTRGERRFAYW 96 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 808 GXXXXPPXTPPXPXXPXNXPXXPPPXKTXXPPXPPP 915 G PP PP P P P PPP PP PPP Sbjct: 459 GVGQAPPPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 36.7 bits (81), Expect = 0.029 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 808 GXXXXPPXTPPXPXXPXNXPXXPPPXKTXXPPXPPP 915 G PP PP P P P PPP PP P P Sbjct: 461 GQAPPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 36.7 bits (81), Expect = 0.029 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 835 PPXPXXPXNXPXXPPPXKTXXPPXPPPXXPXSPP 936 PP P P P PPP PP PPP P PP Sbjct: 464 PPPPPPPPPPPPPPPPPP---PPPPPPFPPPPPP 494 Score = 35.9 bits (79), Expect = 0.050 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 634 PXCXPPXXPPXXPPPXXPPXXXXXXPXPPXP 726 P PP PP PPP PP P PP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 35.9 bits (79), Expect = 0.050 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 634 PXCXPPXXPPXXPPPXXPPXXXXXXPXPPXP 726 P PP PP PPP PP P PP P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 826 PXTPPXPXXPXNXPXXPPPXKTXXPPXPPPXXP 924 P PP P P P PPP PP PPP P Sbjct: 464 PPPPPPPPPP--PPPPPPPPPPPPPPFPPPPPP 494 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 633 PXVXPPXXPPPXAPPXXXPPXXXPKXXPP 719 P PP PPP PP PP P PP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 33.1 bits (72), Expect = 0.35 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 633 PXVXPPXXPPPXAPPXXXPPXXXPKXXPP 719 P PP PPP PP PP P PP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPP 492 Score = 32.7 bits (71), Expect = 0.47 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 874 PPPXKTXXPPXPPPXXPXSPPVF 942 PPP PP PPP P PP F Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPF 488 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/42 (33%), Positives = 16/42 (38%) Frame = +2 Query: 731 GEXXGLXLYPPPXXXPXXGXXXPPXGGXXXTPPXPXPXXPXP 856 G+ G+ PPP P PP PP P P P P Sbjct: 455 GDTEGVGQAPPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 784 GXGXPPXRGXXXXPPXTPPXPXXPXNXPXXPPPXKTXXPPXP 909 G G P PP PP P P P PPP PP P Sbjct: 459 GVGQAPPPPPPPPPPPPPPPPPPPPPPPPFPPP----PPPTP 496 >SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 94 ICDTGYIPLPRSLTRYARSFDCGERKWLT 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 42 AALMNRPTRGERRFAYW 58 >SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) Length = 178 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 133 ICDTGYIPLPRSLTRYARSFDCGERKWLT 161 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 81 AALMNRPTRGERRFAYW 97 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 179 ICDTGYIPLPRSLTRYARSFDCGERKWLT 207 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 127 AALMNRPTRGERRFAYW 143 >SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 102 ICDTGYIPLPRSLTRYARSFDCGERKWLT 130 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/32 (59%), Positives = 24/32 (75%) Frame = +3 Query: 261 IHFMFQVQGEVWEVFSALMNRPTRGERRFAYW 356 +++ F G+ V +ALMNRPTRGERRFAYW Sbjct: 36 LYYAFSYVGKP-VVPAALMNRPTRGERRFAYW 66 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 137 ICDTGYIPLPRSLTRYARSFDCGERKWLT 165 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 85 AALMNRPTRGERRFAYW 101 >SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 153 ICDTGYIPLPRSLTRYARSFDCGERKWLT 181 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 101 AALMNRPTRGERRFAYW 117 >SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) Length = 346 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 63 ICDTGYIPLPRSLTRYARSFDCGERKWLT 91 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 11 AALMNRPTRGERRFAYW 27 >SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGERKWLT 141 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 61 AALMNRPTRGERRFAYW 77 >SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2496 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 600 ICDTGYIPLPRSLTRYARSFDCGERKWLT 628 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 548 AALMNRPTRGERRFAYW 564 >SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGERKWLT 141 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 61 AALMNRPTRGERRFAYW 77 >SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) Length = 216 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 171 ICDTGYIPLPRSLTRYARSFDCGERKWLT 199 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 119 AALMNRPTRGERRFAYW 135 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 Score = 30.3 bits (65), Expect = 2.5 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = +3 Query: 519 VKRPRCWRFSIGSAPLXSIXK 581 V+ PR RFSIGSAPL SI K Sbjct: 143 VRGPRQSRFSIGSAPLTSITK 163 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 96 ICDTGYIPLPRSLTRYARSFDCGERKWLT 124 Score = 41.5 bits (93), Expect = 0.001 Identities = 21/42 (50%), Positives = 29/42 (69%) Frame = +3 Query: 231 CNKQVNNNNCIHFMFQVQGEVWEVFSALMNRPTRGERRFAYW 356 C ++ N+ + +F+ G+ V +ALMNRPTRGERRFAYW Sbjct: 21 CRNSIDIND-MKQLFECVGKP-VVPAALMNRPTRGERRFAYW 60 >SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 117 ICDTGYIPLPRSLTRYARSFDCGERKWLT 145 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 65 AALMNRPTRGERRFAYW 81 >SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) Length = 184 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 139 ICDTGYIPLPRSLTRYARSFDCGERKWLT 167 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 87 AALMNRPTRGERRFAYW 103 >SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 116 ICDTGYIPLPRSLTRYARSFDCGERKWLT 144 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 64 AALMNRPTRGERRFAYW 80 >SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) Length = 150 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 105 ICDTGYIPLPRSLTRYARSFDCGERKWLT 133 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 53 AALMNRPTRGERRFAYW 69 >SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGERKWLT 160 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 80 AALMNRPTRGERRFAYW 96 >SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 130 ICDTGYIPLPRSLTRYARSFDCGERKWLT 158 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 78 AALMNRPTRGERRFAYW 94 >SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 99 ICDTGYIPLPRSLTRYARSFDCGERKWLT 127 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 47 AALMNRPTRGERRFAYW 63 >SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 282 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 237 ICDTGYIPLPRSLTRYARSFDCGERKWLT 265 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 185 AALMNRPTRGERRFAYW 201 >SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) Length = 673 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 628 ICDTGYIPLPRSLTRYARSFDCGERKWLT 656 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 576 AALMNRPTRGERRFAYW 592 >SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) Length = 841 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 350 ICDTGYIPLPRSLTRYARSFDCGERKWLT 378 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 298 AALMNRPTRGERRFAYW 314 >SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) Length = 168 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 123 ICDTGYIPLPRSLTRYARSFDCGERKWLT 151 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 71 AALMNRPTRGERRFAYW 87 >SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) Length = 895 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 854 ICDTGYIPLPRSLTRYARSFDCGERKWLT 882 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 802 AALMNRPTRGERRFAYW 818 >SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) Length = 284 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 239 ICDTGYIPLPRSLTRYARSFDCGERKWLT 267 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 187 AALMNRPTRGERRFAYW 203 >SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 138 ICDTGYIPLPRSLTRYARSFDCGERKWLT 166 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 86 AALMNRPTRGERRFAYW 102 >SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 584 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 539 ICDTGYIPLPRSLTRYARSFDCGERKWLT 567 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 487 AALMNRPTRGERRFAYW 503 >SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 84 ICDTGYIPLPRSLTRYARSFDCGERKWLT 112 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 32 AALMNRPTRGERRFAYW 48 >SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) Length = 1029 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 984 ICDTGYIPLPRSLTRYARSFDCGERKWLT 1012 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 932 AALMNRPTRGERRFAYW 948 >SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) Length = 155 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 110 ICDTGYIPLPRSLTRYARSFDCGERKWLT 138 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 58 AALMNRPTRGERRFAYW 74 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 152 ICDTGYIPLPRSLTRYARSFDCGERKWLT 180 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 100 AALMNRPTRGERRFAYW 116 >SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) Length = 704 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 489 ICDTGYIPLPRSLTRYARSFDCGERKWLT 517 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 437 AALMNRPTRGERRFAYW 453 >SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGERKWLT 121 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 41 AALMNRPTRGERRFAYW 57 >SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) Length = 167 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 122 ICDTGYIPLPRSLTRYARSFDCGERKWLT 150 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 70 AALMNRPTRGERRFAYW 86 >SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) Length = 453 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 285 ICDTGYIPLPRSLTRYARSFDCGERKWLT 313 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 233 AALMNRPTRGERRFAYW 249 >SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) Length = 149 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 104 ICDTGYIPLPRSLTRYARSFDCGERKWLT 132 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 52 AALMNRPTRGERRFAYW 68 >SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 74 ICDTGYIPLPRSLTRYARSFDCGERKWLT 102 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 22 AALMNRPTRGERRFAYW 38 >SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 239 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 194 ICDTGYIPLPRSLTRYARSFDCGERKWLT 222 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 142 AALMNRPTRGERRFAYW 158 >SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 279 ICDTGYIPLPRSLTRYARSFDCGERKWLT 307 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 227 AALMNRPTRGERRFAYW 243 >SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) Length = 150 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 105 ICDTGYIPLPRSLTRYARSFDCGERKWLT 133 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 53 AALMNRPTRGERRFAYW 69 >SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) Length = 198 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 153 ICDTGYIPLPRSLTRYARSFDCGERKWLT 181 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 101 AALMNRPTRGERRFAYW 117 >SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGERKWLT 141 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 61 AALMNRPTRGERRFAYW 77 >SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) Length = 200 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 155 ICDTGYIPLPRSLTRYARSFDCGERKWLT 183 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 103 AALMNRPTRGERRFAYW 119 >SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 123 ICDTGYIPLPRSLTRYARSFDCGERKWLT 151 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 71 AALMNRPTRGERRFAYW 87 >SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_18781| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 125 ICDTGYIPLPRSLTRYARSFDCGERKWLT 153 Score = 33.5 bits (73), Expect = 0.27 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNR TRGERRFA W Sbjct: 73 AALMNRATRGERRFADW 89 >SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 92 ICDTGYIPLPRSLTRYARSFDCGERKWLT 120 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 40 AALMNRPTRGERRFAYW 56 >SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) Length = 177 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGERKWLT 160 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 80 AALMNRPTRGERRFAYW 96 >SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGERKWLT 129 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 49 AALMNRPTRGERRFAYW 65 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 995 ICDTGYIPLPRSLTRYARSFDCGERKWLT 1023 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 943 AALMNRPTRGERRFAYW 959 Score = 32.3 bits (70), Expect = 0.62 Identities = 26/83 (31%), Positives = 26/83 (31%), Gaps = 4/83 (4%) Frame = +1 Query: 631 YPXCXPPXXPPXXPPPXXP--PXXXXXXPXPPXPXWGXXGXXPXPPXXXXPXXGXGXP-- 798 YP P PP PP P P P P P G G P PP P G P Sbjct: 1654 YPVFHYPAPPPPPPPAPGPPGPDGPMGLPGPQGPD-GPKG-PPGPPGLPGPQGIPGYPGA 1711 Query: 799 PXRGXXXXPPXTPPXPXXPXNXP 867 P P PP P P Sbjct: 1712 PAGPPGRDGPMGPPGPSGGQGPP 1734 Score = 29.5 bits (63), Expect = 4.3 Identities = 21/71 (29%), Positives = 21/71 (29%) Frame = +1 Query: 670 PPPXXPPXXXXXXPXPPXPXWGXXGXXPXPPXXXXPXXGXGXPPXRGXXXXPPXTPPXPX 849 PP P P PP P P PP G P PP PP P Sbjct: 1784 PPGLAGPQGPKGMPGPPGP--------PGPPGAIGWKGNPGNPAGPPGLDGPPG-PPGPQ 1834 Query: 850 XPXNXPXXPPP 882 P P P P Sbjct: 1835 GPKGWPGVPGP 1845 Score = 28.7 bits (61), Expect = 7.6 Identities = 21/73 (28%), Positives = 22/73 (30%), Gaps = 2/73 (2%) Frame = +1 Query: 634 PXCXPPXXPPXXPPPXXPPXXXXXXPXPPXP--XWGXXGXXPXPPXXXXPXXGXGXPPXR 807 P P P PP P P PP P +G G P P G PP R Sbjct: 1818 PAGPPGLDGPPGPPGPQGPKGWPGVPGPPGPPGAYGWKG-YPGNPAGPPGRDGIPGPPGR 1876 Query: 808 GXXXXPPXTPPXP 846 P P P Sbjct: 1877 QGGKGPAGIPGIP 1889 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 142 ICDTGYIPLPRSLTRYARSFDCGERKWLT 170 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 90 AALMNRPTRGERRFAYW 106 >SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) Length = 520 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 475 ICDTGYIPLPRSLTRYARSFDCGERKWLT 503 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 423 AALMNRPTRGERRFAYW 439 >SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) Length = 202 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 157 ICDTGYIPLPRSLTRYARSFDCGERKWLT 185 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 105 AALMNRPTRGERRFAYW 121 >SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) Length = 568 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 523 ICDTGYIPLPRSLTRYARSFDCGERKWLT 551 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 471 AALMNRPTRGERRFAYW 487 >SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 130 ICDTGYIPLPRSLTRYARSFDCGERKWLT 158 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 78 AALMNRPTRGERRFAYW 94 >SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) Length = 631 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 521 ICDTGYIPLPRSLTRYARSFDCGERKWLT 549 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 469 AALMNRPTRGERRFAYW 485 Score = 33.5 bits (73), Expect = 0.27 Identities = 17/54 (31%), Positives = 19/54 (35%) Frame = +2 Query: 758 PPPXXXPXXGXXXPPXGGXXXTPPXPXPXXPXPXTXPXXPPRXKQXXPXAPPPG 919 P P P PP PP P P P + PP+ K P P PG Sbjct: 152 PEPETVPPQPETVPPQ--PETVPPQPGSEEPEPVSQAPEPPKPKTSAPEPPKPG 203 >SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 143 ICDTGYIPLPRSLTRYARSFDCGERKWLT 171 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 91 AALMNRPTRGERRFAYW 107 >SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGERKWLT 129 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 49 AALMNRPTRGERRFAYW 65 >SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGERKWLT 129 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 49 AALMNRPTRGERRFAYW 65 >SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) Length = 190 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 145 ICDTGYIPLPRSLTRYARSFDCGERKWLT 173 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 93 AALMNRPTRGERRFAYW 109 >SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) Length = 197 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 152 ICDTGYIPLPRSLTRYARSFDCGERKWLT 180 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 100 AALMNRPTRGERRFAYW 116 >SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) Length = 336 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 291 ICDTGYIPLPRSLTRYARSFDCGERKWLT 319 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 239 AALMNRPTRGERRFAYW 255 >SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 171 ICDTGYIPLPRSLTRYARSFDCGERKWLT 199 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 119 AALMNRPTRGERRFAYW 135 >SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 1206 ICDTGYIPLPRSLTRYARSFDCGERKWLT 1234 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 1154 AALMNRPTRGERRFAYW 1170 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 102 ICDTGYIPLPRSLTRYARSFDCGERKWLT 130 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 50 AALMNRPTRGERRFAYW 66 >SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 122 ICDTGYIPLPRSLTRYARSFDCGERKWLT 150 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 70 AALMNRPTRGERRFAYW 86 >SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 107 ICDTGYIPLPRSLTRYARSFDCGERKWLT 135 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 55 AALMNRPTRGERRFAYW 71 >SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) Length = 502 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 100 ICDTGYIPLPRSLTRYARSFDCGERKWLT 128 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 48 AALMNRPTRGERRFAYW 64 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 130 ICDTGYIPLPRSLTRYARSFDCGERKWLT 158 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 78 AALMNRPTRGERRFAYW 94 >SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 121 ICDTGYIPLPRSLTRYARSFDCGERKWLT 149 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/44 (54%), Positives = 30/44 (68%), Gaps = 5/44 (11%) Frame = +3 Query: 240 QVNNNNCIHFMFQVQ---GEVWE--VFSALMNRPTRGERRFAYW 356 +++NNN I + V G V + V +ALMNRPTRGERRFAYW Sbjct: 42 ELDNNNTIKLIDTVDLEGGPVGKPVVPAALMNRPTRGERRFAYW 85 >SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 98 ICDTGYIPLPRSLTRYARSFDCGERKWLT 126 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 46 AALMNRPTRGERRFAYW 62 >SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2670 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 1476 ICDTGYIPLPRSLTRYARSFDCGERKWLT 1504 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 1424 AALMNRPTRGERRFAYW 1440 >SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) Length = 674 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 629 ICDTGYIPLPRSLTRYARSFDCGERKWLT 657 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 577 AALMNRPTRGERRFAYW 593 >SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 89 ICDTGYIPLPRSLTRYARSFDCGERKWLT 117 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 37 AALMNRPTRGERRFAYW 53 >SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 326 ICDTGYIPLPRSLTRYARSFDCGERKWLT 354 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 274 AALMNRPTRGERRFAYW 290 >SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 174 ICDTGYIPLPRSLTRYARSFDCGERKWLT 202 Score = 42.7 bits (96), Expect = 4e-04 Identities = 26/87 (29%), Positives = 47/87 (54%), Gaps = 2/87 (2%) Frame = +3 Query: 102 G*LDPDMIRYIDEFGQTTTRMQ*KKCFICEICDAIALFVTIISCNKQVNNNNCIHFMFQV 281 G ++ ++ +Y+ ++ +T + + I + A + + N + N ++ + Q Sbjct: 54 GAIEMELSKYLRDYSRTIAGKE--QLLIGAMAKAFEIIPRQLCDNAGFDATNILNKLRQK 111 Query: 282 QGEVWE--VFSALMNRPTRGERRFAYW 356 +V + V +ALMNRPTRGERRFAYW Sbjct: 112 HFQVGKPVVPAALMNRPTRGERRFAYW 138 >SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2102 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 538 ICDTGYIPLPRSLTRYARSFDCGERKWLT 566 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 486 AALMNRPTRGERRFAYW 502 >SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) Length = 348 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 91 ICDTGYIPLPRSLTRYARSFDCGERKWLT 119 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 39 AALMNRPTRGERRFAYW 55 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 160 ICDTGYIPLPRSLTRYARSFDCGERKWLT 188 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 108 AALMNRPTRGERRFAYW 124 >SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) Length = 189 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 144 ICDTGYIPLPRSLTRYARSFDCGERKWLT 172 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 92 AALMNRPTRGERRFAYW 108 >SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) Length = 142 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 144 ICDTGYIPLPRSLTRYARSFDCGERKWLT 172 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 92 AALMNRPTRGERRFAYW 108 >SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) Length = 227 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 182 ICDTGYIPLPRSLTRYARSFDCGERKWLT 210 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 130 AALMNRPTRGERRFAYW 146 >SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) Length = 157 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 112 ICDTGYIPLPRSLTRYARSFDCGERKWLT 140 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 60 AALMNRPTRGERRFAYW 76 >SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 154 ICDTGYIPLPRSLTRYARSFDCGERKWLT 182 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 102 AALMNRPTRGERRFAYW 118 >SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGERKWLT 121 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 41 AALMNRPTRGERRFAYW 57 >SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 119 ICDTGYIPLPRSLTRYARSFDCGERKWLT 147 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 67 AALMNRPTRGERRFAYW 83 >SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) Length = 160 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 115 ICDTGYIPLPRSLTRYARSFDCGERKWLT 143 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 63 AALMNRPTRGERRFAYW 79 >SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) Length = 590 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 545 ICDTGYIPLPRSLTRYARSFDCGERKWLT 573 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 493 AALMNRPTRGERRFAYW 509 >SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) Length = 521 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 440 ICDTGYIPLPRSLTRYARSFDCGERKWLT 468 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 388 AALMNRPTRGERRFAYW 404 >SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGERKWLT 121 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 41 AALMNRPTRGERRFAYW 57 >SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 227 ICDTGYIPLPRSLTRYARSFDCGERKWLT 255 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 175 AALMNRPTRGERRFAYW 191 >SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 112 ICDTGYIPLPRSLTRYARSFDCGERKWLT 140 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 60 AALMNRPTRGERRFAYW 76 >SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_56405| Best HMM Match : Fels1 (HMM E-Value=6.5) Length = 119 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 74 ICDTGYIPLPRSLTRYARSFDCGERKWLT 102 >SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 95 ICDTGYIPLPRSLTRYARSFDCGERKWLT 123 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 43 AALMNRPTRGERRFAYW 59 >SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_55772| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_55573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) Length = 458 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_55103| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_55047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_54903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_54851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 94 ICDTGYIPLPRSLTRYARSFDCGERKWLT 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 42 AALMNRPTRGERRFAYW 58 >SB_54482| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 141 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 637 ICDTGYIPLPRSLTRYARSFDCGERKWLT 665 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 585 AALMNRPTRGERRFAYW 601 >SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 91 ICDTGYIPLPRSLTRYARSFDCGERKWLT 119 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 39 AALMNRPTRGERRFAYW 55 >SB_53836| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_53493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 344 VCVLGALPLPRSLTRCARSFGCGERYQLT 430 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 306 SALMNRPTRGERRFAYW 356 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,330,904 Number of Sequences: 59808 Number of extensions: 544375 Number of successful extensions: 10790 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2155 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5318 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2895879843 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -