BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_J09 (942 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g36240.1 68414.m04505 60S ribosomal protein L30 (RPL30A) simi... 173 2e-43 At3g18740.1 68416.m02379 60S ribosomal protein L30 (RPL30C) simi... 172 2e-43 At1g77940.1 68414.m09083 60S ribosomal protein L30 (RPL30B) simi... 170 1e-42 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 39 0.004 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 39 0.004 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 39 0.006 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 38 0.013 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 38 0.013 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 37 0.017 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 37 0.022 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 36 0.039 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 36 0.039 At1g61080.1 68414.m06877 proline-rich family protein 35 0.068 At1g10620.1 68414.m01204 protein kinase family protein contains ... 35 0.090 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 34 0.12 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 34 0.12 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 34 0.12 At3g50130.1 68416.m05480 expressed protein ; expression supporte... 31 0.13 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 33 0.21 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 33 0.21 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 33 0.21 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 33 0.21 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 33 0.21 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 33 0.27 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 33 0.27 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 33 0.27 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 33 0.36 At4g33660.1 68417.m04781 expressed protein 33 0.36 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 33 0.36 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 33 0.36 At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family... 33 0.36 At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ... 26 0.39 At3g50140.1 68416.m05481 expressed protein contains Pfam profile... 32 0.48 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 32 0.63 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 32 0.63 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 32 0.63 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 32 0.63 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 32 0.63 At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) ... 32 0.63 At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) ... 32 0.63 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 32 0.63 At1g75550.1 68414.m08780 glycine-rich protein 32 0.63 At1g70990.1 68414.m08190 proline-rich family protein 32 0.63 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 32 0.63 At1g11850.2 68414.m01364 expressed protein 32 0.63 At5g46730.1 68418.m05757 glycine-rich protein 31 0.84 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 31 0.84 At5g11990.1 68418.m01402 proline-rich family protein contains pr... 31 0.84 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 31 0.84 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 31 0.84 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 31 0.84 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 31 0.84 At1g15830.1 68414.m01900 expressed protein 31 0.84 At5g25590.1 68418.m03045 expressed protein contains Pfam profile... 31 1.1 At4g18570.1 68417.m02749 proline-rich family protein common fami... 31 1.1 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 31 1.1 At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar... 31 1.1 At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family... 31 1.5 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 31 1.5 At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp... 31 1.5 At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp... 31 1.5 At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp... 31 1.5 At3g50180.1 68416.m05486 hypothetical protein 31 1.5 At3g26120.1 68416.m03257 RNA-binding protein, putative similar t... 31 1.5 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 31 1.5 At2g26410.1 68415.m03169 calmodulin-binding family protein simil... 31 1.5 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 31 1.5 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 31 1.5 At1g26150.1 68414.m03192 protein kinase family protein similar t... 31 1.5 At5g59270.1 68418.m07427 lectin protein kinase family protein co... 30 1.9 At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family... 30 1.9 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 30 1.9 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 30 1.9 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 30 2.6 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 30 2.6 At2g30560.1 68415.m03722 glycine-rich protein 30 2.6 At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family... 30 2.6 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 30 2.6 At1g02710.1 68414.m00222 glycine-rich protein 30 2.6 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 29 3.4 At4g30460.1 68417.m04325 glycine-rich protein 29 3.4 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 29 3.4 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 29 3.4 At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family... 29 3.4 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 29 3.4 At2g25050.1 68415.m02996 formin homology 2 domain-containing pro... 29 3.4 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 29 3.4 At1g35617.1 68414.m04424 hypothetical protein 29 3.4 At1g23540.1 68414.m02960 protein kinase family protein contains ... 29 3.4 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 29 4.5 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 29 4.5 At4g01985.1 68417.m00265 expressed protein 29 4.5 At3g24550.1 68416.m03083 protein kinase family protein contains ... 29 4.5 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 29 4.5 At3g18810.1 68416.m02389 protein kinase family protein contains ... 29 4.5 At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1... 29 4.5 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 29 4.5 At2g05440.2 68415.m00575 glycine-rich protein 29 4.5 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 29 4.5 At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containi... 29 4.5 At1g35880.1 68414.m04457 hypothetical protein 29 4.5 At1g29380.1 68414.m03592 hypothetical protein 29 4.5 At5g41460.1 68418.m05035 fringe-related protein strong similarit... 24 5.1 At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family... 24 5.2 At5g19750.1 68418.m02348 peroxisomal membrane 22 kDa family prot... 29 5.9 At4g15150.1 68417.m02326 glycine-rich protein 29 5.9 At4g14750.1 68417.m02270 calmodulin-binding family protein conta... 29 5.9 At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacy... 29 5.9 At3g04640.1 68416.m00497 glycine-rich protein predicted proteins... 29 5.9 At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ b... 29 5.9 At1g13020.1 68414.m01510 eukaryotic translation initiation facto... 29 5.9 At2g43800.1 68415.m05445 formin homology 2 domain-containing pro... 24 6.4 At1g72790.1 68414.m08415 hydroxyproline-rich glycoprotein family... 25 6.6 At5g38560.1 68418.m04662 protein kinase family protein contains ... 28 7.8 At3g55950.1 68416.m06217 protein kinase family protein contains ... 28 7.8 At3g51290.1 68416.m05614 proline-rich family protein 28 7.8 At3g08640.1 68416.m01003 alphavirus core protein family contains... 28 7.8 At3g02300.1 68416.m00212 regulator of chromosome condensation (R... 28 7.8 At3g01560.1 68416.m00086 proline-rich family protein contains pr... 28 7.8 At2g43680.2 68415.m05430 calmodulin-binding family protein simil... 28 7.8 At2g43680.1 68415.m05429 calmodulin-binding family protein simil... 28 7.8 At2g43150.1 68415.m05358 proline-rich extensin-like family prote... 28 7.8 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 28 7.8 At1g18170.1 68414.m02258 immunophilin / FKBP-type peptidyl-proly... 28 7.8 At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putativ... 24 8.8 At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putativ... 24 9.0 >At1g36240.1 68414.m04505 60S ribosomal protein L30 (RPL30A) similar to GI:6984132 from [Euphorbia esula] Length = 112 Score = 173 bits (420), Expect = 2e-43 Identities = 79/109 (72%), Positives = 92/109 (84%) Frame = +1 Query: 169 MVAAKKQKKTIESINSRLALVMKSGKYCLGYKQTLKTLRQGKAKLVIIAKNAPPLRKSEI 348 MVAAKK KK+ E INSRLALVMKSGKY LGYK LK+LR K KL++I+ N PPLR+SEI Sbjct: 1 MVAAKKTKKSHEGINSRLALVMKSGKYTLGYKSVLKSLRSSKGKLILISSNCPPLRRSEI 60 Query: 349 EYYALLAKTGVHHYSGNNIELGTACGKYYRVCTLAITDPGDSDIITTLP 495 EYYA+LAK GVHHY+ NN++LGTACGKY+RV L+I DPGDSDII +LP Sbjct: 61 EYYAMLAKVGVHHYNRNNVDLGTACGKYFRVSCLSIVDPGDSDIIKSLP 109 >At3g18740.1 68416.m02379 60S ribosomal protein L30 (RPL30C) similar to 60S RIBOSOMAL PROTEIN L30 GB:O49884 from [Lupinus luteus] Length = 112 Score = 172 bits (419), Expect = 2e-43 Identities = 79/109 (72%), Positives = 91/109 (83%) Frame = +1 Query: 169 MVAAKKQKKTIESINSRLALVMKSGKYCLGYKQTLKTLRQGKAKLVIIAKNAPPLRKSEI 348 MVA KK KK+ E INSRLALVMKSGKY LGYK LK+LR K KL++I+ N PPLR+SEI Sbjct: 1 MVAEKKAKKSHEGINSRLALVMKSGKYTLGYKSVLKSLRSSKGKLILISSNCPPLRRSEI 60 Query: 349 EYYALLAKTGVHHYSGNNIELGTACGKYYRVCTLAITDPGDSDIITTLP 495 EYYA+LAK GVH Y+GNN++LGTACGKY+RV L+I DPGDSDII TLP Sbjct: 61 EYYAMLAKVGVHRYNGNNVDLGTACGKYFRVSCLSIVDPGDSDIIKTLP 109 >At1g77940.1 68414.m09083 60S ribosomal protein L30 (RPL30B) similar to ribosomal protein L30 GI:388034 from [Homo sapiens] Length = 112 Score = 170 bits (414), Expect = 1e-42 Identities = 77/109 (70%), Positives = 91/109 (83%) Frame = +1 Query: 169 MVAAKKQKKTIESINSRLALVMKSGKYCLGYKQTLKTLRQGKAKLVIIAKNAPPLRKSEI 348 MV KK KK+ E INSRLALVMKSGKY LGYK LK+LR K KL++I+ N PPLR+SEI Sbjct: 1 MVTEKKTKKSHEGINSRLALVMKSGKYTLGYKSVLKSLRGSKGKLILISTNCPPLRRSEI 60 Query: 349 EYYALLAKTGVHHYSGNNIELGTACGKYYRVCTLAITDPGDSDIITTLP 495 EYYA+LAK GVHHY+GNN++LGTACGKY+RV L+I DPGDSDII ++P Sbjct: 61 EYYAMLAKVGVHHYNGNNVDLGTACGKYFRVSCLSIVDPGDSDIIKSIP 109 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 PP P PP PP P S P PPPPPP Sbjct: 456 PPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPP 493 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 PP P PP PP P S P PPPPPP Sbjct: 440 PPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPP 477 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 PP P PP PP P S P PPPPPP Sbjct: 471 PPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPP 508 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P P + PP P PP PP P P PPP PP P Sbjct: 439 PPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPP 490 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P P + PP P PP P P P PPPPPP P Sbjct: 454 PPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPP 505 Score = 37.1 bits (82), Expect = 0.017 Identities = 18/52 (34%), Positives = 19/52 (36%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P SP + PP S P PP PP P PPPPP P Sbjct: 476 PPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSP 527 Score = 35.5 bits (78), Expect = 0.051 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = +2 Query: 797 SPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 +P L PP S P PP PP P PPPPPP P Sbjct: 419 TPPTLTSPPPP----SPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPP 461 Score = 35.1 bits (77), Expect = 0.068 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = +2 Query: 800 PGRLAXPPXXXXAASXXPXXXXPPXP--PXPXXSXPXXXXPPPPPPXP 937 P L PP S P PP P P P S P PPPPPP P Sbjct: 404 PPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPP----PPPPPPPP 447 Score = 35.1 bits (77), Expect = 0.068 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 PP + P PP PP P + PPPPPP Sbjct: 505 PPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPP 542 Score = 34.7 bits (76), Expect = 0.090 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 798 PRAVXXXPPPXXXPPPXDXXXPXPPXPPXP 887 P V PPP PPP P PP PP P Sbjct: 432 PPPVYSPPPPPPPPPPVYSPPPPPPPPPPP 461 Score = 34.7 bits (76), Expect = 0.090 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPP 928 P SP PP S P PP PP P PPPPP Sbjct: 445 PPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPP 493 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 771 TXASXXVXGPRAVXXXPPPXXXPPPXDXXXPXPPXPPXP 887 T S P PPP PPP P PP PP P Sbjct: 422 TLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPP 460 Score = 33.1 bits (72), Expect = 0.27 Identities = 18/52 (34%), Positives = 19/52 (36%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P SP + PP P PP PP P S P PPPP P Sbjct: 564 PPPHSSPPPHSPPPPHSPPPPIYPYLSPPP-PPTPVSSPPPTPVYSPPPPPP 614 Score = 32.7 bits (71), Expect = 0.36 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 P P + PP P P PP P S P PPPPPP Sbjct: 415 PIFSTPPTLTSPPPPSPPPPVYSPPPPPP--PPPPVYSPPPPPPPPPPPP 462 Score = 32.7 bits (71), Expect = 0.36 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPP 928 P SP PP P PP PP P PPPPP Sbjct: 460 PPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPP 508 Score = 31.9 bits (69), Expect = 0.63 Identities = 18/57 (31%), Positives = 22/57 (38%), Gaps = 5/57 (8%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXX--AASXXPXXXXPPXPPXPXXSXPXXXXP---PPPPPXP 937 P P + + PP ++ P PP P P S P P PPPPP P Sbjct: 541 PPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTP 597 Score = 31.5 bits (68), Expect = 0.84 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 5/46 (10%) Frame = +2 Query: 809 LAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXX-----PPPPPP 931 L+ PP +S P P PP P P PPPPPP Sbjct: 589 LSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPP 634 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPP 928 P P + PP P PP PP P P PPPPP Sbjct: 470 PPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPP--PPPPVYSPPPPP 516 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +2 Query: 797 SPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 S GR P P PP P + P PPPP P P Sbjct: 387 SCGRSVSPRPPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPP 433 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/50 (28%), Positives = 17/50 (34%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 P P + P + + P P PP P P PPPP P Sbjct: 508 PVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEP 557 Score = 29.5 bits (63), Expect = 3.4 Identities = 17/57 (29%), Positives = 18/57 (31%), Gaps = 3/57 (5%) Frame = +2 Query: 770 HXXFPXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXS---XPXXXXPPPPPP 931 H P P PP + P PP P S P PPPPPP Sbjct: 567 HSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPP 623 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P P R PP A P PP PP S P PPPPPP P Sbjct: 577 PPPPPLPSRSIPPPL---AQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPP 625 Score = 35.1 bits (77), Expect = 0.068 Identities = 19/57 (33%), Positives = 21/57 (36%), Gaps = 5/57 (8%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSX-----PXXXXPPPPPPXP 937 P P R PP ++ P PP PP P S PPPPPP P Sbjct: 590 PLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPP 646 Score = 34.7 bits (76), Expect = 0.090 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 PP + PP PP P P PPPPP P Sbjct: 625 PPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPPP 664 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXP----XXSXPXXXXPPPPPPXP 937 PP S P PP PP P S PPPPPP P Sbjct: 490 PPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPPP 533 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXP---XXXXPPPPPPXP 937 PP S P PP PP P + PPPPPP P Sbjct: 511 PPLFMSTTSFSPSQPPPPPPPPPLFTSTTSFSPSQPPPPPPLP 553 Score = 32.7 bits (71), Expect = 0.36 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P PP PP P S P PPPP P Sbjct: 572 PPPPPPPPPPLPSRSIPPPLAQPPPPRPP 600 Score = 32.3 bits (70), Expect = 0.48 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +2 Query: 800 PGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P PP + PP PP S PPPPPP P Sbjct: 676 PPSTPPPPPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPP 721 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPP--PPPXPR 940 P PP PP P P PPP PP PR Sbjct: 567 PINKTPPPPPPPPPPLPSRSIPPPLAQPPPPR 598 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSX-----PXXXXPPPPPPXPR 940 PP AA P PP PP S P PPPPPP P+ Sbjct: 647 PPTRIPAAKCAPP---PPPPPPTSHSGSIRVGPPSTPPPPPPPPPK 689 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPX--PXXSXPXXXXPPPPPPXP 937 PP + P PP PP S PPPPPP P Sbjct: 471 PPSSGDHVTLLPPPPPPPPPPLFTSTTSFSPSQPPPPPPPPP 512 Score = 29.5 bits (63), Expect = 3.4 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 9/49 (18%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSX---------PXXXXPPPPPPXP 937 PP S P PP PP P S P PPPPPP P Sbjct: 532 PPLFTSTTSFSPSQPPPP-PPLPSFSNRDPLTTLHQPINKTPPPPPPPP 579 Score = 26.6 bits (56), Expect(2) = 2.2 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 6/30 (20%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPP------PPPXP 937 PP PP P S PPP PPP P Sbjct: 714 PPPPPPPPLSKTPAPPPPPLSKTPVPPPPP 743 Score = 21.8 bits (44), Expect(2) = 2.2 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 914 PPPPPPXPR 940 PPPPPP R Sbjct: 764 PPPPPPAGR 772 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 P P L PP AA P P PP P S P PPPPPP Sbjct: 1082 PSPPLPPSSLPPPPP---AALFPPLPPPPSQPPPPPLSPPPSPPPPPPPP 1128 Score = 35.1 bits (77), Expect = 0.068 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P SP + P P PP PP P P PPP PP P Sbjct: 1073 PPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPP 1124 Score = 33.1 bits (72), Expect = 0.27 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 842 SXXPXXXXPPXPPXPXXSXPXXXXPPPPP 928 S P PP PP P P PPPPP Sbjct: 1068 SPPPLPPLPPSPPPPSPPLPPSSLPPPPP 1096 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 37.5 bits (83), Expect = 0.013 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P PP PP P P PPPPPP P Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 37.5 bits (83), Expect = 0.013 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P PP PP P P PPPPPP P Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 37.5 bits (83), Expect = 0.013 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P PP PP P P PPPPPP P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 36.3 bits (80), Expect = 0.029 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 PP P PP PP P P P PPPP P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPP 418 Score = 35.9 bits (79), Expect = 0.039 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 842 SXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 S P PP PP P P PPPPPP Sbjct: 378 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 35.5 bits (78), Expect = 0.051 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 PP P PP PP P PPPPPP P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSP 420 Score = 35.1 bits (77), Expect = 0.068 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 PP P P PP P S P PPPPPP Sbjct: 394 PPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPP 431 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 777 ASXXVXGPRAVXXXPPPXXXPPPXDXXXPXPPXPPXP 887 AS P PPP PPP P PP PP P Sbjct: 370 ASFGCSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +2 Query: 797 SPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 SP PP P PP PP P PPPPP P Sbjct: 375 SPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPP 421 Score = 32.3 bits (70), Expect = 0.48 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 3/55 (5%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPX---PXXSXPXXXXPPPPPPXP 937 P P P S P PP PP P S P PPPP P P Sbjct: 399 PPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQP 453 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 PP P PP PP P P PPPP P P Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPYVYPSPP-PPPPSPPP 422 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 798 PRAVXXXPPPXXXPPPXDXXXPXPPXPPXP 887 P PPP PPP PP PP P Sbjct: 422 PYVYPPPPPPYVYPPPPSPPYVYPPPPPSP 451 Score = 28.3 bits (60), Expect = 7.8 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 6/47 (12%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXP---PXPPXPXXSXPXXXXP---PPPPPXPR 940 PP + P P P PP P P P PPPPP P+ Sbjct: 406 PPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQ 452 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +2 Query: 809 LAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 L PP A P PP P P S PPPPPP P Sbjct: 11 LPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPPPP 53 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPP 931 PP PP P PPPPPP Sbjct: 6 PPYPPLPQPPSQNSLAPPPPPP 27 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 37.1 bits (82), Expect = 0.017 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 PP S P P PP S P PPPPPP P Sbjct: 51 PPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPP 90 Score = 32.7 bits (71), Expect = 0.36 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PPP PPP P PP PP P Sbjct: 50 PPPPSPPPPSCTPSPPPPSPPPP 72 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +3 Query: 798 PRAVXXXPPPXXXPPPXDXXXPXPPXPPXP 887 P + PPP PPP P P PP P Sbjct: 57 PPSCTPSPPPPSPPPPKKSSCPPSPLPPPP 86 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPPXPR 940 PP PP P PPP PP P+ Sbjct: 49 PPPPPSPPPPSCTPSPPPPSPPPPK 73 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 36.7 bits (81), Expect = 0.022 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 P PGR A PP A P PP P P P PPP PP Sbjct: 254 PPLKLPPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPP--PKIARPPPAPP 301 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 3/38 (7%) Frame = +2 Query: 836 AASXXPXXXXPPX---PPXPXXSXPXXXXPPPPPPXPR 940 +A+ P PP PP P + P PPPPPP P+ Sbjct: 249 SAAGLPPLKLPPGRSAPPPPPAAAPPPQPPPPPPPKPQ 286 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 35.9 bits (79), Expect = 0.039 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 797 SPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 SP P S P PP PP P S P PPPPP Sbjct: 510 SPVTKRRSPPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPP 554 Score = 33.1 bits (72), Expect = 0.27 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 798 PRAVXXXPPPXXXPPPXDXXXPXPPXPP 881 P V PPP PPP P PP PP Sbjct: 537 PPPVHSPPPPVHSPPPPPVYSPPPPPPP 564 Score = 32.3 bits (70), Expect = 0.48 Identities = 14/44 (31%), Positives = 16/44 (36%) Frame = +2 Query: 800 PGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 P + PP + P P PP P PPPPPP Sbjct: 520 PAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPP 563 Score = 31.5 bits (68), Expect = 0.84 Identities = 19/57 (33%), Positives = 20/57 (35%), Gaps = 5/57 (8%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPP--XPXXSXPXXXXPPPP---PPXP 937 P P + PP S P PP PP P P PPPP PP P Sbjct: 522 PVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPP 578 Score = 31.5 bits (68), Expect = 0.84 Identities = 19/54 (35%), Positives = 20/54 (37%) Frame = +2 Query: 770 HXXFPXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 H P P + PP S P PP PP P S P PPPPP Sbjct: 566 HSPPPPVFSPPPPVYSPPPPVH--SPPPPVHSPP-PPAPVHSPPPPVHSPPPPP 616 Score = 31.5 bits (68), Expect = 0.84 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +2 Query: 800 PGRLAXPPXXXXAASXXPXXXXPPXP---PXPXXSXPXXXXPPPPPP 931 P + PP + P PP P P P S P PPP PP Sbjct: 599 PAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPP 645 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/49 (32%), Positives = 18/49 (36%), Gaps = 3/49 (6%) Frame = +2 Query: 800 PGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPP---PPXP 937 P + PP + P PP PP P PPPP PP P Sbjct: 537 PPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPP 585 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P P + PP S P PP PP P S P PPP P Sbjct: 584 PPVHSPPPPVHSPPPPAPVHSPPPPVHSPP-PPPPVYSPPPPVFSPPPSQSP 634 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 875 PPXPXXSXPXXXXPPPPPPXP 937 PP P S P PPPPP P Sbjct: 519 PPAPVNSPPPPVYSPPPPPPP 539 Score = 28.3 bits (60), Expect = 7.8 Identities = 14/50 (28%), Positives = 16/50 (32%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 P P + + P S PP P P PPPPPP Sbjct: 490 PVQKPQPPKESPQPDDPYDQSPVTKRRSPPPAPVNSPPPPVYSPPPPPPP 539 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 35.9 bits (79), Expect = 0.039 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 PP S P P PP P P PPPPPP Sbjct: 148 PPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPPPP 185 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/33 (39%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +3 Query: 795 GPRAVXXXPPPXXXPPPXDXXXPXP--PXPPXP 887 G + PPP PPP P P P PP P Sbjct: 138 GTTTIAGQPPPPESPPPESLPPPSPESPSPPSP 170 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 35.1 bits (77), Expect = 0.068 Identities = 14/40 (35%), Positives = 16/40 (40%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 PP + P PP PP + PPPPPP P Sbjct: 425 PPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPPPPP 464 Score = 35.1 bits (77), Expect = 0.068 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 PP A S P PP PP P PPPPPP P Sbjct: 444 PPIADIAISMPPPP--PPPPPPPAVMPLKHFAPPPPPPLP 481 Score = 34.7 bits (76), Expect = 0.090 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +2 Query: 812 AXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 A PP + P P PP P P PPPPP P Sbjct: 473 APPPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPP 514 Score = 34.7 bits (76), Expect = 0.090 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +2 Query: 812 AXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXPR 940 A PP A PP PP P + PPPPPP PR Sbjct: 491 APPPPTPPAFKPLKGSAPPPPPPPPLPTT--IAAPPPPPPPPR 531 Score = 32.7 bits (71), Expect = 0.36 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPX----PPXPXXSXPXXXXPPPPPPXP 937 PP AA P PP PP P PPPPPP P Sbjct: 526 PPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPP 569 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 PP A PP PP P P PPPP P Sbjct: 459 PPPPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTPP 498 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 798 PRAVXXXPPPXXXPPPXDXXXPXPPXPP 881 PRA PPP PPP P PP PP Sbjct: 530 PRAAVAPPPP--PPPPGTAAAPPPPPPP 555 Score = 31.5 bits (68), Expect = 0.84 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P PG A PP P PP P + PPPPPP P Sbjct: 550 PPPPPPPGTQAAPPPPPPPPMQN---RAPSPPPMPMGNSGSGGPPPPPPPMP 598 Score = 30.3 bits (65), Expect = 1.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPP 931 PP PP P PPPPPP Sbjct: 605 PPPPPPPMAMANGAAGPPPPPP 626 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/50 (32%), Positives = 18/50 (36%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 P P +A PP PP PP + P PPPPPP Sbjct: 511 PPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPP----PPPPPP 556 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPP 931 PP PP P PPPPPP Sbjct: 590 PPPPPPPMPLANGATPPPPPPP 611 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPPXP 937 PP PP P + PPPPPP P Sbjct: 523 PPPPPPPPRAA---VAPPPPPPPP 543 Score = 28.7 bits (61), Expect = 5.9 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +3 Query: 798 PRAVXXXPPPXXXPPPXDXXXPXPPXPP 881 P + PPP PPP P PP PP Sbjct: 517 PTTIAAPPPPP--PPPRAAVAPPPPPPP 542 Score = 28.7 bits (61), Expect = 5.9 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +3 Query: 798 PRAVXXXPPPXXXPPPXDXXXPXPPXPP 881 P PPP PP P PP PP Sbjct: 542 PPGTAAAPPPPPPPPGTQAAPPPPPPPP 569 Score = 28.3 bits (60), Expect = 7.8 Identities = 14/43 (32%), Positives = 15/43 (34%), Gaps = 3/43 (6%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXP---PXPXXSXPXXXXPPPPPPXP 937 PP + P PP P P P PPPPP P Sbjct: 513 PPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPP 555 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 34.7 bits (76), Expect = 0.090 Identities = 20/56 (35%), Positives = 22/56 (39%), Gaps = 3/56 (5%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPX---PPXPXXSXPXXXXPPPPPPXPR 940 P SP PP A + P PP PP P S P PPP PP P+ Sbjct: 48 PPSPPSPDTQTSPPP---ATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPSPPQPQ 100 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +2 Query: 851 PXXXXPPXPPXPXX--SXPXXXXPPPPPPXP 937 P PP PP P S P PPPPPP P Sbjct: 709 PPPPAPPAPPTPIVHTSSPPPPPPPPPPPAP 739 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 PP + P PP PP P PPPPPP P Sbjct: 696 PPMQHSTVTKVPPPP-PPAPPAPPTPIVHTSSPPPPPPPP 734 Score = 33.1 bits (72), Expect = 0.27 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPPXP 937 PP PP P PPPPPP P Sbjct: 691 PPPPPPPMQHSTVTKVPPPPPPAP 714 Score = 31.5 bits (68), Expect = 0.84 Identities = 16/45 (35%), Positives = 18/45 (40%) Frame = +2 Query: 797 SPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 SP PP ++ P PP PP P PPPPPP Sbjct: 753 SPPAPPAPPRLPTHSASPPPPTAPPPPPLGQTRAP--SAPPPPPP 795 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +2 Query: 800 PGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P R P P PP PP S PPPPP P Sbjct: 670 PARSPPPISNSDKKPALPRPPPPPPPPPMQHSTVTKVPPPPPPAPP 715 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 836 AASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 A S P PP P P + PPPPPP P Sbjct: 524 AISFSPPTPSPPHPVRPQLAQAGA--PPPPPPLP 555 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 PP S PP P P P PPPP P Sbjct: 693 PPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPP 732 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 34.3 bits (75), Expect = 0.12 Identities = 20/53 (37%), Positives = 21/53 (39%) Frame = -1 Query: 939 RGXGGGGGGXXXXGXXXXGXGGXGGXXXXGXXEAAXXXXGGXARRPGDXXXXG 781 RG GGGGGG G GG GG G + GG RR G G Sbjct: 85 RGSGGGGGGRGGSGGGYRS-GGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGG 136 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P P PP P P PPPPPP P Sbjct: 36 PLFPQSPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 33.5 bits (73), Expect = 0.21 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PPP PPP P PP PP P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPP 64 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXPR 940 PP A + PP PP PPPP P PR Sbjct: 59 PPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPR 99 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 PP P PP PP PPPPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPP 80 Score = 28.7 bits (61), Expect = 5.9 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPPXP 937 PP P P PPPPPP P Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPP 58 Score = 28.3 bits (60), Expect = 7.8 Identities = 12/25 (48%), Positives = 12/25 (48%), Gaps = 2/25 (8%) Frame = +3 Query: 819 PP--PXXXPPPXDXXXPXPPXPPXP 887 PP P PPP P PP PP P Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPP 59 >At3g50130.1 68416.m05480 expressed protein ; expression supported by MPSS Length = 564 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 801 RAVXXXPPPXXXPPPXDXXXPXPPXPP 881 R + PPP PPP P PP PP Sbjct: 3 RILSFTPPPPPPPPPSFRSIPRPPPPP 29 Score = 29.5 bits (63), Expect(2) = 0.13 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPP 928 PP PP P S PPPPP Sbjct: 9 PPPPPPPPPSFRSIPRPPPPP 29 Score = 23.4 bits (48), Expect(2) = 0.13 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 914 PPPPPPXP 937 PPPPPP P Sbjct: 49 PPPPPPLP 56 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +2 Query: 812 AXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXPR 940 A P A P PP PP P PPPPP P+ Sbjct: 367 ASAPPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPK 409 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 PP +S PP P S PPPP P P Sbjct: 356 PPKFLKVSSKKASAPPPPVPAPQMPSSAGPPRPPPPAPPP 395 Score = 28.7 bits (61), Expect = 5.9 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 2/54 (3%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXP--PPPPPXP 937 P S G PP S P PP P P P P P PP P Sbjct: 377 PQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +2 Query: 812 AXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXPR 940 A P A P PP PP P PPPPP P+ Sbjct: 367 ASAPPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPK 409 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 PP +S PP P S PPPP P P Sbjct: 356 PPKFLKVSSKKASAPPPPVPAPQMPSSAGPPRPPPPAPPP 395 Score = 28.7 bits (61), Expect = 5.9 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 2/54 (3%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXP--PPPPPXP 937 P S G PP S P PP P P P P P PP P Sbjct: 377 PQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 33.5 bits (73), Expect = 0.21 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 875 PPXPXXSXPXXXXPPPPPPXPR 940 PP P S P PPPPPP P+ Sbjct: 38 PPPPVYSPPISPPPPPPPPPPQ 59 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 875 PPXPXXSXPXXXXPPPPPPXP 937 PP P P PPPPPP P Sbjct: 37 PPPPPVYSPPISPPPPPPPPP 57 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/41 (29%), Positives = 16/41 (39%) Frame = +2 Query: 806 RLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPP 928 + + PP + P PP PP + PPPPP Sbjct: 34 KYSPPPPPVYSPPISPPPPPPPPPPQSHAAAYKRYSPPPPP 74 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 33.5 bits (73), Expect = 0.21 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 807 VXXXPPPXXXPPPXDXXXPXPPXPPXP 887 V PPP PPP P PP PP P Sbjct: 21 VPLPPPPPPPPPPMRRRAPLPPPPPPP 47 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPPXPR 940 PP PP P PPPPPP R Sbjct: 25 PPPPPPPPPMRRRAPLPPPPPPPMR 49 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPPXPR 940 PP PP P PPPPPP R Sbjct: 26 PPPPPPPPMRRRAPLPPPPPPPMRR 50 Score = 29.5 bits (63), Expect = 3.4 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPPXP 937 PP PP PPPPPP P Sbjct: 55 PPPPPPAMRRRVLPRPPPPPPPLP 78 Score = 29.1 bits (62), Expect = 4.5 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPP 928 P PP PP P PPPPP Sbjct: 22 PLPPPPPPPPPPMRRRAPLPPPPPPP 47 Score = 28.7 bits (61), Expect = 5.9 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPPXP 937 PP PP P PPPPP P Sbjct: 24 PPPPPPPPPPMRRRAPLPPPPPPP 47 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 PP S PP PP S PPPPPP P Sbjct: 425 PPPPSSKMSPSVRAYSPPPPPYSKMSPSVRAYPPPPPPSP 464 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 PP +S P PP S P P PPPP P Sbjct: 495 PPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCP 534 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPP 928 PP S PP PP P P PPPP Sbjct: 442 PPPPYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPPP 478 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXP---XXXXPPPPPPXP 937 PP + P P PP S P PPPPPP P Sbjct: 487 PPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSP 529 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/37 (32%), Positives = 14/37 (37%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPP 928 PP ++ P P PP P P PPPP Sbjct: 505 PPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPPP 541 Score = 29.1 bits (62), Expect = 4.5 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 4/48 (8%) Frame = +2 Query: 800 PGRLAXPPXXXXAASXXPXXXXP----PXPPXPXXSXPXXXXPPPPPP 931 P L PP P P P PP P P PPPP P Sbjct: 615 PSPLYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPPSP 662 Score = 28.3 bits (60), Expect = 7.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPP 931 P P PP P P PPPP P Sbjct: 561 PPVTQSPPPPSPVYYPPVTNSPPPPSP 587 Score = 28.3 bits (60), Expect = 7.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPP 931 P P PP P P PPPP P Sbjct: 576 PPVTNSPPPPSPVYYPPVTYSPPPPSP 602 Score = 28.3 bits (60), Expect = 7.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPP 931 P P PP P P PPPP P Sbjct: 606 PQVTPSPPPPSPLYYPPVTPSPPPPSP 632 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 33.1 bits (72), Expect = 0.27 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P PP P P S P PPP PP P Sbjct: 67 PPPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P P PP P P P PPPP P Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPPSP 92 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P P PP P P PPPP P P Sbjct: 66 PPPPTSPPPPSPPPPSPPPPSPPPPSPPP 94 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PPP PPP P PP P P Sbjct: 66 PPPPTSPPPPSPPPPSPPPPSPP 88 Score = 30.3 bits (65), Expect = 1.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PPP PP P PP PP P Sbjct: 73 PPPSPPPPSPPPPSPPPPSPPPP 95 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 1/24 (4%) Frame = +3 Query: 819 PPPXXXPPP-XDXXXPXPPXPPXP 887 PPP PPP P PP PP P Sbjct: 67 PPPTSPPPPSPPPPSPPPPSPPPP 90 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 33.1 bits (72), Expect = 0.27 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 4/58 (6%) Frame = +2 Query: 770 HXXFPXXXXSPGRLAXPPXXXXAASXXPXXXXPPXP----PXPXXSXPXXXXPPPPPP 931 H P P + PP S P PP P P P S P PPPPP Sbjct: 600 HSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPP 657 Score = 32.7 bits (71), Expect = 0.36 Identities = 18/57 (31%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Frame = +2 Query: 770 HXXFPXXXXSPGRLAXPPXXXXAASXXPXXXXPPX---PPXPXXSXPXXXXPPPPPP 931 H P P + PP + P PP PP P S P PPPPP Sbjct: 564 HSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPP 620 Score = 31.9 bits (69), Expect = 0.63 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +2 Query: 800 PGRLAXPPXXXXAASXXPXXXXPPXPPXPXXS---XPXXXXPPPPPP 931 P + PP S P P PP P S P PPPPPP Sbjct: 495 PPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPP 541 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +2 Query: 806 RLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 R PP P PP P P PPPPPP Sbjct: 491 RSPPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPP 532 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = +2 Query: 800 PGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPP 928 P + PP + P P PP P S P PPPP Sbjct: 513 PPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPP 555 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPP---PPXP 937 PP + P PP PP P PPPP PP P Sbjct: 520 PPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPP 562 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +3 Query: 798 PRAVXXXPPPXXXPPPXDXXXPXPP--XPPXP 887 P V PPP PPP P PP PP P Sbjct: 574 PPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPP 605 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 842 SXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 S P P PP P S P PPPP P Sbjct: 492 SPPPPPVHSPPPPSPIHSPPPPPVYSPPPPPP 523 Score = 29.5 bits (63), Expect = 3.4 Identities = 17/53 (32%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPX---PPXPXXSXPXXXXPPPPPP 931 P SP P + P PP PP P S P PPPPP Sbjct: 539 PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPP 591 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +3 Query: 798 PRAVXXXPPPXXXPPPXDXXXPXPP--XPPXP 887 P V PPP PPP P PP PP P Sbjct: 567 PPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPP 598 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +3 Query: 798 PRAVXXXPPPXXXPPPXDXXXPXPP--XPPXP 887 P V PPP PPP P PP PP P Sbjct: 633 PPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPP 664 Score = 29.1 bits (62), Expect = 4.5 Identities = 17/49 (34%), Positives = 19/49 (38%), Gaps = 3/49 (6%) Frame = +2 Query: 800 PGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPP---PPXP 937 P + PP + P P PP P S P PPPP PP P Sbjct: 504 PSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPP----PPPPVHSPPPP 548 Score = 29.1 bits (62), Expect = 4.5 Identities = 17/57 (29%), Positives = 19/57 (33%), Gaps = 4/57 (7%) Frame = +2 Query: 770 HXXFPXXXXSPGRLAXPPXXXXAASXXPXXXXPP----XPPXPXXSXPXXXXPPPPP 928 H P P + PP + P PP PP P S P PPPP Sbjct: 593 HSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPP 649 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/42 (30%), Positives = 15/42 (35%) Frame = +2 Query: 806 RLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 R + PP + PP PP P PPPPP Sbjct: 490 RRSPPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPP 531 Score = 28.7 bits (61), Expect = 5.9 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 4/47 (8%) Frame = +2 Query: 800 PGRLAXPPXXXXAASXXPXXXXPP----XPPXPXXSXPXXXXPPPPP 928 P + PP S P PP PP P S P PPPP Sbjct: 530 PPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 576 Score = 28.7 bits (61), Expect = 5.9 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 3/33 (9%) Frame = +3 Query: 798 PRAVXXXPPPXXXPPPXDXXXPXP---PXPPXP 887 P V PPP PPP P P P PP P Sbjct: 589 PPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPP 621 Score = 28.7 bits (61), Expect = 5.9 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 3/33 (9%) Frame = +3 Query: 798 PRAVXXXPPPXXXPPPXDXXXPXPP---XPPXP 887 P V PPP PPP P PP PP P Sbjct: 596 PPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPP 628 Score = 28.7 bits (61), Expect = 5.9 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 3/35 (8%) Frame = +2 Query: 842 SXXPXXXXPPXPPXPXXSXPXXXXPPPP---PPXP 937 S P PP PP P PPPP PP P Sbjct: 608 SPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPP 642 Score = 28.3 bits (60), Expect = 7.8 Identities = 14/50 (28%), Positives = 16/50 (32%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 P P + + P S PP PP P PPPPP Sbjct: 465 PVHKPQPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPPPSPIHSPPPPP 514 Score = 28.3 bits (60), Expect = 7.8 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +2 Query: 797 SPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPP 928 SP PP P PP PP P PPPP Sbjct: 505 SPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPP 548 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 33.1 bits (72), Expect = 0.27 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P A P PP PP P S P PP PPP P Sbjct: 52 PEPEPEPADCPPPPPPPPCPPPP--SPPPCPPPPSPPPSP 89 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 PP P PP PP P P PPPP P Sbjct: 47 PPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPP 86 Score = 31.9 bits (69), Expect = 0.63 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPP---PPPXP 937 PP P P PP P S P PPP PPP P Sbjct: 63 PPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAP 105 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 PP S P P PP P P P P PP P Sbjct: 76 PPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTP 115 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPPXPR 940 P PP P P P PPP PP P+ Sbjct: 80 PPPPSPPPSPPPPQLPPPPQLPPPAPPKPQ 109 Score = 30.3 bits (65), Expect = 1.9 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPPXP 937 PP P P PPPPPP P Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPP 69 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +3 Query: 798 PRAVXXXPPPXXXPPPXDXXXPXPPXP-PXP 887 P + PPP PPP P PP P P P Sbjct: 82 PPSPPPSPPPPQLPPPPQLPPPAPPKPQPSP 112 Score = 28.7 bits (61), Expect = 5.9 Identities = 14/43 (32%), Positives = 15/43 (34%), Gaps = 2/43 (4%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPP--PPPPXPR 940 PP P PP P P P PP PPP P+ Sbjct: 65 PPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPK 107 Score = 28.3 bits (60), Expect = 7.8 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = +2 Query: 797 SPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 SP P P PP P P P PPPP P Sbjct: 49 SPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLP 95 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 32.7 bits (71), Expect = 0.36 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P P PP AA P PP P PPPPPP P Sbjct: 336 PYSQNKPKFSQPPPPPNRAAFQAITQEKSPVPPPRRSPPPLQTPPPPPPPPP 387 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 32.7 bits (71), Expect = 0.36 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPPXP 937 P PP P P PPPPPP P Sbjct: 17 PQGPPPPVGVPPQYYPPPPPPPPP 40 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPPXPR 940 PP P P PPPPPP PR Sbjct: 21 PPPVGVPPQYYPPPPPPPPPPPPPR 45 Score = 29.5 bits (63), Expect = 3.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PPP PP P PP PP P Sbjct: 21 PPPVGVPPQYYPPPPPPPPPPPP 43 Score = 29.1 bits (62), Expect = 4.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PPP PP P PP PP P Sbjct: 20 PPPPVGVPPQYYPPPPPPPPPPP 42 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 32.7 bits (71), Expect = 0.36 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPP 928 P P PP P PP PP P P PPPP Sbjct: 93 PYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPP 141 Score = 32.7 bits (71), Expect = 0.36 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPP 928 P P PP P P PP P P PPPPP Sbjct: 101 PTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPP 149 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPP 928 PP P PP PP P PPPPP Sbjct: 89 PPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPP 125 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/52 (28%), Positives = 16/52 (30%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P P PP + P P PP P PPPP P P Sbjct: 109 PYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTP 160 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +3 Query: 798 PRAVXXXPPPXXXPPP--XDXXXPXPPXPPXP 887 P V PPP PPP P PP PP P Sbjct: 140 PPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTP 171 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/49 (28%), Positives = 16/49 (32%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPP 928 P P + P + P P PP P P PPPPP Sbjct: 45 PAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPP 93 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/50 (28%), Positives = 15/50 (30%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 P P + PP P PP P P PPPP P Sbjct: 78 PPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTP 127 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/49 (28%), Positives = 14/49 (28%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPP 928 P P PP P PP PP P PPPP Sbjct: 85 PTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPP 133 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 3/32 (9%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPP---PPPPXP 937 P P PP P P PP PPPP P Sbjct: 147 PPPVVTPPPPTPTPEAPCPPPPPTPYPPPPKP 178 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/44 (29%), Positives = 14/44 (31%) Frame = +2 Query: 800 PGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 P + PP P PP P P PPPP P Sbjct: 92 PPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTP 135 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 32.7 bits (71), Expect = 0.36 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPPXP 937 PP PP P PPPPPP P Sbjct: 682 PPPPPGGGPPPPPGGGPPPPPPPP 705 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPP 881 PPP PPP P PP PP Sbjct: 684 PPPGGGPPPPPGGGPPPPPPP 704 >At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 554 Score = 32.7 bits (71), Expect = 0.36 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPPXPR 940 PP PP P + PPPPPP R Sbjct: 260 PPPPPLPMAAGKGVAAPPPPPPGAR 284 Score = 31.9 bits (69), Expect = 0.63 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +2 Query: 800 PGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 PGR A PP + PP PP P PPPPP P Sbjct: 227 PGRAALPPPPPLPMAVRKGVAAPPLPP------PGTAALPPPPPLP 266 >At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ZF-HD homeobox protein-related predicted proteins, Arabidopsis thaliana Length = 334 Score = 25.8 bits (54), Expect(2) = 0.39 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPPXP 937 PP P P PPPPP P Sbjct: 118 PPPPSTAVEYQPHHRHHPPPPPPP 141 Score = 25.4 bits (53), Expect(2) = 0.39 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 914 PPPPPPXPR 940 PPPPPP PR Sbjct: 137 PPPPPPPPR 145 >At3g50140.1 68416.m05481 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 508 Score = 32.3 bits (70), Expect = 0.48 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPPXP 937 PP PP P PPPPPP P Sbjct: 10 PPPPPPPPRLLVLPPLPPPPPPPP 33 Score = 32.3 bits (70), Expect = 0.48 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPPXPR 940 PP PP P PPPPPP P+ Sbjct: 11 PPPPPPPRLLVLPPLPPPPPPPPPQ 35 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P PP PP P PPPPP P Sbjct: 4 PSKRRPPPPPPPPPRLLVLPPLPPPPPPP 32 Score = 28.7 bits (61), Expect = 5.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PPP PP P PP PP P Sbjct: 10 PPPPPPPPRLLVLPPLPPPPPPP 32 Score = 28.3 bits (60), Expect = 7.8 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PPP PPP P P PP P Sbjct: 9 PPPPPPPPPRLLVLPPLPPPPPP 31 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 31.9 bits (69), Expect = 0.63 Identities = 13/40 (32%), Positives = 16/40 (40%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P ++ P PP PP + P PPPPP P Sbjct: 187 PDGDNALSASLPLPPLPPLPPTTGLTLPHSPFPPPPPGPP 226 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PPP PPP + PP PP P Sbjct: 219 PPPPPGPPPKEQDFVRPPLPPPP 241 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 PP P PP PP P PP PPP Sbjct: 203 PPLPPTTGLTLPHSPFPPPPPGPPPKEQDFVRPPLPPP 240 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXG 850 G GGGGGG G G GG GG G Sbjct: 129 GYGGGGGGYGGSGGYGGGAGGYGGSGGYG 157 Score = 31.9 bits (69), Expect = 0.63 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXGXXEAAXXXXGG 817 G GGG GG G G GG GG G A GG Sbjct: 142 GYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGG 181 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 31.9 bits (69), Expect = 0.63 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 869 PXPPXPXXSXPXXXXPPPPPPXPR 940 P PP P PPPPPP PR Sbjct: 43 PPPPPPPLMRRRAPPPPPPPPLPR 66 Score = 28.3 bits (60), Expect = 7.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 869 PXPPXPXXSXPXXXXPPPPPPXPR 940 P PP P PPPPPP R Sbjct: 16 PPPPPPLMRRRAPLPPPPPPPLMR 39 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXG 850 G GGGGGG G G GG GG G Sbjct: 150 GYGGGGGGYGGGGGYGGGGGGYGGGGRGG 178 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGG 818 G GG GG G GGG GGG Sbjct: 147 GGGGYGGGGGGYGGGGGYGGGGG 169 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/47 (31%), Positives = 17/47 (36%) Frame = +2 Query: 797 SPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 SP + PP + P PP P P P PPP P P Sbjct: 577 SPPIIPSPPFTGPSPPSSPSPPLPPVIPSPPIVGPTPSSPPPSTPTP 623 Score = 28.3 bits (60), Expect = 7.8 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +2 Query: 809 LAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 LA PP P PP P + PPPPP P Sbjct: 699 LASPPPPAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPPPPTP 741 >At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXG 850 G GGGGGG G G GG GG G Sbjct: 574 GGGGGGGGSDYYGGGGYGGGGYGGAPSGG 602 Score = 29.1 bits (62), Expect = 4.5 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 939 RGXGGGGGGXXXXGXXXXGXGGXGGXXXXG 850 RG GGGGGG G G GG GG G Sbjct: 571 RGGGGGGGG---GGSDYYGGGGYGGGGYGG 597 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGGXXXTARG 797 G GG GG G GGG GGG G Sbjct: 572 GGGGGGGGGGSDYYGGGGYGGGGYGGAPSG 601 >At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXG 850 G GGGGGG G G GG GG G Sbjct: 574 GGGGGGGGSDYYGGGGYGGGGYGGAPSGG 602 Score = 29.1 bits (62), Expect = 4.5 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 939 RGXGGGGGGXXXXGXXXXGXGGXGGXXXXG 850 RG GGGGGG G G GG GG G Sbjct: 571 RGGGGGGGG---GGSDYYGGGGYGGGGYGG 597 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGGXXXTARG 797 G GG GG G GGG GGG G Sbjct: 572 GGGGGGGGGGSDYYGGGGYGGGGYGGAPSG 601 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 31.9 bits (69), Expect = 0.63 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPPXP 937 PP P P S P PPPP P P Sbjct: 167 PPVPTDPMPSPPPPVSPPPPTPTP 190 Score = 31.5 bits (68), Expect = 0.84 Identities = 15/44 (34%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +2 Query: 809 LAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXX-PPPPPPXP 937 ++ PP S P PP P P P PPPP P P Sbjct: 81 VSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTP 124 Score = 31.5 bits (68), Expect = 0.84 Identities = 15/44 (34%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +2 Query: 809 LAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXP-PPPPPXP 937 ++ PP + P P PP P S P P PPPP P Sbjct: 97 VSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTP 140 Score = 31.5 bits (68), Expect = 0.84 Identities = 15/44 (34%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +2 Query: 809 LAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXP-PPPPPXP 937 ++ PP + P P PP P S P P PPPP P Sbjct: 115 VSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTP 158 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/43 (30%), Positives = 16/43 (37%) Frame = +2 Query: 809 LAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 ++ PP + P P PP P S P P P P P Sbjct: 133 VSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMP 175 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXP-PPPPPXP 937 P P PP P S P P PPPP P Sbjct: 75 PAPVPPVSPPPPTPSVPSPTPPVSPPPPTP 104 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXG 850 G GGGGGG G G GG GG G Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGGGWGWG 96 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXG 850 G GGGGGG G G GG GG G Sbjct: 80 GGGGGGGGGGGGGWGWGGGGGGGGWYKWG 108 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGG 865 G GGGGGG G G GG GG Sbjct: 77 GGGGGGGGGGGGGGGGWGWGGGGG 100 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGG 865 G GGGGGG G G GG GG Sbjct: 79 GGGGGGGGGGGGGGWGWGGGGGGG 102 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 930 GGGGGGXXXXGXXXXGXGGXGGXXXXG 850 GGGGGG G G GG GG G Sbjct: 71 GGGGGGGGGGGGGGGGGGGGGGWGWGG 97 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXGXXEAAXXXXGGXARRPG 799 G GGGGGG G G GG G G GG + G Sbjct: 72 GGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKGKG 117 Score = 29.5 bits (63), Expect = 3.4 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXGXXEAAXXXXGGXARRPG 799 G GGGGGG G G G GG G + G R G Sbjct: 75 GGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKGKGREG 120 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGG 818 G GG GG G GGG GGG Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGG 90 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGG 818 G GG GG G GGG GGG Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGG 92 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXG 850 G GGGGGG G G GG G G Sbjct: 71 GGGGGGGGGGGGGGGGGGGGGGWGWGGGG 99 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 31.9 bits (69), Expect = 0.63 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPP-PPXP 937 PP PP P P PPPP PP P Sbjct: 93 PPSPPPPSPPPPSQACPPPPLPPSP 117 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 822 PPXXXPPPXDXXXPXPPXPPXP 887 PP PPP P PP PP P Sbjct: 96 PPPPSPPPPSQACPPPPLPPSP 117 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPP 928 P PP PP P + P PP PP Sbjct: 93 PPSPPPPSPPPPSQACPPPPLPPSPP 118 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 31.9 bits (69), Expect = 0.63 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 P SP A PP S P P PP S PPPPPP Sbjct: 459 PSSKMSPSFRATPPPPSSKMS--PSFRATPPPPSSKMSPSVKAYPPPPPP 506 Score = 29.9 bits (64), Expect = 2.6 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXX-SXPXXXXPPPPPP 931 P SP A PP P PP PP P S P P PPPP Sbjct: 516 PSSEMSPSVRAYPPPP-------PLSPPPPSPPPPYIYSSPPPPSPSPPPP 559 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 PP + S PP P P P PPPP P Sbjct: 515 PPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSP 554 Score = 29.5 bits (63), Expect = 3.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PPP PPP P PP P P Sbjct: 535 PPPPSPPPPYIYSSPPPPSPSPP 557 Score = 28.3 bits (60), Expect = 7.8 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 875 PPXPXXSXPXXXXPPPPPP 931 PP P P PPPPPP Sbjct: 662 PPPPVYYSPVTQSPPPPPP 680 >At1g11850.2 68414.m01364 expressed protein Length = 108 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXG 850 G GGGGGG G G GG GG G Sbjct: 75 GLGGGGGGLGGGGGGLLGGGGFGGGAGGG 103 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 31.5 bits (68), Expect = 0.84 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXGXXEAAXXXXG 820 G GGGGGG G G G GG G E G Sbjct: 208 GYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGG 246 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = -1 Query: 930 GGGGGGXXXXGXXXXGXGGXGGXXXXGXXEAAXXXXGGXARRPGDXXXXG 781 GG GGG G G GG GG G GG G+ G Sbjct: 195 GGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYG 244 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXGXXEAAXXXXGG 817 G GGGGGG G G G GG G GG Sbjct: 86 GHGGGGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGG 125 Score = 29.1 bits (62), Expect = 4.5 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXGXXEAAXXXXGG 817 G G GGGG G G G GG G A GG Sbjct: 214 GGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGG 253 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 31.5 bits (68), Expect = 0.84 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPP 931 PP PP P + PPPPPP Sbjct: 206 PPPPPPPQAARSYKRSPPPPPP 227 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 PP + P PP PP P PPPPP Sbjct: 136 PPPVNLSPPPPPVLLSPPPPPVLFSPPPPTVTRPPPPP 173 Score = 28.7 bits (61), Expect = 5.9 Identities = 14/44 (31%), Positives = 16/44 (36%) Frame = +2 Query: 800 PGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 P L+ PP + P P PP S P PPPP Sbjct: 129 PVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSPPPPTVTRPPPP 172 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/43 (30%), Positives = 15/43 (34%) Frame = +2 Query: 800 PGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPP 928 P + PP P P PP P + PPPPP Sbjct: 156 PVLFSPPPPTVTRPPPPPTITRSPPPPRPQAAAYYKKTPPPPP 198 Score = 28.3 bits (60), Expect = 7.8 Identities = 15/43 (34%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = +2 Query: 809 LAXPPXXXXAASXXPXXXXPPXPPXPXXS--XPXXXXPPPPPP 931 L+ PP +S P P PP S P PPPPP Sbjct: 42 LSPPPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPP 84 >At5g11990.1 68418.m01402 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 181 Score = 31.5 bits (68), Expect = 0.84 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 842 SXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 S P P P P S P PPPPPP Sbjct: 43 SPPPSKPSPSMSPPPSPSLPLSSSPPPPPP 72 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 31.5 bits (68), Expect = 0.84 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +2 Query: 797 SPGRLAXPPXXXXAASXXPXXXXPPX---PPXPXXSXPXXXXPPPPPP 931 SP + PP + P PP PP P S P PPPPP Sbjct: 641 SPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPP 688 Score = 31.5 bits (68), Expect = 0.84 Identities = 17/54 (31%), Positives = 19/54 (35%) Frame = +2 Query: 770 HXXFPXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 H P P + PP + P P PP P S P PPPPP Sbjct: 718 HSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPP-PVHSPPPPVHSPPPPP 770 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +3 Query: 798 PRAVXXXPPPXXXPPPXDXXXPXPP--XPPXP 887 P V PPP PPP P PP PP P Sbjct: 671 PPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPP 702 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +3 Query: 798 PRAVXXXPPPXXXPPPXDXXXPXPP--XPPXP 887 P V PPP PPP P PP PP P Sbjct: 753 PPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPP 784 Score = 29.5 bits (63), Expect = 3.4 Identities = 17/56 (30%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +2 Query: 770 HXXFPXXXXSPGRLAXPPXXXXAASXXPXXXXPPX---PPXPXXSXPXXXXPPPPP 928 H P P + PP + P PP PP P S P PPPP Sbjct: 668 HSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 723 Score = 29.5 bits (63), Expect = 3.4 Identities = 17/55 (30%), Positives = 18/55 (32%), Gaps = 3/55 (5%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPP---PPXP 937 P P + PP S P P PP P PPPP PP P Sbjct: 730 PVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPP 784 Score = 29.1 bits (62), Expect = 4.5 Identities = 16/52 (30%), Positives = 18/52 (34%), Gaps = 3/52 (5%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPX---PPXPXXSXPXXXXPPPPP 928 P P + PP + P PP PP P S P PPPP Sbjct: 665 PPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 716 Score = 29.1 bits (62), Expect = 4.5 Identities = 17/59 (28%), Positives = 19/59 (32%), Gaps = 3/59 (5%) Frame = +2 Query: 770 HXXFPXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPP---PPXP 937 H P P + PP + P PP P P PPPP PP P Sbjct: 711 HSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPP 769 Score = 28.7 bits (61), Expect = 5.9 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 3/33 (9%) Frame = +3 Query: 798 PRAVXXXPPPXXXPPPXDXXXPXP---PXPPXP 887 P V PPP PPP P P P PP P Sbjct: 775 PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSP 807 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/32 (40%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +3 Query: 798 PRAVXXXPPPXXXPPPXDXXXPXPP--XPPXP 887 P + PPP PPP P PP PP P Sbjct: 664 PPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPP 695 Score = 28.3 bits (60), Expect = 7.8 Identities = 16/55 (29%), Positives = 18/55 (32%), Gaps = 3/55 (5%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPP---PPXP 937 P P + PP + PP PP P PPPP PP P Sbjct: 723 PVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPP 777 Score = 28.3 bits (60), Expect = 7.8 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = +2 Query: 770 HXXFPXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 H P P + PP S P PP PP P S P PPP P Sbjct: 772 HSPPPPVHSPPPPVHSPPPPVH--SPPPPVHSPP-PPSPIYSPPPPVFSPPPKP 822 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 31.5 bits (68), Expect = 0.84 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPP 931 P PP PP P PPPPPP Sbjct: 42 PHPPPPPPPPPPPLYFSYFSLPPPPPP 68 Score = 29.5 bits (63), Expect = 3.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPP 931 PP PP P PPPPPP Sbjct: 48 PPPPPPPLYFSYFSLPPPPPPP 69 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 31.5 bits (68), Expect = 0.84 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPP 931 P PP PP P PPPPPP Sbjct: 239 PDPTPPPPPPPPIPVKQSATPPPPPPP 265 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 31.5 bits (68), Expect = 0.84 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +2 Query: 812 AXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 A PP A P P PP P P P PPP P Sbjct: 80 APPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKP 121 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPP-PPPXPR 940 P SP PP P PP PP P P P PPP P+ Sbjct: 42 PPPAPSPSPCPSPPPKPQP-KPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPK 94 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 31.5 bits (68), Expect = 0.84 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = -1 Query: 939 RGXGGGGGGXXXXGXXXXGXGGXGG 865 +G GGGGGG G G GG GG Sbjct: 397 QGCGGGGGGGDGGGGQGTGIGGGGG 421 >At5g25590.1 68418.m03045 expressed protein contains Pfam profile PF04783: Protein of unknown function (DUF630) Length = 775 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 869 PXPPXPXXSXPXXXXPPPPPPXPR 940 P P P P PPPPPP P+ Sbjct: 85 PASPQPPPPPPIENLPPPPPPLPK 108 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = +2 Query: 842 SXXPXXXXPPXP----PXPXXSXPXXXXPPPPPPXPR 940 S P PP P P P S PPPPPP P+ Sbjct: 308 SIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPPK 344 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 839 ASXXPXXXXPPXPPXPXXSXPXXXXPPPPP 928 A P PP PP P P PPPPP Sbjct: 301 ADPPPQKSIPPPPPPP--PPPLLQQPPPPP 328 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/52 (28%), Positives = 15/52 (28%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P P PP P PP P P P PPP P P Sbjct: 102 PKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKP 153 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/47 (29%), Positives = 18/47 (38%), Gaps = 4/47 (8%) Frame = +2 Query: 809 LAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPP----PPPXP 937 + PP ++ P PP P P + P P P PPP P Sbjct: 116 IVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTP 162 Score = 28.3 bits (60), Expect = 7.8 Identities = 14/52 (26%), Positives = 15/52 (28%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P P P + P PP P P P PPP P P Sbjct: 119 PPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTP 170 >At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 633 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXG-GXGGXXXXGXXEAAXXXXGG 817 G GGGGGG G G G G GG G A+ GG Sbjct: 586 GYGGGGGGYGGGGGYGGGGGYGGGGGYGGGYGGASSGGYGG 626 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGGXXXTARG 797 G GG GG G GGG GGG + G Sbjct: 593 GYGGGGGYGGGGGYGGGGGYGGGYGGASSG 622 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGG 818 G GG GG G GGG GGG Sbjct: 583 GRGGYGGGGGGYGGGGGYGGGGG 605 >At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 162 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPP 931 P PP P P S P PPPP P Sbjct: 45 PVQSSPPPPSPPPPSTPTTACPPPPSP 71 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P SP + PP P PP P P PPPPP P Sbjct: 44 PPPYRSPVTIPPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYP 95 Score = 28.7 bits (61), Expect = 5.9 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +2 Query: 809 LAXPPXXXXAASXXPXXXXPPX--PPXPXXSXPXXXXPPPPPPXP 937 +A PP + P PP PP P P PPP P P Sbjct: 64 VAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPPTPISP 108 >At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 3/47 (6%) Frame = +2 Query: 800 PGRLAXPPXXXXAASXXPXXXXPPXPPX---PXXSXPXXXXPPPPPP 931 P L PP P P PP P P PPPPPP Sbjct: 75 PQHLPHPPHPQMFGQQQPQAFLPHLPPHHLPPPFPGPYDSAPPPPPP 121 >At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 3/47 (6%) Frame = +2 Query: 800 PGRLAXPPXXXXAASXXPXXXXPPXPPX---PXXSXPXXXXPPPPPP 931 P L PP P P PP P P PPPPPP Sbjct: 75 PQHLPHPPHPQMFGQQQPQAFLPHLPPHHLPPPFPGPYDSAPPPPPP 121 >At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 3/47 (6%) Frame = +2 Query: 800 PGRLAXPPXXXXAASXXPXXXXPPXPPX---PXXSXPXXXXPPPPPP 931 P L PP P P PP P P PPPPPP Sbjct: 75 PQHLPHPPHPQMFGQQQPQAFLPHLPPHHLPPPFPGPYDSAPPPPPP 121 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +2 Query: 803 GRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXPR 940 G + PP PP PP P PPPPPP PR Sbjct: 5 GTIPPPPPLPPRLELRRQRAPPPQPPPPPP-------PPPPPPPPR 43 >At3g26120.1 68416.m03257 RNA-binding protein, putative similar to GB:AAC39463 from [Zea mays], PF00076 RNA recognition motif (2 copies) Length = 615 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 875 PPXPXXSXPXXXXPPPPPPXP 937 PP P P PPPPPP P Sbjct: 66 PPHPMMFSPPPPQPPPPPPRP 86 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 779 FPXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 FP P R PP P PP P P PPPPPP Sbjct: 63 FPPEPPLPPRFELPPPLFPPP---PLPRLPPPLLPPPEEPPREPPPPPPPP 110 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPP--PPPPXP 937 PP P PP P P P PP PPPP P Sbjct: 67 PPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPP 108 Score = 28.7 bits (61), Expect = 5.9 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +3 Query: 798 PRAVXXXPPPXXXPPPXDXXXPXPPXPP 881 P + PPP PP P PP PP Sbjct: 82 PPPLPRLPPPLLPPPEEPPREPPPPPPP 109 Score = 28.7 bits (61), Expect = 5.9 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +3 Query: 822 PPXXXPPPXDXXXPXPPXPPXP 887 PP PPP + PP PP P Sbjct: 89 PPPLLPPPEEPPREPPPPPPPP 110 >At2g26410.1 68415.m03169 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 516 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPPXP 937 PP PP P + PP PPP P Sbjct: 54 PPPPPLPDFAPQPLLPPPSPPPPP 77 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 PP P P PP P PPPPPP Sbjct: 389 PPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPP 426 Score = 28.3 bits (60), Expect = 7.8 Identities = 18/59 (30%), Positives = 19/59 (32%), Gaps = 6/59 (10%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXX--SXPXXXXP----PPPPPXPR 940 P PG A PP PP P S P P PPPPP P+ Sbjct: 344 PPGQYMPGNAALSASTPLTPGQFTTANAPPAPPGPANQTSPPPPPPPSAAAPPPPPPPK 402 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 798 PRAVXXXPPPXXXPPPXDXXXPXPPXPPXP 887 P PPP PP P PP PP P Sbjct: 561 PPVYSSPPPPHVYSPPPPVASPPPPSPPPP 590 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPP 928 PP PP P S P PPPP Sbjct: 535 PPQPPMPSPSPPSPIYSPPPP 555 Score = 29.1 bits (62), Expect = 4.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 797 SPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPP 928 SP P S P PP PP P S P PPPP Sbjct: 586 SPPPPVHSPPPPPVFSPPPPVFSPP-PPSPVYSPPPPSHSPPPP 628 Score = 28.7 bits (61), Expect = 5.9 Identities = 16/51 (31%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXX-PPXPPXPXXSXPXXXXPPPPPP 931 P P + PP + P PP PP P S P PPPP Sbjct: 555 PVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPP 605 Score = 28.7 bits (61), Expect = 5.9 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 798 PRAVXXXPPPXXXPPPXDXXXPXPPXPPXP 887 P V PPP PPP P PP P Sbjct: 569 PPHVYSPPPPVASPPPPSPPPPVHSPPPPP 598 Score = 28.7 bits (61), Expect = 5.9 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 798 PRAVXXXPPPXXXPPPXDXXXPXPPXPPXP 887 P V PPP PPP P P P P Sbjct: 612 PSPVYSPPPPSHSPPPPVYSPPPPTFSPPP 641 Score = 28.3 bits (60), Expect = 7.8 Identities = 15/52 (28%), Positives = 16/52 (30%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P SP P + P PP P P PPP PP P Sbjct: 539 PMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPP 590 Score = 28.3 bits (60), Expect = 7.8 Identities = 17/53 (32%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPP---XPXXSXPXXXXPPPPPP 931 P SP P +S P P PP P S P PPPPP Sbjct: 546 PSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPP 598 Score = 28.3 bits (60), Expect = 7.8 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +2 Query: 800 PGRLAXPPXXXXAASXXPXXXXPPX---PPXPXXSXPXXXXPPPPP 928 P + PP AS P PP PP P S P PPPP Sbjct: 569 PPHVYSPPPP--VASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPP 612 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPP 931 P P P P S P PPPPPP Sbjct: 103 PLPTEAPPPANPVSSPPPESSPPPPPP 129 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 6/46 (13%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPP------XPXXSXPXXXXPPPPPPXP 937 PP +S P PP PP P S PPPPP P Sbjct: 109 PPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESP 154 >At5g59270.1 68418.m07427 lectin protein kinase family protein contains Pfam domains PF00139: Legume lectins beta domain and PF00069: Protein kinase domain Length = 668 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPPXPR 940 PP P P S P PPP PP R Sbjct: 262 PPNRPPPPSSPPPPPPPPPTPPTSR 286 Score = 28.3 bits (60), Expect = 7.8 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +3 Query: 825 PXXXPPPXDXXXPXPPXPPXP 887 P PPP P PP PP P Sbjct: 262 PPNRPPPPSSPPPPPPPPPTP 282 >At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 302 Score = 30.3 bits (65), Expect = 1.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPP 931 PP PP P PPPPPP Sbjct: 99 PPQPPPPPQPLNLFSPPPPPPP 120 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 839 ASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 AS PP P P PPPPPP P Sbjct: 89 ASMRQATRIPPPQPPPPPQPLNLFSPPPPPPPP 121 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 801 RAVXXXPPPXXXPPPXDXXXPXPPXPPXP 887 R PPP PPP PP PP P Sbjct: 92 RQATRIPPPQPPPPPQPLNLFSPPPPPPP 120 Score = 28.7 bits (61), Expect = 5.9 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPPXP 937 P PP P PPPPPP P Sbjct: 100 PQPPPPPQPLNLFSPPPPPPPPDP 123 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/50 (28%), Positives = 18/50 (36%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 P +P ++ PP + P PP P S P PP PP Sbjct: 39 PPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPP 88 Score = 28.7 bits (61), Expect = 5.9 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 1/47 (2%) Frame = +2 Query: 800 PGRLAXPPXXXXA-ASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P A PP S P PP P P S P PPP P Sbjct: 60 PVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPP 106 Score = 28.7 bits (61), Expect = 5.9 Identities = 16/49 (32%), Positives = 17/49 (34%), Gaps = 3/49 (6%) Frame = +2 Query: 800 PGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPP---PPPXP 937 P P AS P P P P + P PPP PPP P Sbjct: 67 PANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAP 115 Score = 28.3 bits (60), Expect = 7.8 Identities = 14/50 (28%), Positives = 17/50 (34%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 P P + PP A+ P PP P + P PPP P Sbjct: 66 PPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAP 115 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/50 (28%), Positives = 18/50 (36%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 P +P ++ PP + P PP P S P PP PP Sbjct: 39 PPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPP 88 Score = 28.7 bits (61), Expect = 5.9 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 1/47 (2%) Frame = +2 Query: 800 PGRLAXPPXXXXA-ASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 P A PP S P PP P P S P PPP P Sbjct: 60 PVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPP 106 Score = 28.7 bits (61), Expect = 5.9 Identities = 16/49 (32%), Positives = 17/49 (34%), Gaps = 3/49 (6%) Frame = +2 Query: 800 PGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPP---PPPXP 937 P P AS P P P P + P PPP PPP P Sbjct: 67 PANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAP 115 Score = 28.3 bits (60), Expect = 7.8 Identities = 14/50 (28%), Positives = 17/50 (34%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 P P + PP A+ P PP P + P PPP P Sbjct: 66 PPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAP 115 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = -1 Query: 939 RGXGGGGGGXXXXGXXXXGXGGXGGXXXXGXXEAAXXXXGG 817 RG GGGGGG G GG G G + GG Sbjct: 85 RGSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGG 125 >At3g20850.1 68416.m02636 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 869 PXPPXPXXSXPXXXXPPPPPP 931 P PP P S P PPPP P Sbjct: 55 PPPPTPVYSPPPADLPPPPTP 75 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXGXXEAAXXXXGGXARRPG 799 G GGGGGG G G GG G G GG PG Sbjct: 13 GKGGGGGG-SGGGRGGGGGGGAKGGCGGGGKSGGGGGGGGYMVAPG 57 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 930 GGGGGGXXXXGXXXXGXGGXGGXXXXG 850 GGGGGG G G GG GG G Sbjct: 107 GGGGGGGKNGGGCGGGGGGKGGKSGGG 133 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGG 818 G GG GG G GGG GGG Sbjct: 24 GRGGGGGGGAKGGCGGGGKSGGG 46 Score = 28.3 bits (60), Expect = 7.8 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -1 Query: 939 RGXGGGGGGXXXXGXXXXGXGGXGG 865 RG GGGGG G GG GG Sbjct: 25 RGGGGGGGAKGGCGGGGKSGGGGGG 49 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/38 (34%), Positives = 15/38 (39%) Frame = -1 Query: 930 GGGGGGXXXXGXXXXGXGGXGGXXXXGXXEAAXXXXGG 817 G GGGG G GG GG G ++ GG Sbjct: 76 GSGGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGG 113 >At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 383 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPP 931 PP PP P P PPPPP Sbjct: 222 PPPPPPPSQPLPRPLLLPPPPP 243 Score = 29.1 bits (62), Expect = 4.5 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPP 928 P PP PP P PPPPP Sbjct: 219 PLQPPPPPPPSQPLPRPLLLPPPPPP 244 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 2/26 (7%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPP--PPXP 937 PP P P S P PPPP PP P Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPPP 84 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/26 (46%), Positives = 13/26 (50%), Gaps = 1/26 (3%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPP-PPPXPR 940 PP PP P P PP PPP P+ Sbjct: 61 PPSPPPPSPPPPACPPPPALPPPPPK 86 Score = 29.5 bits (63), Expect = 3.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPP 925 P PP PP P P PPPP Sbjct: 61 PPSPPPPSPPPPACPPPPALPPPPP 85 Score = 29.1 bits (62), Expect = 4.5 Identities = 15/46 (32%), Positives = 16/46 (34%), Gaps = 2/46 (4%) Frame = +2 Query: 797 SPGRLAXPPXXXXAASXXPXXXXPPXP--PXPXXSXPXXXXPPPPP 928 SP + PP P PP P P P PPPPP Sbjct: 52 SPSCIQNPPPPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPPPP 97 Score = 28.7 bits (61), Expect = 5.9 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPP 931 P PP P P + P PPPPP Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPPPP 85 >At1g02710.1 68414.m00222 glycine-rich protein Length = 96 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGGXXXTARG 797 G GG GG G S GGG GG ++ G Sbjct: 54 GGGGEGGGGQKISKGGGGGGSGGGQRSSSG 83 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 29.5 bits (63), Expect = 3.4 Identities = 18/59 (30%), Positives = 18/59 (30%), Gaps = 3/59 (5%) Frame = +2 Query: 770 HXXFPXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPP---PPXP 937 H P SP PP P P PP P PPPP PP P Sbjct: 30 HISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPPPHVLPPPP 88 Score = 28.3 bits (60), Expect = 7.8 Identities = 14/41 (34%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXP-PXPXXSXPXXXXPPPPPPXP 937 PP + PP P P P P PPPPP P Sbjct: 51 PPHQPPPSPYPHPHPPPPSPYPHPHQPPPPPHVLPPPPPTP 91 >At4g30460.1 68417.m04325 glycine-rich protein Length = 162 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 939 RGXGGGGGGXXXXGXXXXGXGGXGGXXXXGXXEAAXXXXGG 817 RG G GGGG G G G GG G GG Sbjct: 115 RGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGG 155 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/44 (29%), Positives = 15/44 (34%) Frame = +2 Query: 800 PGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 P + PP + P PP P P PPPPP Sbjct: 73 PQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPPPP 116 Score = 29.1 bits (62), Expect = 4.5 Identities = 20/59 (33%), Positives = 22/59 (37%), Gaps = 7/59 (11%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPX-PPXPXX---SXPXXXXPPPP---PPXP 937 P +P PP + S P PP PP P S P PPPP PP P Sbjct: 57 PTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPPP 115 Score = 29.1 bits (62), Expect = 4.5 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPP 928 P PP PP P PPPPP Sbjct: 258 PTISPPPLPPQTLKPPPPQTTPPPPP 283 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 PP P PP PP P PP PP P Sbjct: 53 PPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKP 92 Score = 28.3 bits (60), Expect = 7.8 Identities = 15/49 (30%), Positives = 17/49 (34%), Gaps = 2/49 (4%) Frame = +2 Query: 797 SPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPP--PPXP 937 SP + PP P P PP P + P PP PP P Sbjct: 98 SPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPKP 146 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = +2 Query: 806 RLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 R PP + PP P S PPPPPP P Sbjct: 61 RQLRPPSIPVTTNTGHRHCRPPSNPATTNSGHHQLRPPPPPPPP 104 Score = 23.4 bits (48), Expect(2) = 7.2 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 893 SXPXXXXPPPPPP 931 S P PPPPPP Sbjct: 119 SPPPPPPPPPPPP 131 Score = 23.4 bits (48), Expect(2) = 7.2 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 914 PPPPPPXP 937 PPPPPP P Sbjct: 155 PPPPPPPP 162 >At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At3g25690, At5g61090 [Arabidopsis thaliana] Length = 681 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPP 931 PP PP P P PPPPPP Sbjct: 326 PPPPPSPEHKAP---APPPPPP 344 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPP 931 P A P PP P P PPPPPP Sbjct: 220 PQSAVGANGLPPPPPPPPHQAQPPPPPPSGLFPPPPPP 257 >At2g25050.1 68415.m02996 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 1111 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 PP + P PP P PPPPPP P Sbjct: 605 PPPPPLQSHRSALSSSPLPPPLPPKKLLATTNPPPPPPPP 644 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 29.5 bits (63), Expect = 3.4 Identities = 17/54 (31%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPP--PPPXP 937 P P + PP + P P PP P + P PPP PPP P Sbjct: 49 PALPSLPPAVFSPPPTVSSPPPPPLDSSP--PPPPDLTPPPSSPPPPDAPPPIP 100 Score = 28.3 bits (60), Expect = 7.8 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 5/54 (9%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPX-----PPXPXXSXPXXXXPPPPP 928 P S G A PP P PP PP P PPPPP Sbjct: 19 PPDTSSDGSAAPPPTDSAPPPSPPADSSPPPALPSLPPAVFSPPPTVSSPPPPP 72 >At1g35617.1 68414.m04424 hypothetical protein Length = 121 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 819 PPPXXXPPPXDXXXPXPPXPPXP 887 PPP PPP P PP PP P Sbjct: 21 PPPA--PPPESSSPPTPPEPPDP 41 Score = 29.1 bits (62), Expect = 4.5 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPPXPR 940 PP P P S P PP PP P+ Sbjct: 21 PPPAPPPESSSPPTPPEPPDPPDPQ 45 >At1g23540.1 68414.m02960 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 720 Score = 29.5 bits (63), Expect = 3.4 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = +2 Query: 800 PGRLAXPPXXXXAASXXPXXXX-PPXPPXPXXSXPXXXXPPPPPP 931 P A PP S P PP PP S P P PPP Sbjct: 16 PADTAPPPETPSENSALPPVDSSPPSPPADSSSTPPLSEPSTPPP 60 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 930 GGGGGGXXXXGXXXXGXGGXGG 865 GGGGGG G G GG GG Sbjct: 300 GGGGGGYNRGGYSMGGGGGYGG 321 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGG 818 G GG GG G GGG GGG Sbjct: 130 GGGGYGGGGGGYGGGGGGYGGGG 152 Score = 28.3 bits (60), Expect = 7.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGG 865 G GGGGGG G G G GG Sbjct: 133 GYGGGGGGYGGGGGGYGGGGDGGG 156 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 29.1 bits (62), Expect = 4.5 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXGXXEAAXXXXGGXA 811 G G G GG G G GG GG A GG A Sbjct: 48 GVGAGAGGGASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGA 89 Score = 29.1 bits (62), Expect = 4.5 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXGXXEAAXXXXGGXARRPG 799 G GGGGGG GG GG A GG + G Sbjct: 64 GGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRG 109 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 PP S P P P P S P PP P P P Sbjct: 43 PPPSPSTNSTSPPPSSPLPPSLPPPSPPGSLTPPLPQPSP 82 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 866 PPXPPXPXXSXPXXXXPPPPPP 931 PP PP P P PPPPPP Sbjct: 218 PPKPPSPPRKPP----PPPPPP 235 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 29.1 bits (62), Expect = 4.5 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 3/45 (6%) Frame = +2 Query: 803 GRLAXPPXXXXAASXXPXXXXPPXPP---XPXXSXPXXXXPPPPP 928 GR P A P PP PP P S P PP PP Sbjct: 397 GRSVVKPSPPIVALPPPPPPSPPLPPPVYSPPPSPPVFSPPPSPP 441 Score = 28.7 bits (61), Expect = 5.9 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +2 Query: 797 SPGRLAXPPXXXXAASXXPXXXX-PPXPP--XPXXSXPXXXXPPPP 925 SP +A PP + P PP PP P S P PPPP Sbjct: 404 SPPIVALPPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPP 449 Score = 28.3 bits (60), Expect = 7.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 851 PXXXXPPXPPXPXXSXPXXXXPPPPPP 931 P PP PP P PPP PP Sbjct: 406 PIVALPPPPPPSPPLPPPVYSPPPSPP 432 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 29.1 bits (62), Expect = 4.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 837 PPPXDXXXPXPPXPPXP 887 PPP D P PP PP P Sbjct: 30 PPPSDSSSPSPPAPPPP 46 >At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1 predicted transmembrane domain; Length = 175 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 930 GGGGGGXXXXGXXXXGXGGXGG 865 GGGGGG G G GG GG Sbjct: 154 GGGGGGGGGLGGGGCGGGGCGG 175 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGGXXXTARG 797 G GG G G GGG GGG ++RG Sbjct: 113 GGGGSYGGGGGRREGGGGYSGGGGGYSSRG 142 >At2g05440.2 68415.m00575 glycine-rich protein Length = 154 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 930 GGGGGGXXXXGXXXXGXGGXGG 865 GGGGGG G G GG GG Sbjct: 111 GGGGGGHGGGGHYGGGGGGYGG 132 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGG 818 G GG GG G GGG GGG Sbjct: 113 GGGGHGGGGHYGGGGGGYGGGGG 135 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 29.1 bits (62), Expect = 4.5 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPP-PPPPXP 937 PP A P P P P S P PP PPP P Sbjct: 82 PPAPKVAPVISPATPPPQPPQSPPASAPTVSPPPVSPPPAP 122 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/43 (30%), Positives = 15/43 (34%) Frame = +2 Query: 809 LAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 ++ PP A P PP P P PPP P P Sbjct: 111 VSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSP 153 >At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 839 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 930 GGGGGGXXXXGXXXXGXGGXGG 865 GGGGGG G G GG GG Sbjct: 793 GGGGGGCGGCGGGGCGGGGDGG 814 >At1g35880.1 68414.m04457 hypothetical protein Length = 222 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 930 GGGGGGXXXXGXXXXGXGGXGG 865 GGGGGG G G GG GG Sbjct: 163 GGGGGGNLGGGGGKFGGGGDGG 184 >At1g29380.1 68414.m03592 hypothetical protein Length = 228 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGGXXXXG 850 G GGGGGG G G GG G G Sbjct: 113 GGGGGGGGDTGAGAGGGGYGGGGDTGAGG 141 >At5g41460.1 68418.m05035 fringe-related protein strong similarity to unknown protein (pir||T13026) similarity to predicted proteins + similar to hypothetical protein GB:AAC23643 [Arabidopsis thaliana] + weak similarity to Fringe [Schistocerca gregaria](GI:6573138);Fringe encodes an extracellular protein that regulates Notch signalling. Length = 524 Score = 23.8 bits (49), Expect(2) = 5.1 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +2 Query: 914 PPPPPPXPR 940 PPPPPP P+ Sbjct: 101 PPPPPPPPQ 109 Score = 23.4 bits (48), Expect(2) = 5.1 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 893 SXPXXXXPPPPPP 931 S P PPPPPP Sbjct: 96 SPPPSPPPPPPPP 108 >At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 473 Score = 23.8 bits (49), Expect(2) = 5.2 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +2 Query: 869 PXPPXPXXSXPXXXXPPPPPP 931 P P P PPPPPP Sbjct: 270 PIPNLASEFHPSPPPPPPPPP 290 Score = 23.4 bits (48), Expect(2) = 5.2 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 914 PPPPPPXP 937 PPPPPP P Sbjct: 330 PPPPPPPP 337 >At5g19750.1 68418.m02348 peroxisomal membrane 22 kDa family protein similar to SP|P42925 22 kDa peroxisomal membrane protein {Mus musculus}; contains Pfam profile PF04117: Mpv17 / PMP22 family Length = 288 Score = 28.7 bits (61), Expect = 5.9 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -3 Query: 880 GGXGGXGXXXSXGGGXXXGGGXXXTARG 797 GG GG G GGG GGG +G Sbjct: 82 GGSGGLGGSGGGGGGSGGGGGDGSDGKG 109 >At4g15150.1 68417.m02326 glycine-rich protein Length = 102 Score = 28.7 bits (61), Expect = 5.9 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXG 868 G GGGGGG G G GG G Sbjct: 49 GGGGGGGGATSGGGSNSGVGGRG 71 >At4g14750.1 68417.m02270 calmodulin-binding family protein contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 387 Score = 28.7 bits (61), Expect = 5.9 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 Query: 875 PPXPXXSXPXXXXPPPPPPXP 937 PP P + PPPPPP P Sbjct: 54 PPPPACAITLKDSPPPPPPPP 74 >At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacyanin 3 GI:3395770 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain; identical to cDNA uclacyanin 3 (UCC3)GI:3395769 Length = 222 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/41 (31%), Positives = 15/41 (36%) Frame = +2 Query: 797 SPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPP 919 +P + PP S P PP P P S P PP Sbjct: 134 TPSTPSSPPSTPSTPSSPPSPPSPPSPSLPPSSLPPSASPP 174 >At3g04640.1 68416.m00497 glycine-rich protein predicted proteins, Arabidopsis thaliana Length = 159 Score = 28.7 bits (61), Expect = 5.9 Identities = 16/45 (35%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -1 Query: 930 GGGGGGXXXXGXXXXGXG-GXGGXXXXGXXEAAXXXXGGXARRPG 799 GGGGGG G G G GG G ++ GG + R G Sbjct: 73 GGGGGGRGGGGFGGGGRSFGGGGSSSRGGGGSSSRGGGGSSSRGG 117 >At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ boundaries domain protein 18 (LBD18) identical to LOB DOMAIN 18 [Arabidopsis thaliana] GI:17227164; supported by full-length cDNA gi:17227163 Length = 262 Score = 28.7 bits (61), Expect = 5.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 880 GGXGGXGXXXSXGGGXXXGGG 818 GG GG G S GGG GGG Sbjct: 13 GGGGGCGGGGSSGGGGSSGGG 33 >At1g13020.1 68414.m01510 eukaryotic translation initiation factor, putative (EIF4B5) eukaryotic initiation factor 4B (GI:6739522) {Arabidopsis thaliana}; EST gb|T22808 comes from this gene Length = 549 Score = 28.7 bits (61), Expect = 5.9 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 936 GXGGGGGGXXXXGXXXXGXGGXGG 865 G GGGG G G G GG GG Sbjct: 194 GGGGGGAGSYGGGGAGAGSGGGGG 217 >At2g43800.1 68415.m05445 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 894 Score = 23.8 bits (49), Expect(2) = 6.4 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +2 Query: 914 PPPPPPXPR 940 PPPPPP P+ Sbjct: 410 PPPPPPPPQ 418 Score = 23.0 bits (47), Expect(2) = 6.4 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +2 Query: 884 PXXSXPXXXXPPPPPP 931 P P PPPPPP Sbjct: 401 PKRLCPARPPPPPPPP 416 >At1g72790.1 68414.m08415 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 561 Score = 24.6 bits (51), Expect(2) = 6.6 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 899 PXXXXPPPPPPXP 937 P PPPPPP P Sbjct: 360 PLVYSPPPPPPPP 372 Score = 22.2 bits (45), Expect(2) = 6.6 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 914 PPPPPPXPR 940 PPPPPP R Sbjct: 397 PPPPPPPER 405 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/43 (30%), Positives = 16/43 (37%) Frame = +2 Query: 800 PGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPP 928 P ++ P +S P PP PP P PPPP Sbjct: 49 PPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPP 91 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/47 (27%), Positives = 17/47 (36%) Frame = +2 Query: 797 SPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 SP + PP ++ P P P P + P PPP P Sbjct: 73 SPPVITSPPPTVASSPPPPVVIASPPPSTPATTPPAPPQTVSPPPPP 119 Score = 28.3 bits (60), Expect = 7.8 Identities = 14/50 (28%), Positives = 17/50 (34%) Frame = +3 Query: 738 PXIXXXXQXXXTXASXXVXGPRAVXXXPPPXXXPPPXDXXXPXPPXPPXP 887 P + T A+ P+ V PPP P P PP P P Sbjct: 90 PPVVIASPPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSP 139 Score = 28.3 bits (60), Expect = 7.8 Identities = 12/37 (32%), Positives = 13/37 (35%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPP 928 PP S P P PP P + P P PP Sbjct: 106 PPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPP 142 >At3g55950.1 68416.m06217 protein kinase family protein contains protein kinase domain, Pfam:PF00069; similar to cytokinin-regulated kinase 1 [Nicotiana tabacum] gi|10998537|gb|AAG25966 Length = 814 Score = 28.3 bits (60), Expect = 7.8 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +2 Query: 875 PPXPXXSXPXXXXPPPPPPXP 937 P P P PPPPPP P Sbjct: 361 PASPPSQFPLPPPPPPPPPSP 381 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 28.3 bits (60), Expect = 7.8 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Frame = +2 Query: 782 PXXXXSPGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXP--PPPP 928 P SPG +S P PP PP P S P PPPP Sbjct: 82 PPPPLSPGSETTTWTTTTTSSVLPPPPPPPPPPPPPSSTWDFWDPFIPPPP 132 >At3g08640.1 68416.m01003 alphavirus core protein family contains Pfam profile: PF00944 alphavirus core protein Length = 337 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -1 Query: 930 GGGGGGXXXXGXXXXGXGGXGGXXXXGXXEAA 835 GGGGGG G GG GG EA+ Sbjct: 61 GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEAS 92 >At3g02300.1 68416.m00212 regulator of chromosome condensation (RCC1) family protein weak similarity to UVB-resistance protein UVR8 [Arabidopsis thaliana] GI:5478530; contains Pfam profile PF00415: Regulator of chromosome condensation (RCC1) Length = 471 Score = 28.3 bits (60), Expect = 7.8 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +1 Query: 199 IESINSRLALVMKSGKYCLGYKQTLKTLRQGKAKLVIIAKNAPP 330 I + +++ KS Y GY Q+ +T R + KL+ I K PP Sbjct: 7 IGEVAPSVSIPTKSAIYVWGYNQSGQTGRNEQEKLLRIPKQLPP 50 >At3g01560.1 68416.m00086 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 511 Score = 28.3 bits (60), Expect = 7.8 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +2 Query: 818 PPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPPPXP 937 PP A S P PP P S PPP P P Sbjct: 256 PPSSTAAPSQPPSSQLPPQLPTQFSSQQEPYCPPPSHPQP 295 >At2g43680.2 68415.m05430 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 669 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 1/31 (3%) Frame = +3 Query: 798 PRAVXXXPP-PXXXPPPXDXXXPXPPXPPXP 887 PR PP P PP D P P PP P Sbjct: 268 PRPTTPKPPSPRSDPPRLDAPRPTTPKPPSP 298 >At2g43680.1 68415.m05429 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 668 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 1/31 (3%) Frame = +3 Query: 798 PRAVXXXPP-PXXXPPPXDXXXPXPPXPPXP 887 PR PP P PP D P P PP P Sbjct: 267 PRPTTPKPPSPRSDPPRLDAPRPTTPKPPSP 297 >At2g43150.1 68415.m05358 proline-rich extensin-like family protein similar to CRANTZ hydroxyproline-rich glycoprotein [Manihot esculenta] gi|7211797|gb|AAF40442; similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 212 Score = 28.3 bits (60), Expect = 7.8 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +2 Query: 800 PGRLAXPPXXXXAASXXPXXXXPPXPPXPXXSXPXXXXPPPPP 928 P + PP +S P PP PP S P PPPP Sbjct: 78 PPPVKSPPPPYVYSSPPPPVKSPP-PPYYYHSPPPPVKSPPPP 119 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 28.3 bits (60), Expect = 7.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 886 GXGGXGGXGXXXSXGGGXXXGGG 818 G G GG G S GGG GGG Sbjct: 157 GYSGGGGGGRYGSGGGGGGGGGG 179 >At1g18170.1 68414.m02258 immunophilin / FKBP-type peptidyl-prolyl cis-trans isomerase family protein similar to (Peptidyl-prolyl cis-trans isomerase) (PPiase) (Rotamase) (SP:Q26486) [Spodoptera frugiperda]; contains Pfam profile: PF00254 FKBP-type peptidyl-prolyl cis-trans isomerases Length = 247 Score = 28.3 bits (60), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 875 PPXPXXSXPXXXXPPPPPPXP 937 PP P S P PPPPPP P Sbjct: 34 PPEPESSSPP---PPPPPPQP 51 >At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 432 Score = 23.8 bits (49), Expect(2) = 8.8 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +2 Query: 914 PPPPPPXPR 940 PPPPPP P+ Sbjct: 23 PPPPPPPPQ 31 Score = 22.6 bits (46), Expect(2) = 8.8 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +2 Query: 893 SXPXXXXPPPPPPXP 937 S P PPPPP P Sbjct: 15 SHPVVDNQPPPPPPP 29 >At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 310 Score = 23.8 bits (49), Expect(2) = 9.0 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +2 Query: 914 PPPPPPXPR 940 PPPPPP P+ Sbjct: 23 PPPPPPPPQ 31 Score = 22.6 bits (46), Expect(2) = 9.0 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +2 Query: 893 SXPXXXXPPPPPPXP 937 S P PPPPP P Sbjct: 15 SHPVVDNQPPPPPPP 29 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,169,575 Number of Sequences: 28952 Number of extensions: 332543 Number of successful extensions: 7667 Number of sequences better than 10.0: 126 Number of HSP's better than 10.0 without gapping: 1345 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4500 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2256303936 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -