BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_J07 (904 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 27 0.15 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 22 5.7 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 27.5 bits (58), Expect = 0.15 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 677 PXGPPXAPHPXXXPAXGXXXPXXPPP 754 P GPP APHP G P P Sbjct: 72 PHGPPYAPHPSLSSGLGGGLSGMPMP 97 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 22.2 bits (45), Expect = 5.7 Identities = 11/33 (33%), Positives = 11/33 (33%) Frame = +1 Query: 607 PPXGRXXXXPPXXGGXPPGXTLXPXGPPXGPXP 705 P G PP G PP P G P P Sbjct: 52 PSVGLRQGIPPHHYGGPPSGGQPPQGMPYPRFP 84 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,742 Number of Sequences: 336 Number of extensions: 2498 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 25134219 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -