BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_I21 (914 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0300 + 2350232-2352274,2352349-2352669,2352752-2352838,235... 31 1.3 02_03_0224 - 16577234-16577494,16577798-16577996,16578069-165781... 29 6.8 12_01_0378 - 2946916-2947590 28 9.0 10_07_0045 + 12328388-12328419,12328504-12328645,12328862-123290... 28 9.0 09_04_0745 + 19884868-19886000,19886110-19886309,19886422-198866... 28 9.0 >03_01_0300 + 2350232-2352274,2352349-2352669,2352752-2352838, 2353031-2353708,2353800-2353964,2354139-2354433, 2354581-2354795,2354885-2355190,2355269-2355332, 2355426-2355665,2355783-2355886 Length = 1505 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/58 (24%), Positives = 29/58 (50%) Frame = +2 Query: 41 DLSSXLGNTQDSTLQR*SPL*LFYVFSWHLCMLQIPTSLTTFWRSSFTIASSSPITTV 214 D++ LG +T+Q + + +W + +L +P ++ W + IASS +T + Sbjct: 1054 DIAFRLGGFASTTIQLLGIVAVMSKVTWQVLILIVPMAVACMWMQRYYIASSRELTRI 1111 >02_03_0224 - 16577234-16577494,16577798-16577996,16578069-16578139, 16578442-16578517,16578632-16578762,16578853-16578978, 16579075-16579248,16579414-16579484,16579752-16579923, 16581780-16581892,16582705-16582779,16582913-16583009, 16583448-16583534,16583535-16583589,16583650-16583828 Length = 628 Score = 28.7 bits (61), Expect = 6.8 Identities = 15/58 (25%), Positives = 31/58 (53%) Frame = +1 Query: 226 SKHLYEEKKSEVITNVVNXLIRNNKMNCMEYAYXLWLQGSKXHRPGLFPS*VQTYLRR 399 S+ + + K E+I+ +++ + ++NC E +W+Q S H L +QT L++ Sbjct: 447 SRSITQMSKQELISGLLHYI---QQINCAEAMEKIWVQSSMPHFISLSLKQLQTILKK 501 >12_01_0378 - 2946916-2947590 Length = 224 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/47 (29%), Positives = 27/47 (57%) Frame = +1 Query: 70 GLDAPKMKPAIVILCLFVASLYAADSDVPNDILEEQLYNSVVVADYD 210 G+ ++P +++L ASL AA++ VP + ++ +VV D+D Sbjct: 87 GVHYDAIRPRLLLLLAGGASLGAANATVPGVFHQPRMSTTVVAIDFD 133 >10_07_0045 + 12328388-12328419,12328504-12328645,12328862-12329054, 12329224-12329320,12329404-12329528,12329616-12329734, 12331225-12331298,12331359-12331413,12331450-12331500, 12331611-12331857,12331940-12332036,12332170-12332244, 12334286-12334488,12334757-12334905,12334995-12335168, 12335276-12335401,12335493-12335623,12335743-12335818, 12335898-12336027,12336115-12336193,12336267-12336465, 12336591-12336698,12336769-12337025,12337267-12337282 Length = 984 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/50 (28%), Positives = 28/50 (56%) Frame = +1 Query: 250 KSEVITNVVNXLIRNNKMNCMEYAYXLWLQGSKXHRPGLFPS*VQTYLRR 399 K E+I+ +++ + ++NC E +W+Q S+ H L +QT L++ Sbjct: 771 KQELISGLLHYI---QQINCAEAMEKIWVQSSRPHYISLSLKQLQTILKK 817 >09_04_0745 + 19884868-19886000,19886110-19886309,19886422-19886666, 19886880-19887668 Length = 788 Score = 28.3 bits (60), Expect = 9.0 Identities = 18/50 (36%), Positives = 22/50 (44%) Frame = +2 Query: 644 SPRPQFHRPXVPXPCXRTPXPLXPXXXRPHTRXSPRCXXLXAPGPPXXPR 793 +P PQ RP P P P P+ P T+ +P AP PP PR Sbjct: 256 APPPQSVRPPPPPPPPPPPPPMPPRTDNASTQAAP------AP-PPPLPR 298 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,320,644 Number of Sequences: 37544 Number of extensions: 318001 Number of successful extensions: 976 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 875 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 969 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2600672280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -