BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_J06 (983 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 29 0.042 AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 24 1.6 AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia or... 24 1.6 AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia or... 24 1.6 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 29.5 bits (63), Expect = 0.042 Identities = 17/76 (22%), Positives = 33/76 (43%), Gaps = 2/76 (2%) Frame = -1 Query: 434 WNKLTLPATPSCSPKPGMRVPVRLSPCPFT--LSRASPAEAALSLWRSLKSADPMALSTF 261 W LP+ + SP+P +PV P P L + + + ++ ++ PM ++T Sbjct: 67 WQVTPLPSDGTTSPEPDPEIPVAPEPAPLASPLVQEPGSSTTSATSGAVMASPPMPITTD 126 Query: 260 LSLPVRGTFRAAPEVP 213 + G R+ + P Sbjct: 127 NVAAISGVLRSLLDRP 142 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 24.2 bits (50), Expect = 1.6 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +1 Query: 433 HNNNHDLSAKAFAIRNSPSAIPNAPNFNTLGGG 531 H+ D+S+ N+PSA N NFN G Sbjct: 115 HDEIPDISSTRGNNNNTPSATNNNTNFNNNSNG 147 >AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia ortholog protein. Length = 471 Score = 24.2 bits (50), Expect = 1.6 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +1 Query: 433 HNNNHDLSAKAFAIRNSPSAIPNAPNFNTLGGG 531 H+ D+S+ N+PSA N NFN G Sbjct: 63 HDEIPDISSTRGNNNNTPSATNNNTNFNNNSNG 95 >AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia ortholog protein. Length = 477 Score = 24.2 bits (50), Expect = 1.6 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +1 Query: 433 HNNNHDLSAKAFAIRNSPSAIPNAPNFNTLGGG 531 H+ D+S+ N+PSA N NFN G Sbjct: 246 HDEIPDISSTRGNNNNTPSATNNNTNFNNNSNG 278 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,748 Number of Sequences: 336 Number of extensions: 2988 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 27926910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -