BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_J04 (942 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g10520.1 68414.m01184 DNA polymerase lambda (POLL) identical ... 31 1.5 At1g67220.1 68414.m07651 zinc finger protein-related similar to ... 29 3.4 At5g48385.1 68418.m05980 expressed protein 29 5.9 >At1g10520.1 68414.m01184 DNA polymerase lambda (POLL) identical to DNA polymerase lambda GI:12053869 from [Arabidopsis thaliana] Length = 529 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/73 (23%), Positives = 39/73 (53%), Gaps = 1/73 (1%) Frame = +1 Query: 226 LWLYQG-DNVPRAPSTADHPILPSKIDDVQLDPNRRYVRSVTNPENNEASIEHSHHTVDI 402 L LYQ ++ + A+ + KID ++D ++ + +++ E+ + + + ++ D Sbjct: 86 LMLYQWLEDSLTSGEKANEDLYVLKIDSEEVDKPKKSLPAISGSEDQSSPQKRTRYSPDA 145 Query: 403 GLDQPIESHRNTR 441 G + +ESH NT+ Sbjct: 146 GDFKGVESHSNTQ 158 >At1g67220.1 68414.m07651 zinc finger protein-related similar to SP|Q09472 E1A-associated protein p300 {Homo sapiens}, SP|Q92793 CREB-binding protein {Homo sapiens}; contains Pfam profiles PF00569: Zinc finger ZZ type, PF00628: PHD-finger, PF02135: TAZ zinc finger Length = 1357 Score = 29.5 bits (63), Expect = 3.4 Identities = 19/70 (27%), Positives = 31/70 (44%), Gaps = 2/70 (2%) Frame = +2 Query: 314 SIQTEGMFAVSPIQKITRRPLNIHIIQLILDLTSRSRATVTQGTCGFCTLEGNCLF--QR 487 S+Q AVS +++ T + +H I+ L S + +G C E +C Sbjct: 596 SLQKRSKRAVSLVERFTEEEIKLH----IMSLKKPSTQSAVEGMCDLKEEEESCQLCDDG 651 Query: 488 FLRFNPKPIY 517 L F P+P+Y Sbjct: 652 TLLFPPQPLY 661 >At5g48385.1 68418.m05980 expressed protein Length = 558 Score = 28.7 bits (61), Expect = 5.9 Identities = 19/68 (27%), Positives = 29/68 (42%), Gaps = 1/68 (1%) Frame = -3 Query: 466 LEGTKTAGPLCYGGSRSAGQVQYQLYDVNVQWTPRYFLDW*HCE-HTFGLDRAARRRFSK 290 +E T++ L S Q+Q ++ Q L W E H GL+R+ +RRF + Sbjct: 1 MEDTRSVASLMDSTSSKIQQLQKAFAELESQRAVTLNLKWKELEEHFHGLERSLKRRFHE 60 Query: 289 EESDGLRY 266 E Y Sbjct: 61 LEDQEKEY 68 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,196,009 Number of Sequences: 28952 Number of extensions: 342080 Number of successful extensions: 1108 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 868 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1052 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2256303936 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -