BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_J09 (942 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40337| Best HMM Match : Ribosomal_L7Ae (HMM E-Value=7.3e-31) 175 6e-44 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 41 0.002 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 38 0.016 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 38 0.016 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 37 0.021 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 37 0.021 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.083 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 35 0.083 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 35 0.11 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 35 0.11 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 35 0.11 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 34 0.14 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 33 0.25 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 33 0.25 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 33 0.33 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 33 0.33 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.44 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.59 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.59 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 32 0.59 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 32 0.77 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 32 0.77 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 32 0.77 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 32 0.77 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 31 1.4 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 31 1.4 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) 31 1.4 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 31 1.4 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 31 1.8 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_19709| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 30 3.1 SB_32850| Best HMM Match : GRP (HMM E-Value=0.089) 29 4.1 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 29 4.1 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 29 5.5 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 29 5.5 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 29 5.5 SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) 29 5.5 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 29 5.5 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 29 5.5 SB_40225| Best HMM Match : No HMM Matches (HMM E-Value=.) 24 5.8 SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.2 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.2 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.2 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.2 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.2 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 28 9.5 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 28 9.5 SB_21661| Best HMM Match : EGF_CA (HMM E-Value=0) 28 9.5 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 28 9.5 SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 28 9.5 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 28 9.5 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 >SB_40337| Best HMM Match : Ribosomal_L7Ae (HMM E-Value=7.3e-31) Length = 108 Score = 175 bits (425), Expect = 6e-44 Identities = 82/99 (82%), Positives = 90/99 (90%) Frame = +1 Query: 199 IESINSRLALVMKSGKYCLGYKQTLKTLRQGKAKLVIIAKNAPPLRKSEIEYYALLAKTG 378 +ESINSRLALVMKSGK+ LG K TLKTLRQGKAKLVIIA N P LRKSEIEYYA+LAKTG Sbjct: 1 MESINSRLALVMKSGKFTLGLKSTLKTLRQGKAKLVIIANNTPQLRKSEIEYYAMLAKTG 60 Query: 379 VHHYSGNNIELGTACGKYYRVCTLAITDPGDSDIITTLP 495 VHHY+GNNIELGTACGKY+RV L+ITDPGDSDII ++P Sbjct: 61 VHHYTGNNIELGTACGKYFRVSVLSITDPGDSDIIRSMP 99 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 45.2 bits (102), Expect = 8e-05 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXX-PPXPPXPXXSXPXXXXPPPPPPXP 937 P PG A PP S P PP PP P S P PPPPPP P Sbjct: 942 PSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +2 Query: 797 SPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 SP + PP P PP P P PPPPP P Sbjct: 913 SPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPP 959 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +2 Query: 809 LAXPPXXXXAAS--XXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 L PP A S P PP PP P S P PP P P Sbjct: 932 LPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPP 976 Score = 28.7 bits (61), Expect = 7.2 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 5/57 (8%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPP-XPXXSXPXXXXPP----PPPPXP 937 P SP A PP P P PP P S P PP PPPP P Sbjct: 904 PGGSESPS--ASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPP 958 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/52 (34%), Positives = 19/52 (36%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P P PP + P PP PP P P PPPPPP P Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/52 (34%), Positives = 19/52 (36%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P P + PP P PP PP P P PPPPPP P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/52 (34%), Positives = 19/52 (36%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P P + PP P PP PP P P PPPPPP P Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +2 Query: 797 SPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 S G PP P PP PP P P PPPPPP P Sbjct: 358 SAGINMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPP 404 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P P PP P PP PP P P PPPPPP P Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXPR 940 P SP PP P PP PP P P PPPPPP R Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALR 435 Score = 38.3 bits (85), Expect = 0.009 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P SP PP P PP PP P P PPP PP P Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 37.9 bits (84), Expect = 0.012 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +2 Query: 797 SPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 SP PP + P P PP P P PPPPPP P Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPP 410 Score = 37.9 bits (84), Expect = 0.012 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P P PP + P PP PP P P PPPPP P Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 34.7 bits (76), Expect = 0.11 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPPXPR 940 P PP PP P P PP PPP P+ Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQ 394 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 38.3 bits (85), Expect = 0.009 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPPXP 937 PP PP P S P PPPPPP P Sbjct: 1160 PPPPPPPPPSSPSPPPPPPPPPPP 1183 Score = 36.3 bits (80), Expect = 0.036 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPPXP 937 PP PP P P PPPPPP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPP 1180 Score = 36.3 bits (80), Expect = 0.036 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P PP PP S P PPPPPP P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 35.1 bits (77), Expect = 0.083 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPP 931 P PP PP P P PPPPPP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPP 1183 Score = 33.9 bits (74), Expect = 0.19 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PPP PPP P PP PP P Sbjct: 1159 PPPPPPPPPPSSPSPPPPPPPPP 1181 Score = 33.9 bits (74), Expect = 0.19 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PPP PPP P PP PP P Sbjct: 1160 PPPPPPPPPSSPSPPPPPPPPPP 1182 Score = 33.5 bits (73), Expect = 0.25 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PPP PPP P PP PP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPP 1179 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PPP PPP PP PP P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPP 1180 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PPP PP P PP PP P Sbjct: 1161 PPPPPPPPSSPSPPPPPPPPPPP 1183 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 37.5 bits (83), Expect = 0.016 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P PP PP P P PPPPPP P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 36.3 bits (80), Expect = 0.036 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPPXP 937 PP PP P P PPPPPP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 36.3 bits (80), Expect = 0.036 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPPXP 937 PP PP P P PPPPPP P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFP 489 Score = 33.9 bits (74), Expect = 0.19 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 807 VXXXPPPXXXPPPXDXXXPXPPXPPXP 887 V PPP PPP P PP PP P Sbjct: 460 VGQAPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 33.5 bits (73), Expect = 0.25 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PPP PPP P PP PP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPP 487 Score = 33.5 bits (73), Expect = 0.25 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PPP PPP P PP PP P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFP 489 Score = 33.5 bits (73), Expect = 0.25 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PPP PPP P PP PP P Sbjct: 470 PPPPPPPPPPPPPPPPPPFPPPP 492 Score = 33.1 bits (72), Expect = 0.33 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P PP PP P P PPP PP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPP 492 Score = 33.1 bits (72), Expect = 0.33 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P PP PP P P PP PPP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 33.1 bits (72), Expect = 0.33 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P PP PP P P P PPPP P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 31.9 bits (69), Expect = 0.77 Identities = 16/54 (29%), Positives = 18/54 (33%) Frame = +3 Query: 720 AIALXXPXIXXXXQXXXTXASXXVXGPRAVXXXPPPXXXPPPXDXXXPXPPXPP 881 AI P + + T P PPP PPP P PP PP Sbjct: 440 AIPKHDPRLFSQDEDGDTEGVGQAPPPPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 839 ASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 A P PP PP P P PPPPP Sbjct: 463 APPPPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PPP PPP PP PP P Sbjct: 474 PPPPPPPPPPPPPPFPPPPPPTP 496 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 37.5 bits (83), Expect = 0.016 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 PP S PP PP P S PPPPPP P Sbjct: 681 PPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPP 720 Score = 33.5 bits (73), Expect = 0.25 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPPXP 937 PP PP P PPPPPP P Sbjct: 678 PPPPPLPVIEGSSLSVPPPPPPPP 701 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPP 931 PP PP P PPPPPP Sbjct: 726 PPPPPSPQPGCAGLPPPPPPPP 747 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/44 (29%), Positives = 15/44 (34%) Frame = +2 Query: 806 RLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 ++ PP PP PP P PPPPP P Sbjct: 675 KVPPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPP 718 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 P PG PP PP PP P + PPPPPP Sbjct: 714 PPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCA----GLPPPPPP 759 Score = 29.9 bits (64), Expect = 3.1 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 869 PXPPXPXXSXPXXXXPPPPPPXPR 940 P PP P P PPPPP P+ Sbjct: 710 PMPPPPPPPPPGCAGLPPPPPSPQ 733 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 798 PRAVXXXPPPXXXPPPXDXXXPXPPXPPXP 887 P PPP P P P PP PP P Sbjct: 719 PPGCAGLPPPPPSPQPGCAGLPPPPPPPPP 748 Score = 29.5 bits (63), Expect = 4.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PPP PPP P PP P P Sbjct: 712 PPPPPPPPPGCAGLPPPPPSPQP 734 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 PP + P PP PP P PPPP P P Sbjct: 699 PPPPPLLSGTLPMPPPPPPPPPGCAGLP----PPPPSPQP 734 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 37.1 bits (82), Expect = 0.021 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXGXXEAAXXXXGGXARRPGDXXXXG 781 G GGGGGG G G GG GG G GG GD G Sbjct: 665 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 33.5 bits (73), Expect = 0.25 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXGXXEAAXXXXGG 817 G GGGGGG G G GG GG G GG Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 699 Score = 33.5 bits (73), Expect = 0.25 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXGXXEAAXXXXGG 817 G GGGGGG G G GG GG G GG Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 33.1 bits (72), Expect = 0.33 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 930 GGGGGGXXXXGXXXXGXGGXGGXXXXGXXEAAXXXXGGXARRPG 799 GGGGGG G G GG GG G GG A G Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 33.1 bits (72), Expect = 0.33 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXGXXEAAXXXXGGXARRPGD 796 G GGGGGG G G GG GG G G GD Sbjct: 671 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDGD 717 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGG 818 G GG GG G GGG GGG Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGG 679 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 37.1 bits (82), Expect = 0.021 Identities = 19/47 (40%), Positives = 21/47 (44%) Frame = +2 Query: 797 SPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 SP ++ PP P PP PP P S P PPPPPP P Sbjct: 197 SPSQITQPP----PPPPRPPPSPPPPPPPPSPSPP--RPPPPPPPSP 237 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P PP PP P P P PPP P Sbjct: 224 PSPPRPPPPPPPSPPRPLAAKLPEPPPIP 252 Score = 29.9 bits (64), Expect = 3.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PPP P P P PP PP P Sbjct: 218 PPPPPSPSPPRPPPPPPPSPPRP 240 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 35.1 bits (77), Expect = 0.083 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPP 931 P PP PP P P PPPPPP Sbjct: 685 PPPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 31.9 bits (69), Expect = 0.77 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPP 931 P PP PP P P PPPPP Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPP 710 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P PP PP P P PPPP P Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P PP PP P P PPPP P Sbjct: 687 PPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PPP PPP P PP P P Sbjct: 692 PPPPPPPPPPQPSTPPPPPPSTP 714 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PPP PPP P PP P P Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTP 706 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PPP PPP P P PP P Sbjct: 687 PPPPPPPPPPPPPPPQPSTPPPP 709 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PPP PPP P P PP P Sbjct: 689 PPPPPPPPPPPPPQPSTPPPPPP 711 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPPXPR 940 P P PP P P PPPPPP P+ Sbjct: 677 PIQTMVPPPPPPPPPPP----PPPPPPPPQ 702 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PPP PPP P PP PP P Sbjct: 683 PPPPPPPPP--PPPPPPPPPPQP 703 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 35.1 bits (77), Expect = 0.083 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 800 PGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 P R A PP A PP PP P P PPPPPP Sbjct: 341 PSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGP----PPPPPP 380 Score = 31.9 bits (69), Expect = 0.77 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 4/48 (8%) Frame = +2 Query: 809 LAXPPXXXXAASXXPXXXX--PPXPPXPXXSXP--XXXXPPPPPPXPR 940 +A PP A P PP PP P P PPPPPP R Sbjct: 353 MAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGR 400 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 5/43 (11%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXP-----XXXXPPPPPP 931 PP AA P PP PP + P PPPPPP Sbjct: 289 PPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPP 331 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 PP P PP P P PPPPP P Sbjct: 330 PPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPP 369 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 34.7 bits (76), Expect = 0.11 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P PP PP P PPPPPP P Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPPLP 684 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 812 AXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 A PP PP PP P P PPPPPP Sbjct: 658 AGPPPPPPPPPGGQAGGAPPPPPPPL---PGGAAPPPPPP 694 Score = 29.9 bits (64), Expect = 3.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PPP PPP PP PP P Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPP 682 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGGXXXTARGP 794 G GG GG G GGG GGG RGP Sbjct: 343 GGGGGGGGGGGGGGGGGRGGGGGFSSRGRGP 373 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 939 RGXGGGGGGXXXXGXXXXGXGGXGGXXXXG 850 RG GGGGGG G G GG GG G Sbjct: 341 RGGGGGGGGGGGGGGGGGGRGGGGGFSSRG 370 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 34.7 bits (76), Expect = 0.11 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPP 931 PP PP P + P PPPPPP Sbjct: 304 PPPPPPPGGAPPPPPPPPPPPP 325 Score = 34.7 bits (76), Expect = 0.11 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 798 PRAVXXXPPPXXXPPPXDXXXPXPPXPP 881 P PPP PPP D P PP PP Sbjct: 310 PGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 34.3 bits (75), Expect = 0.14 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P PP PP P P PPPPP P Sbjct: 309 PPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 798 PRAVXXXPPPXXXPPPXDXXXPXPPXPPXP 887 P V P PPP D P PP PP P Sbjct: 281 PDIVTGGGAPVPPPPPADGSAPAPPPPPPP 310 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 P + G PP P PP PP P PPPPPP Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAP----PPPPPP 337 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 798 PRAVXXXPPPXXXPPPXDXXXPXPPXPPXP 887 P A P P PPP P PP PP P Sbjct: 295 PPADGSAPAPPPPPPPGGAPPPPPPPPPPP 324 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P P PP P P PPPPPP P Sbjct: 296 PADGSAPAPPPPPP--PGGAPPPPPPPPP 322 Score = 29.9 bits (64), Expect = 3.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PPP PPP PP PP P Sbjct: 315 PPPPPPPPPPPGDGGAPPPPPPP 337 Score = 29.5 bits (63), Expect = 4.1 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXP---PXPPXPXXSXPXXXXPPPPPPXP 937 PP +A P P P PP P P PPPP P Sbjct: 294 PPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +2 Query: 869 PXPPXPXXSXPXXXXPPPPPP 931 P PP P PPPPPP Sbjct: 290 PVPPPPPADGSAPAPPPPPPP 310 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 34.3 bits (75), Expect = 0.14 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPP 931 PP PP P P PPPPPP Sbjct: 196 PPPPPPPPPGFPGGAPPPPPPP 217 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +3 Query: 798 PRAVXXXPPPXXXPPPXDXXXPXPPXPPXP 887 P + PPP PPP PP PP P Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPPP 217 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPP 931 P PP PP P PPPPPP Sbjct: 190 PMAGMPPPPPPPPPPGFPGGAPPPPPP 216 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXP---PPPPPXP 937 PP P PP PP P P P PPPPP P Sbjct: 358 PPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPP 400 Score = 33.9 bits (74), Expect = 0.19 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXP---PPPPPXP 937 PP P PP PP P P P PPPPP P Sbjct: 368 PPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 32.7 bits (71), Expect = 0.44 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXP---PPPPPXP 937 PP S P P PP P P P PPPPP P Sbjct: 348 PPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPP 390 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPP---PPPPXP 937 PP P P PP P + P PP PPPP P Sbjct: 357 PPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPP 399 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPP---PPPPXP 937 PP P P PP P + P PP PPPP P Sbjct: 367 PPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPP 409 Score = 29.9 bits (64), Expect = 3.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PPP PPP PP PP P Sbjct: 388 PPPTNGPPPPPPPTNGPPPPPPP 410 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 PP A S P P P P P PPPPPP Sbjct: 405 PPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPPPP 442 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +2 Query: 800 PGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P L P P P P P S P P PPPP P Sbjct: 360 PKPLMSTPVQRPPGMRPPGAGNGPGGPPPPWSKPGGILPGPPPPGP 405 Score = 28.7 bits (61), Expect = 7.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 798 PRAVXXXPPPXXXPPPXDXXXPXPPXPPXP 887 P A PPP PPP P PP P Sbjct: 315 PAAFAPAPPPSQAPPPPKTIPSTLPPPPVP 344 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 33.5 bits (73), Expect = 0.25 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXGXXEAAXXXXGG 817 G GGGGGG G G GG GG G GG Sbjct: 71 GGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGG 110 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 930 GGGGGGXXXXGXXXXGXGGXGGXXXXGXXEAAXXXXGG 817 GGGGGG G G GG GG G GG Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGG 99 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXGXXEAAXXXXGG 817 G GGGGGG G G G GG G GG Sbjct: 66 GGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGG 105 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXG-GXXXXGXXEAAXXXXGG 817 G GGGGGG G G GG G G G + GG Sbjct: 69 GGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGG 109 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = -1 Query: 930 GGGGGGXXXXGXXXXGXGGXGGXXXXGXXEAAXXXXGG 817 GGGGGG G G GG G G + GG Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGG 100 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXG 850 G GGGGGG G G GG G G Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGG 91 Score = 28.3 bits (60), Expect = 9.5 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXGXXEAAXXXXGG 817 G GGGGGG G G GG GG G GG Sbjct: 62 GGGGGGGG----GGGGGGGGGGGGGGDDGDGGGGDGGGGG 97 Score = 28.3 bits (60), Expect = 9.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGGXXXTAR 800 G G GG G GGG GGG AR Sbjct: 89 GGGDGGGGGGGGDGGGGGGGGGGGVGRAR 117 Score = 28.3 bits (60), Expect = 9.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXG 850 G GGGGGG G G GG G G Sbjct: 91 GDGGGGGGGGDGGGGGGGGGGGVGRARFG 119 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 33.5 bits (73), Expect = 0.25 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPP-PPXP 937 P P A P P PP PP P P PPPP PP P Sbjct: 136 PNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYP 188 Score = 33.1 bits (72), Expect = 0.33 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 PP + P P PP P P PPPP P P Sbjct: 130 PPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPP 169 Score = 33.1 bits (72), Expect = 0.33 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Frame = +2 Query: 779 FPXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPP-PPPPXP 937 +P P PP P PP PP P P P PPPP P Sbjct: 156 YPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNP 209 Score = 32.7 bits (71), Expect = 0.44 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 PP P PP PP P P PP PPP Sbjct: 177 PPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPP 214 Score = 31.9 bits (69), Expect = 0.77 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 1/53 (1%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPP-PPXP 937 P P PP P PP P P P PPPP PP P Sbjct: 105 PPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYP 157 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 PP P PP PP P P PPPP P Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAP 123 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PPP PPP + P PP P P Sbjct: 103 PPPPPYPPPPNPPYPPPPNAPYP 125 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 4/44 (9%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPP----PPXP 937 PP S PP PP P P PPPP PP P Sbjct: 135 PPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPP 178 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +3 Query: 798 PRAVXXXPPPXXXPPPXDXXXPXPPXPPXP 887 P PP PPP + P PP PP P Sbjct: 183 PNPPYPPPPNPPYPPPPNAPNPPPPNPPYP 212 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPP--PPPPXP 937 PP + P PP PP P P PP P PP P Sbjct: 193 PPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYP 234 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +2 Query: 800 PGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXPR 940 P PP P PP PP P P P PPPP P+ Sbjct: 198 PPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNP----PYPPPPNPQ 240 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PP PPP + P PP PP P Sbjct: 111 PPNPPYPPPPNAPYPPPPNPPYP 133 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPP-PPXP 937 PP P PP PP P P PPPP PP P Sbjct: 95 PPPPYPPYPPPPPYPPPPNPPYP--PPPNAPYPPPPNPPYP 133 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 3/49 (6%) Frame = +2 Query: 800 PGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPP---PPPPXP 937 P PP P PP P P P PP PPPP P Sbjct: 119 PPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNP 167 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/56 (30%), Positives = 18/56 (32%), Gaps = 4/56 (7%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPP----PPXP 937 P P PP + P PP P P P PPPP PP P Sbjct: 152 PNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPP 207 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 P P PP P PP P P P PP PPP Sbjct: 176 PPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPP 225 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/46 (30%), Positives = 15/46 (32%) Frame = +2 Query: 800 PGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P PP P PP P + P P PPPP P Sbjct: 135 PPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYP 180 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 Query: 798 PRAVXXXPPPXXXPPPXDXXXPXPPXPPXP 887 P A PP PPP + P PP PP P Sbjct: 199 PNAPNPPPPNPPYPPPPN--APNPPYPPPP 226 Score = 28.3 bits (60), Expect = 9.5 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 PP P PP P P P P PP P P Sbjct: 151 PPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPP 190 Score = 28.3 bits (60), Expect = 9.5 Identities = 16/54 (29%), Positives = 16/54 (29%), Gaps = 2/54 (3%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPP--PPPPXP 937 P P PP P PP P P P PP P PP P Sbjct: 170 PNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYP 223 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 33.5 bits (73), Expect = 0.25 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXP---PXPPXPXXSXPXXXXPPPPPPXP 937 PP A+ P P PP P P PPPPPP P Sbjct: 166 PPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPP 208 Score = 33.5 bits (73), Expect = 0.25 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 798 PRAVXXXPPPXXXPPPXDXXXPXPPXPP 881 P A PPP PPP P PP PP Sbjct: 182 PLAAASPPPPSGGPPPPPPPPPPPPPPP 209 Score = 32.7 bits (71), Expect = 0.44 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P + G PP A P P P P PPPPPP P Sbjct: 156 PIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPP 207 Score = 31.9 bits (69), Expect = 0.77 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P AAS P PP PP P PPPPPP P Sbjct: 179 PAVPLAAASPPPPSGGPPPPPPP---------PPPPPPPP 209 Score = 31.1 bits (67), Expect = 1.4 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 P SP A PP A P PP PP P PPPPPP Sbjct: 127 PPPPTSPATRAPPPPPPIA----PATGGPPPPPP---IAPATGGPPPPPP 169 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 6/44 (13%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPX------PPXPXXSXPXXXXPPPPPP 931 PP S P PP PP P P PPPPPP Sbjct: 113 PPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPP 156 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 PP A PP PP + P PPPPPP Sbjct: 110 PPPPPRAPETPSQAPSPPPPP----TSPATRAPPPPPP 143 Score = 28.7 bits (61), Expect = 7.2 Identities = 16/54 (29%), Positives = 18/54 (33%), Gaps = 4/54 (7%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXX----PPXPPXPXXSXPXXXXPPPPPP 931 P +P P AA+ P PP PP P P PPPP Sbjct: 166 PPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 28.3 bits (60), Expect = 9.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 869 PXPPXPXXSXPXXXXPPPPPPXP 937 P PP P S PPPPP P Sbjct: 124 PSPPPPPTSPATRAPPPPPPIAP 146 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 33.1 bits (72), Expect = 0.33 Identities = 17/51 (33%), Positives = 20/51 (39%), Gaps = 5/51 (9%) Frame = +2 Query: 800 PGRLAXPPXXXXAASXXPXXXXP-----PXPPXPXXSXPXXXXPPPPPPXP 937 P ++ PP +A P P P PP P P PPPPP P Sbjct: 343 PPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPP 393 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/46 (34%), Positives = 19/46 (41%) Frame = +2 Query: 803 GRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXPR 940 G++A PP S P PP P + PPPPPP R Sbjct: 337 GQIAPPPPPI---SKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRR 379 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 795 GPRAVXXXPPPXXXPPPXDXXXPXPPXPP 881 GP + PPP PPP PP PP Sbjct: 256 GPTSGGEPPPPKNAPPPPKRGSSNPPPPP 284 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 33.1 bits (72), Expect = 0.33 Identities = 17/51 (33%), Positives = 20/51 (39%), Gaps = 5/51 (9%) Frame = +2 Query: 800 PGRLAXPPXXXXAASXXPXXXXP-----PXPPXPXXSXPXXXXPPPPPPXP 937 P ++ PP +A P P P PP P P PPPPP P Sbjct: 255 PPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPP 305 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/46 (34%), Positives = 19/46 (41%) Frame = +2 Query: 803 GRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXPR 940 G++A PP S P PP P + PPPPPP R Sbjct: 249 GQIAPPPPPI---SKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRR 291 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 795 GPRAVXXXPPPXXXPPPXDXXXPXPPXPP 881 GP + PPP PPP PP PP Sbjct: 168 GPTSGGEPPPPKNAPPPPKRGSSNPPPPP 196 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 33.1 bits (72), Expect = 0.33 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPPXP 937 PP P P P PPPPPP P Sbjct: 225 PPPPAAPAPPPPPAAAPPPPPPPP 248 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PP PPP P PP PP P Sbjct: 227 PPAAPAPPPPPAAAPPPPPPPPP 249 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 PP P P PP P + P PPPPPP Sbjct: 215 PPEPDYLEPTPPPPAAPAPPPPPAAAPP---PPPPPPP 249 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P P PP P + P PPPPPP P Sbjct: 225 PPPPAAPAPPPPPAAAP----PPPPPPPP 249 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 32.7 bits (71), Expect = 0.44 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 795 GPRAVXXXPPPXXXPPPXDXXXPXPPXPP 881 GP AV PPP PPP P PP PP Sbjct: 76 GPAAVIPPPPP---PPPPASNVPAPPPPP 101 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P PP PP P + PPPPP P Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPPPVMP 105 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 32.3 bits (70), Expect = 0.59 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +2 Query: 812 AXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 A PP A + P PP P P P PPPPP P Sbjct: 63 AAPPPPAAAPAAPPPPAAPPAAPPPPPPLPA---PPPPPAQP 101 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P PP PP P P P PPP P Sbjct: 81 PPAAPPPPPPLPAPPPPPAQPAPQPPPAP 109 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/41 (36%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +2 Query: 818 PPXXXXAA-SXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 PP AA + P P P P + P PPPP P P Sbjct: 54 PPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAP 94 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +2 Query: 812 AXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 A PP A+ P P PP P P PPP PP Sbjct: 74 APPPPAAPPAAPPPPPPLPAPPPPPAQPAP---QPPPAPP 110 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 798 PRAVXXXPPPXXXPPPXDXXXPXPPXPPXP 887 P A PPP PP P P PP P Sbjct: 68 PAAAPAAPPPPAAPPAAPPPPPPLPAPPPP 97 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 798 PRAVXXXPPPXXXPPPXDXXXPXPPXPPXP 887 P A PPP PPP P P PP P Sbjct: 81 PPAAPPPPPPLPAPPP-PPAQPAPQPPPAP 109 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 32.3 bits (70), Expect = 0.59 Identities = 17/54 (31%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXP--PPPPPXP 937 P P + PP A P PP P + P P PPPPP P Sbjct: 155 PSIASQPPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAP 208 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 32.3 bits (70), Expect = 0.59 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPPXP 937 PP PP P + P PPPPPP P Sbjct: 298 PPAPPLPNFTSPS---PPPPPPLP 318 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +2 Query: 812 AXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 A P + S P PP P P PPPPP P Sbjct: 300 APPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPP 341 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 31.9 bits (69), Expect = 0.77 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXG 850 G GGGGGG G G GG GG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 160 Score = 31.9 bits (69), Expect = 0.77 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXG 850 G GGGGGG G G GG GG G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 161 Score = 31.9 bits (69), Expect = 0.77 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXG 850 G GGGGGG G G GG GG G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 162 Score = 31.9 bits (69), Expect = 0.77 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXG 850 G GGGGGG G G GG GG G Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 163 Score = 31.9 bits (69), Expect = 0.77 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXG 850 G GGGGGG G G GG GG G Sbjct: 136 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 164 Score = 31.9 bits (69), Expect = 0.77 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXG 850 G GGGGGG G G GG GG G Sbjct: 137 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 31.9 bits (69), Expect = 0.77 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXG 850 G GGGGGG G G GG GG G Sbjct: 138 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 31.9 bits (69), Expect = 0.77 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXG 850 G GGGGGG G G GG GG G Sbjct: 140 GGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGG 818 G GG GG G GGG GGG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGG 154 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGG 818 G GG GG G GGG GGG Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGG 155 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGG 818 G GG GG G GGG GGG Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGG 156 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGG 818 G GG GG G GGG GGG Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGG 157 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGG 818 G GG GG G GGG GGG Sbjct: 136 GGGGGGGGGGGGGGGGGGGGGGG 158 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGG 818 G GG GG G GGG GGG Sbjct: 137 GGGGGGGGGGGGGGGGGGGGGGG 159 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGG 818 G GG GG G GGG GGG Sbjct: 138 GGGGGGGGGGGGGGGGGGGGGGG 160 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGG 818 G GG GG G GGG GGG Sbjct: 139 GGGGGGGGGGGGGGGGGGGGGGG 161 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGG 818 G GG GG G GGG GGG Sbjct: 140 GGGGGGGGGGGGGGGGGGGGGGG 162 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGG 818 G GG GG G GGG GGG Sbjct: 141 GGGGGGGGGGGGGGGGGGGGGGG 163 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGG 818 G GG GG G GGG GGG Sbjct: 142 GGGGGGGGGGGGGGGGGGGGGGG 164 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGG 818 G GG GG G GGG GGG Sbjct: 143 GGGGGGGGGGGGGGGGGGGGGGG 165 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGG 818 G GG GG G GGG GGG Sbjct: 144 GGGGGGGGGGGGGGGGGGGGGGG 166 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXG 850 G GGGGGG G G GG G G Sbjct: 146 GGGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 31.9 bits (69), Expect = 0.77 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXG 850 G GGGGGG G G GG GG G Sbjct: 793 GGGGGGGGGGDGGGYGDGDGGGGGGGGGG 821 Score = 31.9 bits (69), Expect = 0.77 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXG 850 G GGGGGG G G GG GG G Sbjct: 845 GDGGGGGGGGGGGGGGGGGGGGGGGGGGG 873 Score = 31.9 bits (69), Expect = 0.77 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXG 850 G GGGGGG G G GG GG G Sbjct: 847 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 875 Score = 31.9 bits (69), Expect = 0.77 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXG 850 G GGGGGG G G GG GG G Sbjct: 848 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXGXXEAAXXXXGG 817 G GGGGGG G GG GG G + GG Sbjct: 795 GGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGG 834 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/52 (34%), Positives = 19/52 (36%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXGXXEAAXXXXGGXARRPGDXXXXG 781 G GGGGGG G G GG G G + GG GD G Sbjct: 783 GDGGGGGG---GGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYG 831 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXGXXEAAXXXXGGXARRPGDXXXXG 781 G GGGGGG G GG G G GG GD G Sbjct: 786 GGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFG 837 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXGXXEAAXXXXGG 817 G GGGGGG G G G GG G GG Sbjct: 812 GGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGG 851 Score = 29.9 bits (64), Expect = 3.1 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXG-GXGGXXXXGXXEAAXXXXGG 817 G GGGGGG G G G G GG G A GG Sbjct: 810 GDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGG 850 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXGXXEAAXXXXGG 817 G GGGGGG G G G GG G GG Sbjct: 817 GGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGG 856 Score = 29.1 bits (62), Expect = 5.5 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = -1 Query: 930 GGGGGGXXXXGXXXXGXGGXGGXXXXGXXEAAXXXXGGXARRPGDXXXXG 781 GGGGGG G GG GG G GG G G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGG 818 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGG 818 G GG GG G GGG GGG Sbjct: 845 GDGGGGGGGGGGGGGGGGGGGGG 867 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGG 818 G GG GG G GGG GGG Sbjct: 847 GGGGGGGGGGGGGGGGGGGGGGG 869 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGG 818 G GG GG G GGG GGG Sbjct: 848 GGGGGGGGGGGGGGGGGGGGGGG 870 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGG 818 G GG GG G GGG GGG Sbjct: 849 GGGGGGGGGGGGGGGGGGGGGGG 871 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGG 818 G GG GG G GGG GGG Sbjct: 850 GGGGGGGGGGGGGGGGGGGGGGG 872 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGG 818 G GG GG G GGG GGG Sbjct: 851 GGGGGGGGGGGGGGGGGGGGGGG 873 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGG 818 G GG GG G GGG GGG Sbjct: 852 GGGGGGGGGGGGGGGGGGGGGGG 874 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGG 818 G GG GG G GGG GGG Sbjct: 853 GGGGGGGGGGGGGGGGGGGGGGG 875 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGG 818 G GG GG G GGG GGG Sbjct: 854 GGGGGGGGGGGGGGGGGGGGGGG 876 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 31.9 bits (69), Expect = 0.77 Identities = 13/39 (33%), Positives = 15/39 (38%) Frame = +2 Query: 821 PXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P ++ P PP P P PPPPPP P Sbjct: 330 PPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPPP 368 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 31.9 bits (69), Expect = 0.77 Identities = 17/45 (37%), Positives = 19/45 (42%) Frame = +2 Query: 797 SPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 SPG LA PP + P PP P + P PPPP P Sbjct: 173 SPGILAPPPAPPGVLAPPPA---PPGVLPPPPAPPGALIPPPPAP 214 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 31.5 bits (68), Expect = 1.0 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = -1 Query: 930 GGGGGGXXXXGXXXXGXGGXGGXXXXGXXEA-AXXXXGGXARRPGDXXXXG 781 GGGGGG G G GG G G A A GG GD G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDGDG 91 >SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 421 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +3 Query: 777 ASXXVXGPRAVXXXPPPXXXPPPXDXXXPXPPXPPXP 887 AS + R P P PPP D PP PP P Sbjct: 180 ASVRLVNTRMPDESPEPTRPPPPLDDLDDLPPPPPPP 216 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPP 881 PPP PPP P PP PP Sbjct: 73 PPPLCAPPPPPPPPPPPPPPP 93 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +2 Query: 836 AASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 AA+ P PP PP P PPPPPP P Sbjct: 69 AAATPPPLCAPPPPPPP---------PPPPPPPP 93 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Frame = +2 Query: 770 HXXFPXXXXSPGRL---AXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 H P PG + PP P PP P P P PPPPPP Sbjct: 245 HSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMP-PGGMPPNMEQPPPPPP 300 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPPXPR 940 PP PP P P P P PP PR Sbjct: 1362 PPTPPRPPTPRPRPPTPRPGPPTPR 1386 >SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) Length = 131 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGG 865 G GGGGGG G G GG GG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGG 76 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGG 865 G GGGGGG G G GG GG Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 930 GGGGGGXXXXGXXXXGXGGXGGXXXXG 850 GGGGGG G G GG GG G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGG 818 G GG GG G GGG GGG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGG 75 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGG 818 G GG GG G GGG GGG Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGG 76 Score = 29.1 bits (62), Expect = 5.5 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXGXXEAAXXXXGGXA 811 G GGGGGG G G GG G + GG A Sbjct: 55 GGGGGGGGGGGGGGGGGGGGGGGDGDDDDGDDDDDDDDGGDA 96 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPP 881 PPP PPP P PP PP Sbjct: 274 PPPLCAPPPPPPPPPPPPPPP 294 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +2 Query: 836 AASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 AA+ P PP PP P PPPPPP P Sbjct: 270 AAATPPPLCAPPPPPPP---------PPPPPPPP 294 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 842 SXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 S P P PP P PPPPPP P Sbjct: 85 SCMPTSCAPACPPACCAPPPPPPPPPPPPPPP 116 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 836 AASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 A + P PP PP P P PPPPPP Sbjct: 92 APACPPACCAPPPPPPPPPPPPP---PPPPPP 120 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PP PPP P PP PP P Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPP 118 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 798 PRAVXXXPPPXXXPPPXDXXXPXPPXPPXP 887 P A PPP PPP P PP PP P Sbjct: 96 PPACCAPPPPPPPPPP-----PPPPPPPPP 120 Score = 29.5 bits (63), Expect = 4.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 839 ASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 A P P PP P P PPPPPP P Sbjct: 92 APACPPACCAPPPPPPPPPPP----PPPPPPPP 120 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 869 PXPPXPXXSXPXXXXPPPPPP 931 P PP P P PPPPPP Sbjct: 908 PPPPLPLAPEPPPPLPPPPPP 928 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 869 PXPPXPXXSXPXXXXPPPPPPXP 937 P PP P P P PPPP P Sbjct: 906 PAPPPPLPLAPEPPPPLPPPPPP 928 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGG 865 G GGGGGG G G GG GG Sbjct: 1759 GGGGGGGGMGGGGGMAGGGGGMGG 1782 Score = 28.7 bits (61), Expect = 7.2 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXGXXEAAXXXXGG 817 G GGGGGG G G G GG G A GG Sbjct: 1757 GFGGGGGGGGMGG--GGGMAGGGGGMGGGGMAAGGGEFGG 1794 Score = 28.3 bits (60), Expect = 9.5 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGGXXXTARG 797 G GG G G GGG GGG A G Sbjct: 1799 GGGGMAGGGGGMGGGGGGMGGGGEGMGAAG 1828 >SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 795 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 842 SXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 S P PP P P S PPPPPP Sbjct: 678 SSKPPLTPPPPLPTPIASSEPLPLPPPPPP 707 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 839 ASXXPXXXXPPXPPXPXXSXPXXXXPPPPP 928 +S P PP P S P PPPPP Sbjct: 678 SSKPPLTPPPPLPTPIASSEPLPLPPPPPP 707 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPPXP 937 PP PP P P PPPPPP P Sbjct: 424 PPPPPPPAPLPP----PPPPPPQP 443 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PPP PPP P PP PP P Sbjct: 424 PPP---PPPPAPLPPPPPPPPQP 443 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPP 931 PP PP P PPPPPP Sbjct: 755 PPPPPPPAVPGEGARPPPPPPP 776 Score = 29.5 bits (63), Expect = 4.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 869 PXPPXPXXSXPXXXXPPPPPPXP 937 P PP P PPPPPP P Sbjct: 755 PPPPPPPAVPGEGARPPPPPPPP 777 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 798 PRAVXXXPPPXXXPPPXDXXXPXPPXPPXP 887 PR PPP PPP P PP PP P Sbjct: 860 PRPRPRRPPPPPPPPP----PPPPPPPPPP 885 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPP 931 P PP P P PPPPPP Sbjct: 864 PRRPPPPPPPPPPPPPPPPPPP 885 Score = 29.9 bits (64), Expect = 3.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 869 PXPPXPXXSXPXXXXPPPPPPXP 937 P P P P PPPPPP P Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPP 884 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 878 PXPXXSXPXXXXPPPPPPXP 937 P P P PPPPPP P Sbjct: 860 PRPRPRRPPPPPPPPPPPPP 879 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +3 Query: 804 AVXXXPPPXXXPPPXDXXXPXPPXPPXP 887 ++ PPP PPP P PP P P Sbjct: 779 SIPTTPPPEYPPPPPGLARPNPPPPNPP 806 >SB_19709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 613 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPP 931 PP PP P PPPPPP Sbjct: 584 PPHPPPPAHHVNKPGVPPPPPP 605 >SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 29.9 bits (64), Expect = 3.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PPP PPP PP PP P Sbjct: 5 PPPPPPPPPIAAEFTAPPAPPPP 27 Score = 29.5 bits (63), Expect = 4.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPPXP 937 PP PP P PP PPP P Sbjct: 5 PPPPPPPPPIAAEFTAPPAPPPPP 28 Score = 29.5 bits (63), Expect = 4.1 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPPXP 937 PP PP P + PPPPP P Sbjct: 7 PPPPPPPIAAEFTAPPAPPPPPNP 30 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 29.9 bits (64), Expect = 3.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 P P PPP P PP PP P Sbjct: 1264 PQPPFMPPPPRMQPPGPPGPPGP 1286 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 930 GGGGGGXXXXGXXXXGXGGXGGXXXXG 850 GGGGGG G G GG GG G Sbjct: 95 GGGGGGFGGGGGGGFGGGGGGGGGFGG 121 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGGXXXTAR 800 G GG GG G GGG GGG +R Sbjct: 102 GGGGGGGFGGGGGGGGGFGGGGGGGFGSR 130 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGG 818 G GG GG G GGG GGG Sbjct: 92 GFGGGGGGGFGGGGGGGFGGGGG 114 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGG 818 G GG GG G GGG GGG Sbjct: 100 GFGGGGGGGFGGGGGGGGGFGGG 122 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 930 GGGGGGXXXXGXXXXGXGGXGG 865 GGGGGG G G GG GG Sbjct: 103 GGGGGGFGGGGGGGGGFGGGGG 124 Score = 28.3 bits (60), Expect = 9.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXG 850 G GGGGGG G GG GG G Sbjct: 92 GFGGGGGGGFGGGGGGGFGGGGGGGGGFG 120 Score = 28.3 bits (60), Expect = 9.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXG 850 G GGGGGG G G G GG G Sbjct: 100 GFGGGGGGGFGGGGGGGGGFGGGGGGGFG 128 >SB_32850| Best HMM Match : GRP (HMM E-Value=0.089) Length = 676 Score = 29.5 bits (63), Expect = 4.1 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = -1 Query: 930 GGGGGGXXXXGXXXXGXGGXGGXXXXGXXEAAXXXXGG 817 GGGGGG G GG GG G + GG Sbjct: 556 GGGGGGDYNGGDGDDDDGGGGGDDDDGDGDGDDDDDGG 593 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 29.5 bits (63), Expect = 4.1 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 4/43 (9%) Frame = +2 Query: 821 PXXXXAASXXPXXXXPPXPP----XPXXSXPXXXXPPPPPPXP 937 P A + P PP PP P PPPPPP P Sbjct: 540 PIPAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEP 582 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 PP P P P P PPPPPP P Sbjct: 283 PPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 29.5 bits (63), Expect = 4.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PPP PPP P PP P P Sbjct: 96 PPPATPPPPTMPPTPPPPQTPAP 118 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXG 850 G GGGGGG G G GG G G Sbjct: 83 GCGGGGGGGGGVGGGGGGGGGGGDDCEDG 111 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGG 818 G GG GG G GGG GGG Sbjct: 83 GCGGGGGGGGGVGGGGGGGGGGG 105 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 2/35 (5%) Frame = +3 Query: 789 VXGPRAVXXXPPPXXXPPPXDXXXPXP--PXPPXP 887 V P PPP PPP P P P PP P Sbjct: 121 VPPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVP 155 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PPP PPP P PP PP P Sbjct: 663 PPPP--PPPPGGGVPGPPKPPPP 683 Score = 28.7 bits (61), Expect = 7.2 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPP 925 PP PP P P PPPP Sbjct: 664 PPPPPPPGGGVPGPPKPPPP 683 >SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) Length = 591 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 880 GGXGGXGXXXSXGGGXXXGGGXXXTARGPXT 788 GG GG G GGG GGG A G T Sbjct: 487 GGFGGGGGASGGGGGGGGGGGFSGGACGDFT 517 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPPXP 937 PP P P P PPP PP P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 28.7 bits (61), Expect = 7.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PPP PPP P PP PP P Sbjct: 1311 PPPPPPPPP---PPPPPPLPPTP 1330 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPP 931 PP PP P P PPPPPP Sbjct: 312 PPPPPEPTSELP----PPPPPP 329 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/38 (31%), Positives = 14/38 (36%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 PP + + P PP P PPPPPP Sbjct: 269 PPIPSASQNATPPPPPPPPSNTPGMFASSGFQPPPPPP 306 >SB_40225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1442 Score = 23.8 bits (49), Expect(2) = 5.8 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +2 Query: 914 PPPPPPXPR 940 PPPPPP P+ Sbjct: 727 PPPPPPPPQ 735 Score = 23.4 bits (48), Expect(2) = 5.8 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 893 SXPXXXXPPPPPP 931 S P PPPPPP Sbjct: 722 SYPTLPPPPPPPP 734 >SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 880 GGXGGXGXXXSXGGGXXXGGGXXXTARG 797 GG GG G GGG GGG A G Sbjct: 468 GGFGGGGGPNGAGGGGGGGGGYSGGASG 495 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 28.7 bits (61), Expect = 7.2 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPP 931 PP PP P P PPPPPP Sbjct: 54 PPPPPPPPPPPP----PPPPPP 71 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGGXXXTARG 797 G GG G G + GGG GGG T G Sbjct: 242 GGGGATGGGGGATGGGGGATGGGGGATGGG 271 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGGXXXTARG 797 G GG G G + GGG GGG T G Sbjct: 249 GGGGATGGGGGATGGGGGATGGGGGATGGG 278 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGGXXXTARG 797 G GG G G + GGG GGG T G Sbjct: 256 GGGGATGGGGGATGGGGGATGGGGGATGGG 285 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGGXXXTARG 797 G GG G G + GGG GGG T G Sbjct: 263 GGGGATGGGGGATGGGGGATGGGGGATGGG 292 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGGXXXTARG 797 G GG G G + GGG GGG T G Sbjct: 270 GGGGATGGGGGATGGGGGATGGGGGATGGG 299 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGGXXXTARG 797 G GG G G + GGG GGG T G Sbjct: 277 GGGGATGGGGGATGGGGGATGGGGGATGGG 306 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGGXXXTARG 797 G GG G G + GGG GGG T G Sbjct: 305 GGGGATGVGGGATGGGGGATGGGVGATGGG 334 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGGXXXTARG 797 G GG G G + GGG GGG T G Sbjct: 319 GGGGATGGGVGATGGGGGATGGGGGVTGGG 348 Score = 28.3 bits (60), Expect = 9.5 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGGXXXTARG 797 G GG G G + GGG GGG T G Sbjct: 284 GGGGATGGGGGATGGGGGATGGGGGATGVG 313 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXG 850 G GGGGGG G G G GG G Sbjct: 764 GYGGGGGGYRGGGGYGGGHRGGGGYGGGG 792 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 28.7 bits (61), Expect = 7.2 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPPXP 937 P P P S P PPPPP P Sbjct: 361 PAPTPAPLSSTPCAPFAPPPPPPP 384 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 798 PRAVXXXPPPXXXPPPXDXXXPXPPXPPXP 887 P V PP PP P PP PP P Sbjct: 783 PGQVGEMGPPGLPGPPGPASPPSPPGPPGP 812 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 798 PRAVXXXPPPXXXPPPXDXXXPXPPXPPXP 887 P V PP PP P PP PP P Sbjct: 868 PGQVGEMGPPGLPGPPGPASPPSPPGPPGP 897 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 28.3 bits (60), Expect = 9.5 Identities = 13/45 (28%), Positives = 14/45 (31%) Frame = +2 Query: 797 SPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 +PG P PP PP P PP PPP Sbjct: 1008 NPGTTTNVPDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPP 1052 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 28.3 bits (60), Expect = 9.5 Identities = 15/50 (30%), Positives = 17/50 (34%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 P +P + PP S P PP PP P P PP P Sbjct: 176 PPKPPAPSTIPTPPTPPAPPSP-PIPTAPPTPPMPETPLPPGSPHIPPAP 224 >SB_21661| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 1202 Score = 28.3 bits (60), Expect = 9.5 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +2 Query: 443 AHSPSQTLVTRTLSPLC 493 AHSP+ TL+T TL+P C Sbjct: 152 AHSPATTLITVTLTPNC 168 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 822 PPXXXPPPXDXXXPXPPXPP 881 PP PPP P PP PP Sbjct: 64 PPTLPPPPPPPPPPLPPPPP 83 >SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXP 878 PPP PPP P PP P Sbjct: 197 PPPSGAPPPPPIGAPPPPPP 216 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +2 Query: 800 PGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPP 922 PG PP P PP PP P P PPP Sbjct: 204 PGMWGPPPMGGPPPMGGPPGGYPPPPPPPGAGDP--AYPPP 242 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 822 PPXXXPPPXDXXXPXPPXPP 881 PP PPP P PP PP Sbjct: 288 PPTLPPPPPPPPPPLPPPPP 307 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 28.3 bits (60), Expect = 9.5 Identities = 11/30 (36%), Positives = 12/30 (40%) Frame = +3 Query: 798 PRAVXXXPPPXXXPPPXDXXXPXPPXPPXP 887 P + PPP PP P P PP P Sbjct: 1050 PPSAVPIPPPRKPSPPPSEPAPPPRQPPPP 1079 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,972,110 Number of Sequences: 59808 Number of extensions: 427130 Number of successful extensions: 4537 Number of sequences better than 10.0: 74 Number of HSP's better than 10.0 without gapping: 1243 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2764 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2752873431 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -