BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_I20 (957 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 50 2e-06 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 44 2e-04 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 40 0.004 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 38 0.012 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.016 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 38 0.016 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 36 0.049 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 36 0.049 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.085 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 35 0.085 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 35 0.085 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) 35 0.11 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 34 0.15 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 34 0.20 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 34 0.20 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 33 0.26 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 33 0.26 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 33 0.26 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.45 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 32 0.60 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 32 0.60 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 32 0.79 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.79 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 32 0.79 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 31 1.0 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 31 1.0 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 31 1.0 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 31 1.0 SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) 31 1.0 SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 31 1.4 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 31 1.4 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 31 1.4 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 31 1.8 SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) 31 1.8 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 31 1.8 SB_22536| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 31 1.8 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 31 1.8 SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) 31 1.8 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) 30 2.4 SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) 30 2.4 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_52684| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 30 3.2 SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) 30 3.2 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 30 3.2 SB_5429| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) 29 4.2 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 29 4.2 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 29 4.2 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 29 4.2 SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_36422| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 29 5.6 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 29 5.6 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 29 5.6 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) 29 7.4 SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_48061| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 29 7.4 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 29 7.4 SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 28 9.7 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 28 9.7 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 SB_59124| Best HMM Match : Bac_luciferase (HMM E-Value=1.6) 28 9.7 SB_50215| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) 28 9.7 SB_10368| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 28 9.7 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 51.2 bits (117), Expect = 1e-06 Identities = 26/79 (32%), Positives = 30/79 (37%), Gaps = 2/79 (2%) Frame = +3 Query: 636 SXXPPXPXXPXPPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXP--SAHPPPXLXPX 809 S PP P P PP PP PP +PP P P + +PP P Sbjct: 89 SPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPY 148 Query: 810 XXPTXPPFLPXLPXPXPRP 866 P PP+ P L P P P Sbjct: 149 PPPPNPPYPPPLYPPPPNP 167 Score = 43.6 bits (98), Expect = 2e-04 Identities = 30/106 (28%), Positives = 34/106 (32%), Gaps = 4/106 (3%) Frame = +3 Query: 645 PPXPXXPXPPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXPSA-HPPPXLXPXXXPT 821 PP P P PP P PP +PP P P +PPP P P Sbjct: 133 PPPPNAPYPPSPNAP-YPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPP 191 Query: 822 XPPF--LPXLP-XPXPRPXLXXXXXXXXXXXXXXXHRPXLPXXPPP 950 PP+ P P P P P + P P PPP Sbjct: 192 NPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPP 237 Score = 36.7 bits (81), Expect = 0.028 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 623 PXXFXXXPPPPXPPXPPXPPXXPXRPP 703 P F PP P PP PP PP P PP Sbjct: 85 PTNFSPNPPYPPPPYPPYPPPPPYPPP 111 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 623 PXXFXXXPPPPXPPXPPXPPXXPXRPP 703 P + PPPP P PP PP P PP Sbjct: 96 PPPYPPYPPPPPYPPPPNPPYPP--PP 120 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP PP P PP Sbjct: 149 PPPPNPPYPPPLYPPPPNPP 168 Score = 29.9 bits (64), Expect = 3.2 Identities = 18/65 (27%), Positives = 19/65 (29%), Gaps = 4/65 (6%) Frame = +2 Query: 623 PXXFXXXPPPPXPPXP----PXPPXXPXRPPXFXXXXXXXXXXXXXXXQIXLAXTFGPPP 790 P + P PP PP P P PP P PP PPP Sbjct: 105 PPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPP 164 Query: 791 PXSXP 805 P P Sbjct: 165 PNPPP 169 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP P P P PP Sbjct: 162 PPPPNPPPPNAPYPPPPYPP 181 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 4/31 (12%) Frame = +2 Query: 623 PXXFXXXPPPPXPPXP----PXPPXXPXRPP 703 P + P PP PP P P PP P PP Sbjct: 176 PPPYPPPPNPPYPPPPNPPYPPPPNAPNPPP 206 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPPXF 709 PP P PP P PP P P F Sbjct: 220 PPYPPPPNAPNPPYPPPPNPQF 241 Score = 28.3 bits (60), Expect = 9.7 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +3 Query: 648 PXPXXPXPPXXXXPPXAPPXSP 713 P P P PP PP PP +P Sbjct: 218 PNPPYPPPPNAPNPPYPPPPNP 239 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 50.4 bits (115), Expect = 2e-06 Identities = 28/77 (36%), Positives = 29/77 (37%) Frame = +3 Query: 636 SXXPPXPXXPXPPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXPSAHPPPXLXPXXX 815 S PP P P PP PP PP SPP + P P PPP P Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPP----------PPPQPPPPPPPPPPPPPPPPPPP 413 Query: 816 PTXPPFLPXLPXPXPRP 866 P PP P P P P P Sbjct: 414 PPPPPAPPPPPPPPPPP 430 Score = 46.8 bits (106), Expect = 3e-05 Identities = 25/70 (35%), Positives = 26/70 (37%) Frame = +3 Query: 663 PXPPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXPSAHPPPXLXPXXXPTXPPFLPX 842 P PP PP +PP PP S P P PPP P P PP P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP-PPP 424 Query: 843 LPXPXPRPXL 872 P P P P L Sbjct: 425 PPPPPPPPAL 434 Score = 44.8 bits (101), Expect = 1e-04 Identities = 25/80 (31%), Positives = 25/80 (31%) Frame = +3 Query: 633 SSXXPPXPXXPXPPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXPSAHPPPXLXPXX 812 S PP P P P PP PP PP P P PPP P Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Query: 813 XPTXPPFLPXLPXPXPRPXL 872 P PP P L P L Sbjct: 424 PPPPPPPPPALRLACAPPRL 443 Score = 37.9 bits (84), Expect = 0.012 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP PP PP P PP Sbjct: 402 PPPPPPPPPPPPPPPPPAPP 421 Score = 37.5 bits (83), Expect = 0.016 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP PP PP P PP Sbjct: 367 PPPPPPPPPPSPPPPPPPPP 386 Score = 37.5 bits (83), Expect = 0.016 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP PP PP P PP Sbjct: 378 PPPPPPPPPPSPPPPPQPPP 397 Score = 37.5 bits (83), Expect = 0.016 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP PP PP P PP Sbjct: 381 PPPPPPPSPPPPPQPPPPPP 400 Score = 37.5 bits (83), Expect = 0.016 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP PP PP P PP Sbjct: 384 PPPPSPPPPPQPPPPPPPPP 403 Score = 37.5 bits (83), Expect = 0.016 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP PP PP P PP Sbjct: 390 PPPPQPPPPPPPPPPPPPPP 409 Score = 37.5 bits (83), Expect = 0.016 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP PP PP P PP Sbjct: 395 PPPPPPPPPPPPPPPPPPPP 414 Score = 37.5 bits (83), Expect = 0.016 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP PP PP P PP Sbjct: 396 PPPPPPPPPPPPPPPPPPPP 415 Score = 37.5 bits (83), Expect = 0.016 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP PP PP P PP Sbjct: 397 PPPPPPPPPPPPPPPPPPPP 416 Score = 37.5 bits (83), Expect = 0.016 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP PP PP P PP Sbjct: 398 PPPPPPPPPPPPPPPPPPPP 417 Score = 37.5 bits (83), Expect = 0.016 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP PP PP P PP Sbjct: 399 PPPPPPPPPPPPPPPPPPPP 418 Score = 37.5 bits (83), Expect = 0.016 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP PP PP P PP Sbjct: 403 PPPPPPPPPPPPPPPPAPPP 422 Score = 37.5 bits (83), Expect = 0.016 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP PP PP P PP Sbjct: 405 PPPPPPPPPPPPPPAPPPPP 424 Score = 37.5 bits (83), Expect = 0.016 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP PP PP P PP Sbjct: 406 PPPPPPPPPPPPPAPPPPPP 425 Score = 37.5 bits (83), Expect = 0.016 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP PP PP P PP Sbjct: 409 PPPPPPPPPPAPPPPPPPPP 428 Score = 37.5 bits (83), Expect = 0.016 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP PP PP P PP Sbjct: 412 PPPPPPPAPPPPPPPPPPPP 431 Score = 35.5 bits (78), Expect = 0.064 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +2 Query: 611 LTXIPXXFXXXPPPPXPPXPPXPPXXPXRPP 703 +T I PPPP PP PP P P PP Sbjct: 354 VTDISAGINMSPPPPPPPPPPPPSPPPPPPP 384 Score = 34.3 bits (75), Expect = 0.15 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP P PP PP P PP Sbjct: 413 PPPPPPAPPPPPPPPPPPPP 432 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/74 (36%), Positives = 31/74 (41%) Frame = -3 Query: 865 GRGXGXGRXGRKGGXVGXXXGXRXGGGWAEGXGXXDLXXXXXXGSEXXXXGGEXGGAXGG 686 G G G G G GG G G GGG+ +G G D ++ GG GG GG Sbjct: 804 GGGYGDGDGGGGGGG-GGGGGGGDGGGYGDGGGFGD----GGGYADGDGGGGGGGGGGGG 858 Query: 685 XXXXGGXGXXGXGG 644 GG G G GG Sbjct: 859 GGGGGGGGGGGGGG 872 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -3 Query: 715 GGEXGGAXGGXXXXGGXGXXGXGG 644 GG+ GG GG GG G G GG Sbjct: 782 GGDGGGGGGGGGGGGGGGGGGDGG 805 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 39.5 bits (88), Expect = 0.004 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPPXF 709 PPPP PP PP PP P PP F Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPF 488 Score = 37.5 bits (83), Expect = 0.016 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP PP PP P PP Sbjct: 464 PPPPPPPPPPPPPPPPPPPP 483 Score = 37.5 bits (83), Expect = 0.016 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP PP PP P PP Sbjct: 465 PPPPPPPPPPPPPPPPPPPP 484 Score = 37.5 bits (83), Expect = 0.016 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP PP PP P PP Sbjct: 466 PPPPPPPPPPPPPPPPPPPP 485 Score = 37.5 bits (83), Expect = 0.016 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP PP PP P PP Sbjct: 472 PPPPPPPPPPPPPPPPFPPP 491 Score = 37.5 bits (83), Expect = 0.016 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP PP PP P PP Sbjct: 474 PPPPPPPPPPPPPPFPPPPP 493 Score = 37.5 bits (83), Expect = 0.016 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP PP PP P PP Sbjct: 475 PPPPPPPPPPPPPFPPPPPP 494 Score = 37.1 bits (82), Expect = 0.021 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP PP PP P PP Sbjct: 471 PPPPPPPPPPPPPPPPPFPP 490 Score = 35.1 bits (77), Expect = 0.085 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRP 700 PPPP PP PP PP P P Sbjct: 478 PPPPPPPPPPFPPPPPPTP 496 Score = 33.1 bits (72), Expect = 0.34 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 645 PPXPXXPXPPXXXXPPXAPPXSPP 716 PP P P PP PP PP PP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPFPPP 491 Score = 31.9 bits (69), Expect = 0.79 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 768 PXPSAHPPPXLXPXXXPTXPPFLPXLPXPXPRP 866 P P PPP P P PP P P P P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 29.5 bits (63), Expect = 4.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 883 PPXXPTPPPQXXTGXPFXPXXPP 951 PP P PPP PF P PP Sbjct: 472 PPPPPPPPPPPPPPPPFPPPPPP 494 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 780 AHPPPXLXPXXXPTXPPFLPXLPXPXPRP 866 A PPP P P PP P P P P P Sbjct: 463 APPPPPPPPPPPPPPPPPPPPPPPPFPPP 491 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 37.9 bits (84), Expect = 0.012 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP PP PP P PP Sbjct: 688 PPPPPPPPPPPPPPQPSTPP 707 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 620 IPXXFXXXPPPPXPPXPPXPPXXPXRPP 703 IP PPPP PP PP PP P P Sbjct: 676 IPIQTMVPPPPPPPPPPPPPPPPPPPQP 703 Score = 35.5 bits (78), Expect = 0.064 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 620 IPXXFXXXPPPPXPPXPPXPPXXPXRPP 703 +P PPP PP PP PP P PP Sbjct: 674 LPIPIQTMVPPPPPPPPPPPPPPPPPPP 701 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +2 Query: 614 TXIPXXFXXXPPPPXPPXPPXP-PXXPXRPP 703 T +P PPPP PP PP P P P PP Sbjct: 680 TMVPPPPPPPPPPPPPPPPPPPQPSTPPPPP 710 Score = 34.3 bits (75), Expect = 0.15 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP PP P P PP Sbjct: 692 PPPPPPPPPPQPSTPPPPPP 711 Score = 33.1 bits (72), Expect = 0.34 Identities = 19/65 (29%), Positives = 20/65 (30%) Frame = +3 Query: 645 PPXPXXPXPPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXPSAHPPPXLXPXXXPTX 824 PP P P PP PP P +PP S P S P P Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSPSGTSAGNPQQQPPP 743 Query: 825 PPFLP 839 P LP Sbjct: 744 PGQLP 748 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 883 PPXXPTPPPQXXTGXPFXPXXPP 951 PP P PPPQ T P P PP Sbjct: 693 PPPPPPPPPQPSTPPPPPPSTPP 715 Score = 28.3 bits (60), Expect = 9.7 Identities = 18/72 (25%), Positives = 20/72 (27%) Frame = -3 Query: 859 GXGXGRXGRKGGXVGXXXGXRXGGGWAEGXGXXDLXXXXXXGSEXXXXGGEXGGAXGGXX 680 G G G G G GG G + + GG GG GG Sbjct: 553 GGNDGSNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNN 612 Query: 679 XXGGXGXXGXGG 644 G G GG Sbjct: 613 NGGNTGGNNNGG 624 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 37.9 bits (84), Expect = 0.012 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +3 Query: 645 PPXPXXPXPPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXPSAHPPPXL 800 PP P P PP PP PP PP L P PPP L Sbjct: 212 PPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPPTL 263 Score = 34.3 bits (75), Expect = 0.15 Identities = 22/76 (28%), Positives = 24/76 (31%), Gaps = 2/76 (2%) Frame = +3 Query: 609 ISHXYLXXSSXXPPXPXXPXPPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXPSAH- 785 I + S P PP PP +PP PP S P P A Sbjct: 185 IDQISIGTSHPTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAK 244 Query: 786 -PPPXLXPXXXPTXPP 830 P P P PT PP Sbjct: 245 LPEPPPIPNMPPTLPP 260 Score = 31.9 bits (69), Expect = 0.79 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRP 700 PPPP PP P PP P P Sbjct: 206 PPPPRPPPSPPPPPPPPSP 224 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 611 LTXIPXXFXXXPPPPXPPXPPXPPXXPXRPP 703 +T P PP P PP PP P P PP Sbjct: 201 ITQPPPPPPRPPPSPPPPPPPPSPSPPRPPP 231 Score = 28.3 bits (60), Expect = 9.7 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 786 PPPXLXPXXXPTXPPFLPXLPXPXPRP 866 PPP P P PP P P P P P Sbjct: 207 PPPRPPPSPPPPPPPPSPSPPRPPPPP 233 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 37.5 bits (83), Expect = 0.016 Identities = 26/74 (35%), Positives = 30/74 (40%), Gaps = 2/74 (2%) Frame = +3 Query: 645 PPXPXXPXPPXXXXPPXAP-PXSPPXXXXSLXXXXXXXKSXXPXP-SAHPPPXLXPXXXP 818 PP P P PP PP P + P + + P P SA PPP + P Sbjct: 910 PPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPP-IPATQVP 968 Query: 819 TXPPFLPXLPXPXP 860 PP LP LP P P Sbjct: 969 --PPPLPPLPPPPP 980 Score = 31.1 bits (67), Expect = 1.4 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 644 PPPPXPPXPPXPP 682 PPPP PP PP PP Sbjct: 968 PPPPLPPLPPPPP 980 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP P P PP P PP Sbjct: 908 PPPPLPLAPEPPPPLPPPPP 927 Score = 29.1 bits (62), Expect = 5.6 Identities = 17/64 (26%), Positives = 20/64 (31%), Gaps = 2/64 (3%) Frame = +3 Query: 645 PPXPXXPXPPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXP--SAHPPPXLXPXXXP 818 PP P P PP P +P + S P P + PP P P Sbjct: 918 PPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPATQVPPPPLPPLPP 977 Query: 819 TXPP 830 PP Sbjct: 978 PPPP 981 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 37.5 bits (83), Expect = 0.016 Identities = 26/75 (34%), Positives = 26/75 (34%), Gaps = 1/75 (1%) Frame = -3 Query: 865 GRGXGXGRXGRKGGXVGXXXGXRXGGGWAEGXG-XXDLXXXXXXGSEXXXXGGEXGGAXG 689 G G G G R GG G R GGG G G G GG GG G Sbjct: 133 GGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYG 192 Query: 688 GXXXXGGXGXXGXGG 644 G GG G G G Sbjct: 193 GGGYGGGGGGYGGSG 207 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -1 Query: 714 GGXWGGRXGXXGGXGGXGGXGGGG 643 GG +GG GG GG G GGGG Sbjct: 178 GGGYGGGGHGGGGYGGGGYGGGGG 201 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 723 RXXGGXWGGRXGXXGGXGGXGGXGGGG 643 R GG GGR G G G G GGGG Sbjct: 127 RRGGGYGGGRGGGGGYRSGGGYRGGGG 153 Score = 29.1 bits (62), Expect = 5.6 Identities = 31/103 (30%), Positives = 33/103 (32%) Frame = -1 Query: 951 GGXGGXEGXAGXXLWRXXXXXXXXGXXGGGGGXXPXXXXXXXXGWVXXXGXEXGGGGPKV 772 GG GG G G G GGGGG G G GGGG Sbjct: 130 GGYGGGRGGGGGYR-SGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGG 188 Query: 771 XARXIWXXXXXGEVXPRXXGGXWGGRXGXXGGXGGXGGXGGGG 643 + G G +GG G GG G G GGGG Sbjct: 189 GG---YGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGGG 228 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 37.1 bits (82), Expect = 0.021 Identities = 28/103 (27%), Positives = 29/103 (28%), Gaps = 1/103 (0%) Frame = +3 Query: 645 PPXPXXPXPPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXPSAHPP-PXLXPXXXPT 821 PP P P PP P PP + P P P P PT Sbjct: 1043 PPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPT 1102 Query: 822 XPPFLPXLPXPXPRPXLXXXXXXXXXXXXXXXHRPXLPXXPPP 950 PP P P PRP HRP P P P Sbjct: 1103 EPPPRQPKPTPAPRP-------RSWVESQPELHRPPPPIKPKP 1138 Score = 31.9 bits (69), Expect = 0.79 Identities = 24/77 (31%), Positives = 25/77 (32%), Gaps = 5/77 (6%) Frame = +3 Query: 645 PPXPXX-PXPPXXXX-PPXAPPXSPPXXXX---SLXXXXXXXKSXXPXPSAHPPPXLXPX 809 PP P P PP PP A P PP S K P PPP P Sbjct: 1019 PPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPP 1078 Query: 810 XXPTXPPFLPXLPXPXP 860 + P P P P P Sbjct: 1079 PSTSQPVPPPRQPDPIP 1095 Score = 28.7 bits (61), Expect = 7.4 Identities = 19/65 (29%), Positives = 19/65 (29%), Gaps = 3/65 (4%) Frame = +3 Query: 768 PXPSAHPPPXLXPXXXPTXPPFLPXLPXPXPR---PXLXXXXXXXXXXXXXXXHRPXLPX 938 P PPP P P P P P P PR P P P Sbjct: 1043 PPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPT 1102 Query: 939 XPPPR 953 PPPR Sbjct: 1103 EPPPR 1107 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 35.9 bits (79), Expect = 0.049 Identities = 24/79 (30%), Positives = 29/79 (36%), Gaps = 2/79 (2%) Frame = +3 Query: 615 HXYLXXSSXXPPXPXXPXP-PXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXPSAHPP 791 + + SS PP P P P PP A P +PP P P+ PP Sbjct: 42 YPHFISSSPPPPPPSPPAAAPAAPPPPAAAPAAPPPP----AAPPAAPPPPPPLPAPPPP 97 Query: 792 PXL-XPXXXPTXPPFLPXL 845 P P P P FLP + Sbjct: 98 PAQPAPQPPPAPPHFLPFI 116 Score = 35.1 bits (77), Expect = 0.085 Identities = 19/59 (32%), Positives = 22/59 (37%) Frame = +3 Query: 690 PXAPPXSPPXXXXSLXXXXXXXKSXXPXPSAHPPPXLXPXXXPTXPPFLPXLPXPXPRP 866 P PP SPP + + P P+A P P P PP P P P P P Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPP-PPAQPAPQPPP 107 Score = 33.5 bits (73), Expect = 0.26 Identities = 22/66 (33%), Positives = 25/66 (37%) Frame = +3 Query: 669 PPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXPSAHPPPXLXPXXXPTXPPFLPXLP 848 PP PP A P +PP + P+A PPP P P PP P P Sbjct: 51 PPPPPSPPAAAPAAPPPPAAA----PAAPPPPAAPPAAPPPP--PPLPAPPPPPAQP-AP 103 Query: 849 XPXPRP 866 P P P Sbjct: 104 QPPPAP 109 Score = 30.7 bits (66), Expect = 1.8 Identities = 18/57 (31%), Positives = 23/57 (40%) Frame = +3 Query: 696 APPXSPPXXXXSLXXXXXXXKSXXPXPSAHPPPXLXPXXXPTXPPFLPXLPXPXPRP 866 +PP PP + + P+A PPP P P PP LP P P +P Sbjct: 49 SPPPPPPSPPAAAPAAPPPPAA---APAAPPPPAAPPAAPPPPPP-LPAPPPPPAQP 101 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP P PP PP P P Sbjct: 86 PPPPPLPAPPPPPAQPAPQP 105 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 1/21 (4%) Frame = +2 Query: 644 PPPPXPPX-PPXPPXXPXRPP 703 PPP PP PP PP P PP Sbjct: 76 PPPAAPPAAPPPPPPLPAPPP 96 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 4/26 (15%) Frame = +2 Query: 644 PPPPXPPXPPXP----PXXPXRPPXF 709 PPPP P PP P P P PP F Sbjct: 87 PPPPLPAPPPPPAQPAPQPPPAPPHF 112 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 35.9 bits (79), Expect = 0.049 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP PP P P +PP Sbjct: 5 PPPPGPPPPPSAPSGPVKPP 24 Score = 34.7 bits (76), Expect = 0.11 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRP 700 PPPP PP PP PP P P Sbjct: 2 PPPPPPPGPPPPPSAPSGP 20 Score = 29.1 bits (62), Expect = 5.6 Identities = 19/74 (25%), Positives = 22/74 (29%), Gaps = 3/74 (4%) Frame = +3 Query: 648 PXPXXPXPPXXXXPPXAPPXS---PPXXXXSLXXXXXXXKSXXPXPSAHPPPXLXPXXXP 818 P P P PP P S PP + + P P+ PP P Sbjct: 239 PLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGP 298 Query: 819 TXPPFLPXLPXPXP 860 PP P P P Sbjct: 299 PLPPSRDQAPAPPP 312 Score = 28.3 bits (60), Expect = 9.7 Identities = 19/72 (26%), Positives = 21/72 (29%) Frame = +3 Query: 645 PPXPXXPXPPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXPSAHPPPXLXPXXXPTX 824 PP P P P PP P S P+ PP P P Sbjct: 265 PPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATP---PPP 321 Query: 825 PPFLPXLPXPXP 860 PP +P P P Sbjct: 322 PPSRDQVPLPPP 333 Score = 28.3 bits (60), Expect = 9.7 Identities = 19/69 (27%), Positives = 19/69 (27%), Gaps = 4/69 (5%) Frame = +3 Query: 636 SXXPPXPXXPXPPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXPSAH----PPPXLX 803 S PP P PP PP P P PS PPP L Sbjct: 277 SSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLR 336 Query: 804 PXXXPTXPP 830 P PP Sbjct: 337 GQIAPPPPP 345 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 35.9 bits (79), Expect = 0.049 Identities = 26/102 (25%), Positives = 26/102 (25%) Frame = +3 Query: 645 PPXPXXPXPPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXPSAHPPPXLXPXXXPTX 824 PP P P P P PP SP P P PP P Sbjct: 111 PPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPP---PPIAPATGGPPPP 167 Query: 825 PPFLPXLPXPXPRPXLXXXXXXXXXXXXXXXHRPXLPXXPPP 950 PP P P P L P P PPP Sbjct: 168 PPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPP 209 Score = 35.9 bits (79), Expect = 0.049 Identities = 21/72 (29%), Positives = 26/72 (36%), Gaps = 1/72 (1%) Frame = +3 Query: 648 PXPXXPXPPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXPSA-HPPPXLXPXXXPTX 824 P P P P PP PP +P ++ + P P + PPP P P Sbjct: 151 PPPPPPIAPATGGPPPPPPIAPAA---TVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPP 207 Query: 825 PPFLPXLPXPXP 860 PP L P P Sbjct: 208 PPILELAAPPPP 219 Score = 32.3 bits (70), Expect = 0.60 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 2/22 (9%) Frame = +2 Query: 644 PPPPX--PPXPPXPPXXPXRPP 703 PPPP PP PP PP P PP Sbjct: 188 PPPPSGGPPPPPPPPPPPPPPP 209 Score = 31.9 bits (69), Expect = 0.79 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 620 IPXXFXXXPPPPXPPXPPXPPXXPXRPP 703 +P PPP P PP PP P PP Sbjct: 181 VPLAAASPPPPSGGPPPPPPPPPPPPPP 208 Score = 31.5 bits (68), Expect = 1.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP PP PP P Sbjct: 197 PPPPPPPPPPPPPILELAAP 216 Score = 29.9 bits (64), Expect = 3.2 Identities = 22/82 (26%), Positives = 26/82 (31%), Gaps = 5/82 (6%) Frame = +3 Query: 636 SXXPPXPXXPXPPXXXXPPXAPPXSP----PXXXXSLXXXXXXXKSXXP-XPSAHPPPXL 800 S P P P P PP PP +P P + P P+A P Sbjct: 121 SQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPA 180 Query: 801 XPXXXPTXPPFLPXLPXPXPRP 866 P + PP P P P P Sbjct: 181 VPLAAASPPPPSGGPPPPPPPP 202 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP PP P PP Sbjct: 198 PPPPPPPPPPPPILELAAPP 217 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 35.1 bits (77), Expect = 0.085 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 711 GXWGGRXGXXGGXGGXGGXGGGG 643 G WGGR G GG GG G GG G Sbjct: 160 GGWGGRGGNGGGRGGGEGGGGRG 182 Score = 34.3 bits (75), Expect = 0.15 Identities = 25/73 (34%), Positives = 28/73 (38%) Frame = -3 Query: 865 GRGXGXGRXGRKGGXVGXXXGXRXGGGWAEGXGXXDLXXXXXXGSEXXXXGGEXGGAXGG 686 GRG GR G +G G G GGG G G + G+ GGE GG G Sbjct: 128 GRGGWRGRGGGEGNGAGGGIGR--GGG--RGRGGGEGGWGGRGGNGGGRGGGEGGGGRGR 183 Query: 685 XXXXGGXGXXGXG 647 G G G G Sbjct: 184 GTGGGSRGGGGDG 196 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 714 GGXWGGRXGXXGGXGGXGGXGGG 646 GG GGR G GG G G GGG Sbjct: 166 GGNGGGRGGGEGGGGRGRGTGGG 188 Score = 28.3 bits (60), Expect = 9.7 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -1 Query: 714 GGXWGGRXGXXGGXGGXGGXGGGGXXXKXXG 622 GG GG G G G GG GGG + G Sbjct: 170 GGRGGGEGGGGRGRGTGGGSRGGGGDGRGRG 200 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 35.1 bits (77), Expect = 0.085 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRP 700 PPPP PP PP PP P P Sbjct: 1312 PPPPPPPPPPPPPPLPPTP 1330 Score = 32.3 bits (70), Expect = 0.60 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 2/22 (9%) Frame = +2 Query: 644 PP--PPXPPXPPXPPXXPXRPP 703 PP PP PP PP PP P PP Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPP 1328 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 35.1 bits (77), Expect = 0.085 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 702 GGRXGXXGGXGGXGGXGGGG 643 GGR G GG GG GG GGGG Sbjct: 81 GGRGGGFGGGGGFGGGGGGG 100 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = -1 Query: 714 GGXWGGRXGXXGGXGGXGGXGGGG 643 GG +GG G GG GG G GGGG Sbjct: 84 GGGFGGGGGFGGGGGGGFGGGGGG 107 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = -1 Query: 714 GGXWGGRXGXXGGXGGXGGXGGGG 643 GG +GG G G GG GG GGGG Sbjct: 90 GGGFGGGGGGGFGGGGGGGFGGGG 113 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -3 Query: 865 GRGXGXGRXGRKGGXVGXXXGXRXGGGWAEGXG 767 GRG G G G GG G G GGG+ G G Sbjct: 82 GRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGG 114 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 34.7 bits (76), Expect = 0.11 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRP 700 PPPP PP PP PP P P Sbjct: 867 PPPPPPPPPPPPPPPPPPP 885 Score = 34.7 bits (76), Expect = 0.11 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 647 PPPXPPXPPXPPXXPXRPP 703 PPP PP PP PP P PP Sbjct: 867 PPPPPPPPPPPPPPPPPPP 885 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 648 PXPXXPXPPXXXXPPXAPPXSPP 716 P P P PP PP PP PP Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPP 884 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 P P PP PP PP P PP Sbjct: 862 PRPRRPPPPPPPPPPPPPPP 881 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 P P PP PP PP P PP Sbjct: 864 PRRPPPPPPPPPPPPPPPPP 883 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 34.7 bits (76), Expect = 0.11 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP PP PP P P Sbjct: 56 PPPPPPPPPPPPPPPPSSSP 75 Score = 34.3 bits (75), Expect = 0.15 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRP 700 PPPP PP PP P P RP Sbjct: 60 PPPPPPPPPPPPSSSPSRP 78 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP PP PP P PP Sbjct: 54 PPPPPPPPPPPPPPPP--PP 71 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 34.7 bits (76), Expect = 0.11 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 647 PPPXPPXPPXPPXXPXRPP 703 PPP PP PP PP P PP Sbjct: 1157 PPPPPPPPPPPPSSPSPPP 1175 Score = 34.3 bits (75), Expect = 0.15 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP PP P P PP Sbjct: 1159 PPPPPPPPPPSSPSPPPPPP 1178 Score = 34.3 bits (75), Expect = 0.15 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP P PP P PP Sbjct: 1162 PPPPPPPSSPSPPPPPPPPP 1181 Score = 34.3 bits (75), Expect = 0.15 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP P PP PP P PP Sbjct: 1165 PPPPSSPSPPPPPPPPPPPP 1184 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP PP P PP Sbjct: 1158 PPPPPPPPPPPSSPSPPPPP 1177 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 4/24 (16%) Frame = +2 Query: 644 PPPPXPPXP----PXPPXXPXRPP 703 PPPP PP P P PP P PP Sbjct: 1160 PPPPPPPPPSSPSPPPPPPPPPPP 1183 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 2/21 (9%) Frame = +2 Query: 644 PPP--PXPPXPPXPPXXPXRP 700 PPP P PP PP PP P P Sbjct: 1166 PPPSSPSPPPPPPPPPPPPTP 1186 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 34.7 bits (76), Expect = 0.11 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRP 700 PPPP PP PP PP P P Sbjct: 102 PPPPPPPPPPPPPPPPPPP 120 Score = 34.7 bits (76), Expect = 0.11 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 647 PPPXPPXPPXPPXXPXRPP 703 PPP PP PP PP P PP Sbjct: 102 PPPPPPPPPPPPPPPPPPP 120 Score = 32.7 bits (71), Expect = 0.45 Identities = 25/87 (28%), Positives = 25/87 (28%), Gaps = 13/87 (14%) Frame = +3 Query: 645 PPXPXXPXPPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXPSAHPPPXLXPXXXP-- 818 PP P PP PP PP PP P P PPP P P Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPPPPITLH-HEQHVVSHVMHPAPPPPPPPPPAPCMPPCH 154 Query: 819 -----------TXPPFLPXLPXPXPRP 866 PP P P P P P Sbjct: 155 QTQVVHSVQLHASPPGPPPAPMPAPPP 181 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 653 PXPPXPPXPPXXPXRPP 703 P PP PP PP P PP Sbjct: 136 PAPPPPPPPPPAPCMPP 152 >SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) Length = 496 Score = 34.7 bits (76), Expect = 0.11 Identities = 21/66 (31%), Positives = 22/66 (33%), Gaps = 1/66 (1%) Frame = +3 Query: 669 PPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXPSAHPP-PXLXPXXXPTXPPFLPXL 845 PP P P SPP SL P P +PP P P P P P Sbjct: 289 PPRYPPSPPRYPPSPPRYPPSLHRYPQSPLRYPPSPIRYPPLPSRYPPSPPRYPSSHPRY 348 Query: 846 PXPXPR 863 P PR Sbjct: 349 PPSPPR 354 Score = 33.1 bits (72), Expect = 0.34 Identities = 22/69 (31%), Positives = 24/69 (34%), Gaps = 4/69 (5%) Frame = +3 Query: 669 PPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXX---PXPSAHPP-PXLXPXXXPTXPPFL 836 PP P +PP PP S P PS +PP P P P PP Sbjct: 293 PPSPPRYPPSPPRYPPSLHRYPQSPLRYPPSPIRYPPLPSRYPPSPPRYPSSHPRYPPSP 352 Query: 837 PXLPXPXPR 863 P P PR Sbjct: 353 PRYPPSPPR 361 Score = 30.3 bits (65), Expect = 2.4 Identities = 22/73 (30%), Positives = 24/73 (32%) Frame = +3 Query: 645 PPXPXXPXPPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXPSAHPPPXLXPXXXPTX 824 PP P PP P +P PP S PS+HP P P Sbjct: 300 PPSPPR-YPPSLHRYPQSPLRYPPSPIRYPPLPSRYPPSPPRYPSSHPR---YPPSPPRY 355 Query: 825 PPFLPXLPXPXPR 863 PP P P PR Sbjct: 356 PPSPPRYPSSHPR 368 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 34.7 bits (76), Expect = 0.11 Identities = 27/73 (36%), Positives = 27/73 (36%) Frame = -3 Query: 865 GRGXGXGRXGRKGGXVGXXXGXRXGGGWAEGXGXXDLXXXXXXGSEXXXXGGEXGGAXGG 686 G G G G G GG G G GGG A G G G E GG GG G Sbjct: 1759 GGGGGGGGMGGGGGMAGGGGGM-GGGGMAAGGGEFG-------GGEGMGGGGMAGGGGGM 1810 Query: 685 XXXXGGXGXXGXG 647 GG G G G Sbjct: 1811 GGGGGGMGGGGEG 1823 Score = 31.1 bits (67), Expect = 1.4 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 2/63 (3%) Frame = -3 Query: 826 GXVGXXXGXRXGGGWAEGXGXXDLXXXXXXGSEXXXXGGEXGG--AXGGXXXXGGXGXXG 653 G G G GGG A G G G E G GG A GG GG G G Sbjct: 1759 GGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMG 1818 Query: 652 XGG 644 GG Sbjct: 1819 GGG 1821 Score = 29.1 bits (62), Expect = 5.6 Identities = 17/59 (28%), Positives = 19/59 (32%) Frame = -3 Query: 865 GRGXGXGRXGRKGGXVGXXXGXRXGGGWAEGXGXXDLXXXXXXGSEXXXXGGEXGGAXG 689 G G G G GG + G GGG G G + GG GG G Sbjct: 1788 GGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGGG 1846 Score = 28.7 bits (61), Expect = 7.4 Identities = 18/61 (29%), Positives = 19/61 (31%) Frame = -3 Query: 829 GGXVGXXXGXRXGGGWAEGXGXXDLXXXXXXGSEXXXXGGEXGGAXGGXXXXGGXGXXGX 650 GG G G GGG G + GGE G G GG G G Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGG 1815 Query: 649 G 647 G Sbjct: 1816 G 1816 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 34.3 bits (75), Expect = 0.15 Identities = 23/76 (30%), Positives = 25/76 (32%) Frame = +3 Query: 633 SSXXPPXPXXPXPPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXPSAHPPPXLXPXX 812 S+ PP PP PP PP L + P P PPP P Sbjct: 1220 SAPRPPPMGHHMMNMPPPPPAMPPDGPPKFM-GLPPPPPGMRPMPPQPPFMPPP---PRM 1275 Query: 813 XPTXPPFLPXLPXPXP 860 P PP P P P P Sbjct: 1276 QPPGPPGPPGPPGPQP 1291 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 623 PXXFXXXPPPPXPPXPPXPPXXPXRPP 703 P F PPPP P P PP P PP Sbjct: 1246 PPKFMGLPPPP-PGMRPMPPQPPFMPP 1271 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Frame = +2 Query: 644 PPPPX--PPXPPXPPXXPXRPP 703 PPPP PP PP PP P P Sbjct: 1270 PPPPRMQPPGPPGPPGPPGPQP 1291 >SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/25 (64%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = -1 Query: 714 GGXWGGRXGXXGG-XGGXGGXGGGG 643 GG GGR G GG GG GG GGGG Sbjct: 369 GGRGGGRGGGRGGFRGGRGGRGGGG 393 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = -1 Query: 723 RXXGGXWGGRXGXXGGXGGXGGXGGG 646 R GG +GG G GG G GG GGG Sbjct: 189 RSGGGGYGGSKGGYGGGSGGGGYGGG 214 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = -1 Query: 714 GGXWGGR-XGXXGGXGGXGGXGGGG 643 GG GGR G GG G GG GGGG Sbjct: 209 GGYGGGRGGGGYGGGHGGGGYGGGG 233 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/50 (36%), Positives = 21/50 (42%) Frame = -3 Query: 793 GGGWAEGXGXXDLXXXXXXGSEXXXXGGEXGGAXGGXXXXGGXGXXGXGG 644 GGG ++G G GS+ GG GG GG GG G GG Sbjct: 179 GGGGSQGGGYRS-GGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGG 227 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 34.3 bits (75), Expect = 0.15 Identities = 23/75 (30%), Positives = 24/75 (32%), Gaps = 1/75 (1%) Frame = +3 Query: 645 PPXPXXPXP-PXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXPSAHPPPXLXPXXXPT 821 PP P P P PP PP PP + P P PPP P Sbjct: 436 PPQPRPPHGMPQGGGPPQLPPNLPPPPG-GMRGMPPPPMGMYPPPRGFPPPPFGP----- 489 Query: 822 XPPFLPXLPXPXPRP 866 PPF P P P Sbjct: 490 PPPFYRGPPPPRGMP 504 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +2 Query: 623 PXXFXXXPPPPXPPXPPXPPXXPXRP 700 P PPPP PP PP PP +P Sbjct: 73 PPPLCAPPPPPPPPPPPPPPPGAKKP 98 Score = 32.3 bits (70), Expect = 0.60 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP PP PP + P Sbjct: 79 PPPPPPPPPPPPPPPGAKKP 98 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPP P PP PP P PP Sbjct: 73 PPPLCAPPPPPPPPPPPPPP 92 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 2/21 (9%) Frame = +2 Query: 647 PPPX--PPXPPXPPXXPXRPP 703 PPP PP PP PP P PP Sbjct: 73 PPPLCAPPPPPPPPPPPPPPP 93 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 614 TXIPXXFXXXPPPPXPPXPPXP 679 T P PPPP PP PP P Sbjct: 72 TPPPLCAPPPPPPPPPPPPPPP 93 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 33.9 bits (74), Expect = 0.20 Identities = 19/72 (26%), Positives = 21/72 (29%) Frame = +3 Query: 645 PPXPXXPXPPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXPSAHPPPXLXPXXXPTX 824 PP P P P + P PP + P P PP P Sbjct: 923 PPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAP 982 Query: 825 PPFLPXLPXPXP 860 PP P P P P Sbjct: 983 PPPPPPPPPPPP 994 Score = 28.3 bits (60), Expect = 9.7 Identities = 24/83 (28%), Positives = 26/83 (31%), Gaps = 7/83 (8%) Frame = +3 Query: 633 SSXXPPXPXXPXPPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXP---SAHPP---- 791 S+ P P PP PP P S P P SA PP Sbjct: 911 SASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGA 970 Query: 792 PXLXPXXXPTXPPFLPXLPXPXP 860 P L P + PP P P P P Sbjct: 971 PPLPPPPGGSAPPPPPPPPPPPP 993 Score = 28.3 bits (60), Expect = 9.7 Identities = 21/75 (28%), Positives = 22/75 (29%), Gaps = 2/75 (2%) Frame = +3 Query: 645 PPXPXXPXPPXXXXPPX--APPXSPPXXXXSLXXXXXXXKSXXPXPSAHPPPXLXPXXXP 818 PP P P PP AP PP + S P PP P Sbjct: 922 PPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSA 981 Query: 819 TXPPFLPXLPXPXPR 863 PP P P P R Sbjct: 982 PPPPPPPPPPPPPMR 996 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +2 Query: 623 PXXFXXXPPPPXPPXPPXPPXXPXRP 700 P PPPP PP PP PP +P Sbjct: 274 PPPLCAPPPPPPPPPPPPPPPGAKKP 299 Score = 32.3 bits (70), Expect = 0.60 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP PP PP + P Sbjct: 280 PPPPPPPPPPPPPPPGAKKP 299 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPP P PP PP P PP Sbjct: 274 PPPLCAPPPPPPPPPPPPPP 293 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 2/21 (9%) Frame = +2 Query: 647 PPPX--PPXPPXPPXXPXRPP 703 PPP PP PP PP P PP Sbjct: 274 PPPLCAPPPPPPPPPPPPPPP 294 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 614 TXIPXXFXXXPPPPXPPXPPXP 679 T P PPPP PP PP P Sbjct: 273 TPPPLCAPPPPPPPPPPPPPPP 294 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 33.5 bits (73), Expect = 0.26 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 620 IPXXFXXXPPPPXPPXPPXPP 682 IP PPPP PP PP PP Sbjct: 63 IPPTLPPPPPPPPPPLPPPPP 83 Score = 33.1 bits (72), Expect = 0.34 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXP 691 PPPP PP PP PP P Sbjct: 68 PPPPPPPPPPLPPPPP 83 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PP PP PP PP P PP Sbjct: 64 PPTLPPPPPPPPPPLPPPPP 83 Score = 29.5 bits (63), Expect = 4.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 P PP P PP PP P PP Sbjct: 62 PIPPTLPPPPPPPPPPLPPP 81 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 33.5 bits (73), Expect = 0.26 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 620 IPXXFXXXPPPPXPPXPPXPP 682 IP PPPP PP PP PP Sbjct: 287 IPPTLPPPPPPPPPPLPPPPP 307 Score = 33.1 bits (72), Expect = 0.34 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXP 691 PPPP PP PP PP P Sbjct: 292 PPPPPPPPPPLPPPPP 307 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PP PP PP PP P PP Sbjct: 288 PPTLPPPPPPPPPPLPPPPP 307 Score = 29.5 bits (63), Expect = 4.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 P PP P PP PP P PP Sbjct: 286 PIPPTLPPPPPPPPPPLPPP 305 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 33.5 bits (73), Expect = 0.26 Identities = 27/103 (26%), Positives = 31/103 (30%), Gaps = 2/103 (1%) Frame = +3 Query: 648 PXPXXPXPPXXXXPPXAPPXSP-PXXXXSLXXXXXXXKSXXPXPSAHPPPXLXPXXXPTX 824 P P P PP P PP +P P P P PP P P Sbjct: 527 PHPRVP-PPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPG 585 Query: 825 PPFLPXLPXPX-PRPXLXXXXXXXXXXXXXXXHRPXLPXXPPP 950 P P +P P P P + + P LP PP Sbjct: 586 TPH-PRVPPPGAPHPKVPPPGAPYQRLPYSGAYHPRLPPPGPP 627 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 33.5 bits (73), Expect = 0.26 Identities = 26/84 (30%), Positives = 30/84 (35%), Gaps = 3/84 (3%) Frame = +3 Query: 624 LXXSSXXPPXPXXPXPPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXPSAHPPPXLX 803 L S+ PP P P P PP + PP S + P P PPP + Sbjct: 238 LGLSNIKPPPPPVPPPTIPSVPPGSETYVPPG---SATYESMDSVNKAPVPPMTPPPAVV 294 Query: 804 PXXXPTXPPFLPXLP---XPXPRP 866 T PP P LP P P P Sbjct: 295 -----TAPPPAPPLPNFTSPSPPP 313 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 33.5 bits (73), Expect = 0.26 Identities = 22/71 (30%), Positives = 24/71 (33%) Frame = +3 Query: 654 PXXPXPPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXPSAHPPPXLXPXXXPTXPPF 833 P P PP PP PP + P P P+ PPP P P PP Sbjct: 354 PPSPPPPTNNTPPPPPPTNKP--------------PPPPPPTNGPPPPPPPTNGPPPPPP 399 Query: 834 LPXLPXPXPRP 866 P P P P Sbjct: 400 PTNGPPPPPPP 410 Score = 29.9 bits (64), Expect = 3.2 Identities = 18/61 (29%), Positives = 19/61 (31%) Frame = +3 Query: 636 SXXPPXPXXPXPPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXPSAHPPPXLXPXXX 815 S PP P PP P PP PP P P+ PPP P Sbjct: 356 SPPPPTNNTPPPPPPTNKP--PPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNG 413 Query: 816 P 818 P Sbjct: 414 P 414 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Frame = +2 Query: 644 PPPPX--PPXPPXPPXXPXRPP 703 PPPP PP PP P P PP Sbjct: 367 PPPPTNKPPPPPPPTNGPPPPP 388 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Frame = +2 Query: 644 PPPPX--PPXPPXPPXXPXRPP 703 PPPP PP PP P P PP Sbjct: 377 PPPPTNGPPPPPPPTNGPPPPP 398 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Frame = +2 Query: 644 PPPPX--PPXPPXPPXXPXRPP 703 PPPP PP PP P P PP Sbjct: 387 PPPPTNGPPPPPPPTNGPPPPP 408 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/50 (28%), Positives = 15/50 (30%) Frame = +3 Query: 645 PPXPXXPXPPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXPSAHPPP 794 PP P PP P PP PP P P + PP Sbjct: 366 PPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 28.3 bits (60), Expect = 9.7 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP P P PP P P Sbjct: 365 PPPPPPTNKPPPPPPPTNGP 384 >SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 650 Score = 33.1 bits (72), Expect = 0.34 Identities = 21/70 (30%), Positives = 25/70 (35%), Gaps = 3/70 (4%) Frame = +3 Query: 645 PPXPXXPXPPXXXXPPXAP--PXSPPXXXXSLXXXXXXXKSXXPXPSAHPP-PXLXPXXX 815 PP P P PP AP P +P S P ++PP P P Sbjct: 187 PPTPSSYPPTQPSYPPTAPSYPPTPSSYPPIAASYPPTAPSYNPTAPSYPPTPSSYPPTQ 246 Query: 816 PTXPPFLPXL 845 P+ PP P L Sbjct: 247 PSHPPTAPFL 256 >SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 519 Score = 33.1 bits (72), Expect = 0.34 Identities = 24/81 (29%), Positives = 27/81 (33%) Frame = -3 Query: 865 GRGXGXGRXGRKGGXVGXXXGXRXGGGWAEGXGXXDLXXXXXXGSEXXXXGGEXGGAXGG 686 G G G G G G G GGG +G D GS GG+ G GG Sbjct: 131 GDGDGDGDGDGDGDGDGDGDGDGDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDGGDDGGG 190 Query: 685 XXXXGGXGXXGXGGXXXEXXR 623 G G GG + R Sbjct: 191 SGGGGDDGGSDGGGGGNDGGR 211 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 33.1 bits (72), Expect = 0.34 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = -1 Query: 723 RXXGGXWGGRXGXXGGXGGXGGXGGGG 643 R GG +GG G GG GG GGGG Sbjct: 102 RGGGGGYGGGGGYGGGGRSYGGGGGGG 128 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 702 GGRXGXXGGXGGXGGXGGGG 643 GGR G GG GG GG GGGG Sbjct: 100 GGRGGG-GGYGGGGGYGGGG 118 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 32.7 bits (71), Expect = 0.45 Identities = 16/28 (57%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -1 Query: 723 RXXGGXWGGRXGXXGGX-GGXGGXGGGG 643 R GG GG G GG GG GG GGGG Sbjct: 23 RDGGGGHGGGHGYGGGPNGGGGGGGGGG 50 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -1 Query: 714 GGXWGGRXGXXGGXGGXGGXGGG 646 G +GG GG GG GG GGG Sbjct: 32 GHGYGGGPNGGGGGGGGGGGGGG 54 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 32.3 bits (70), Expect = 0.60 Identities = 25/77 (32%), Positives = 27/77 (35%), Gaps = 1/77 (1%) Frame = +3 Query: 645 PPXPXXPXPPXXXXPPXAP-PXSPPXXXXSLXXXXXXXKSXXPXPSAHPPPXLXPXXXPT 821 PP P P PP P P P PP S P P H PP PT Sbjct: 274 PPNPSIPAPPNPSIPLAPPNPYIPP------APPNLFIPSAPPNP--HIPPAPPNPYIPT 325 Query: 822 XPPFLPXLPXPXPRPXL 872 PP P +P P P + Sbjct: 326 APP-NPSIPPAPPNPSI 341 Score = 31.9 bits (69), Expect = 0.79 Identities = 24/77 (31%), Positives = 26/77 (33%), Gaps = 3/77 (3%) Frame = +3 Query: 645 PPXPXXPXPPXXXXPPXAPPXS--PPXXXXSLXXXXXXXKSXXPXPSAHPPPXLXP-XXX 815 PP P P P P APP PP S P P P P + P Sbjct: 291 PPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIPPAP---PNPSIPPAPPN 347 Query: 816 PTXPPFLPXLPXPXPRP 866 P+ PP P L P P Sbjct: 348 PSIPPAPPNLFIPPATP 364 Score = 31.5 bits (68), Expect = 1.0 Identities = 26/105 (24%), Positives = 29/105 (27%) Frame = +3 Query: 636 SXXPPXPXXPXPPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXPSAHPPPXLXPXXX 815 S P P P PP P APP +PP L P P P Sbjct: 183 STIPTPPTPPAPPSPPI-PTAPP-TPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAI 240 Query: 816 PTXPPFLPXLPXPXPRPXLXXXXXXXXXXXXXXXHRPXLPXXPPP 950 T P +P P P P P +P P P Sbjct: 241 ATPNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPNP 285 Score = 31.1 bits (67), Expect = 1.4 Identities = 23/100 (23%), Positives = 28/100 (28%), Gaps = 2/100 (2%) Frame = +3 Query: 654 PXXPXPPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXPSAH-PPPXLXPXXXPTXPP 830 P P P P PP P + ++ P S H PP L P P P Sbjct: 176 PPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPN 235 Query: 831 FLPXLPXP-XPRPXLXXXXXXXXXXXXXXXHRPXLPXXPP 947 + P P P P +P PP Sbjct: 236 PSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIPPAPP 275 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 623 PXXFXXXPPPPXPPXPPXPPXXPXRP 700 P P PP PP PP P P P Sbjct: 182 PSTIPTPPTPPAPPSPPIPTAPPTPP 207 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 32.3 bits (70), Expect = 0.60 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 2/22 (9%) Frame = +2 Query: 644 PPPPXPP--XPPXPPXXPXRPP 703 PPPP PP PP PP P PP Sbjct: 304 PPPPPPPGGAPPPPPPPPPPPP 325 Score = 31.5 bits (68), Expect = 1.0 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 647 PPPXPPXPPXPPXXPXRPP 703 PPP PP PP PP PP Sbjct: 314 PPPPPPPPPPPPGDGGAPP 332 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP PP P PP Sbjct: 316 PPPPPPPPPPGDGGAPPPPP 335 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 648 PXPXXPXPPXXXXPPXAPPXSPP 716 P P P PP PP PP PP Sbjct: 302 PAPPPPPPPGGAPPPPPPPPPPP 324 Score = 28.3 bits (60), Expect = 9.7 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 3/23 (13%) Frame = +2 Query: 644 PPPPXPPXP---PXPPXXPXRPP 703 P PP PP P P PP P PP Sbjct: 302 PAPPPPPPPGGAPPPPPPPPPPP 324 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 31.9 bits (69), Expect = 0.79 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 623 PXXFXXXPPPPXPPXPPXPPXXP 691 P + PPPP PP P PP P Sbjct: 32 PPPYEAPPPPPGPPGPDGPPGFP 54 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +2 Query: 644 PPPPXP---PXPPXPPXXPXRPPXF 709 PPPP P P PP P P PP F Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPPGF 53 Score = 28.3 bits (60), Expect = 9.7 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRP 700 P PP P PP PP P P Sbjct: 285 PGPPGPQMPPGPPGLPGAP 303 Score = 28.3 bits (60), Expect = 9.7 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRP 700 P PP P PP PP P P Sbjct: 370 PGPPGPQMPPGPPGLPGAP 388 Score = 28.3 bits (60), Expect = 9.7 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRP 700 P PP P PP PP P P Sbjct: 455 PGPPGPQMPPGPPGLPGAP 473 Score = 28.3 bits (60), Expect = 9.7 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRP 700 P PP P PP PP P P Sbjct: 540 PGPPGPQMPPGPPGLPGAP 558 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 31.9 bits (69), Expect = 0.79 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 623 PXXFXXXPPPPXPPXPPXPPXXPXRPP 703 P PPPP P PP PP PP Sbjct: 218 PDYLEPTPPPPAAPAPPPPPAAAPPPP 244 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 614 TXIPXXFXXXPPPPXPPXPPXPPXXPXRPP 703 T P PPPP PP PP P + P Sbjct: 224 TPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 28.3 bits (60), Expect = 9.7 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 621 YLXXSSXXPPXPXXPXPPXXXXPPXAPPXSPP 716 YL + P P P PP PP PP PP Sbjct: 220 YLEPTPPPPAAPAPPPPPAAAPPP--PPPPPP 249 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 31.9 bits (69), Expect = 0.79 Identities = 26/104 (25%), Positives = 29/104 (27%), Gaps = 2/104 (1%) Frame = +3 Query: 645 PPXPXXPXPPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXPSAH--PPPXLXPXXXP 818 PP P PP APP P + S P P + PPP P Sbjct: 297 PPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPP---PSMGM 353 Query: 819 TXPPFLPXLPXPXPRPXLXXXXXXXXXXXXXXXHRPXLPXXPPP 950 PP P P P P + P PPP Sbjct: 354 APPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPP 397 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP PP RPP Sbjct: 367 PPPPVGGPPPPPPPIEGRPP 386 Score = 28.7 bits (61), Expect = 7.4 Identities = 22/77 (28%), Positives = 25/77 (32%), Gaps = 8/77 (10%) Frame = +3 Query: 633 SSXXPPXPXX---PXPPXXXXPPX----APPXSPPXXXXSLXXXXXXXKSXXPXPSAHPP 791 SS PP P P P PP APP PP + P +PP Sbjct: 334 SSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPP 393 Query: 792 PXLXPXXXPTXP-PFLP 839 P P P P +P Sbjct: 394 PPPPPGRGAPPPGPMIP 410 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 31.5 bits (68), Expect = 1.0 Identities = 24/73 (32%), Positives = 24/73 (32%) Frame = -3 Query: 865 GRGXGXGRXGRKGGXVGXXXGXRXGGGWAEGXGXXDLXXXXXXGSEXXXXGGEXGGAXGG 686 GRG G G G G G G GGG G G G GG G GG Sbjct: 273 GRGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGG---GWGRMQGGMGRGPGGGWGRMQGG 329 Query: 685 XXXXGGXGXXGXG 647 G G G G Sbjct: 330 GMGRGPGGGLGRG 342 Score = 30.3 bits (65), Expect = 2.4 Identities = 21/74 (28%), Positives = 22/74 (29%) Frame = -3 Query: 865 GRGXGXGRXGRKGGXVGXXXGXRXGGGWAEGXGXXDLXXXXXXGSEXXXXGGEXGGAXGG 686 GRG G G G G GGGW +G G G G G Sbjct: 233 GRGSGSPMWGGGMGQGPRGWGRGSGGGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSGGGW 292 Query: 685 XXXXGGXGXXGXGG 644 GG G GG Sbjct: 293 GRMQGGGMGRGPGG 306 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 31.5 bits (68), Expect = 1.0 Identities = 25/79 (31%), Positives = 25/79 (31%), Gaps = 3/79 (3%) Frame = +3 Query: 633 SSXXPPXPXXPXPP---XXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXPSAHPPPXLX 803 SS P P P PP P PP PP L P PS P Sbjct: 689 SSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGL---------PPPPPSPQPGCAGL 739 Query: 804 PXXXPTXPPFLPXLPXPXP 860 P P PP LP P P Sbjct: 740 PPPPPPPPPGCAGLPPPPP 758 Score = 31.1 bits (67), Expect = 1.4 Identities = 24/78 (30%), Positives = 26/78 (33%), Gaps = 4/78 (5%) Frame = +3 Query: 645 PPXPXXPX--PPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXPSAHPPPXLX--PXX 812 PP P P PP PP PP +L P P PPP P Sbjct: 678 PPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPM---------PPPPPPPPPGCAGLPPP 728 Query: 813 XPTXPPFLPXLPXPXPRP 866 P+ P LP P P P Sbjct: 729 PPSPQPGCAGLPPPPPPP 746 Score = 29.5 bits (63), Expect = 4.2 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 5/61 (8%) Frame = +3 Query: 699 PPXSPPXXXXSLXXXXXXXKSXXPXPSAHPPPXLX-----PXXXPTXPPFLPXLPXPXPR 863 PP PP L S P P PPP L P P PP LP P P Sbjct: 677 PPPPPP-----LPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPS 731 Query: 864 P 866 P Sbjct: 732 P 732 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 6/26 (23%) Frame = +2 Query: 644 PPPPXPPXP------PXPPXXPXRPP 703 PPPP PP P P PP P PP Sbjct: 695 PPPPPPPPPLLSGTLPMPPPPPPPPP 720 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 31.5 bits (68), Expect = 1.0 Identities = 24/71 (33%), Positives = 25/71 (35%) Frame = -3 Query: 865 GRGXGXGRXGRKGGXVGXXXGXRXGGGWAEGXGXXDLXXXXXXGSEXXXXGGEXGGAXGG 686 G G G G G G G G GGG G G G+ GG GG GG Sbjct: 48 GAGNGVGAGGC--GCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGG--GG 103 Query: 685 XXXXGGXGXXG 653 GG G G Sbjct: 104 SGGVGGNGGSG 114 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 711 GXWGGRXGXXGGXGGXGGXGGGG 643 G GG G GG G G GGGG Sbjct: 59 GCGGGNDGGNGGGGAGNGGGGGG 81 Score = 29.1 bits (62), Expect = 5.6 Identities = 19/62 (30%), Positives = 20/62 (32%) Frame = -3 Query: 829 GGXVGXXXGXRXGGGWAEGXGXXDLXXXXXXGSEXXXXGGEXGGAXGGXXXXGGXGXXGX 650 GG G GGG G G + G GG GG G GG G G Sbjct: 28 GGVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGA 87 Query: 649 GG 644 G Sbjct: 88 AG 89 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 714 GGXWGGRXGXXGGXGGXGGXGGGG 643 GG GG G G GG GG G G Sbjct: 62 GGNDGGNGGGGAGNGGGGGGAGNG 85 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 31.5 bits (68), Expect = 1.0 Identities = 12/20 (60%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +2 Query: 644 PPPPXPPXP-PXPPXXPXRP 700 PPPP PP P P PP P +P Sbjct: 424 PPPPPPPAPLPPPPPPPPQP 443 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 31.5 bits (68), Expect = 1.0 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 647 PPPXPPXPPXPPXXPXRPP 703 P P PP PP PP P PP Sbjct: 522 PAPQPPSPPAPPPKPAPPP 540 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 P PP PP PP P P R P Sbjct: 524 PQPPSPPAPPPKPAPPPRSP 543 >SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) Length = 628 Score = 31.5 bits (68), Expect = 1.0 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXR 697 PPPP PP PP PP R Sbjct: 212 PPPPPPPPPPPPPMLARR 229 Score = 31.1 bits (67), Expect = 1.4 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 644 PPPPXPPXPPXPP 682 PPPP PP PP PP Sbjct: 211 PPPPPPPPPPPPP 223 >SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2631 Score = 31.1 bits (67), Expect = 1.4 Identities = 21/72 (29%), Positives = 22/72 (30%) Frame = -3 Query: 859 GXGXGRXGRKGGXVGXXXGXRXGGGWAEGXGXXDLXXXXXXGSEXXXXGGEXGGAXGGXX 680 G G G GG G G G G + G S GG GGA GG Sbjct: 771 GAGSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGAS--GGAGGSSGGASGGAG 828 Query: 679 XXGGXGXXGXGG 644 G G G Sbjct: 829 SSSGGASGGADG 840 >SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPPXF 709 PPPP PP PP P P P + Sbjct: 143 PPPPPPPSPPPPCHPPALPSTY 164 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP P PP P P Sbjct: 142 PPPPPPPPSPPPPCHPPALP 161 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 714 GGXWGGRXGXXGGXGGXGGXGGG 646 GG GG G GG GG G GGG Sbjct: 73 GGATGGHGGATGGGGGATGDGGG 95 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 714 GGXWGGRXGXXGGXGGXGGXGGG 646 GG GG G GG GG G GGG Sbjct: 129 GGATGGHGGATGGHGGATGGGGG 151 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 714 GGXWGGRXGXXGGXGGXGGXGGG 646 GG GG G GG GG G GGG Sbjct: 136 GGATGGHGGATGGGGGATGGGGG 158 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/49 (34%), Positives = 19/49 (38%) Frame = -3 Query: 793 GGGWAEGXGXXDLXXXXXXGSEXXXXGGEXGGAXGGXXXXGGXGXXGXG 647 GGG G G G + GG+ GG GG GG G G G Sbjct: 64 GGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 31.1 bits (67), Expect = 1.4 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 644 PPPPXPPXPPXPP 682 PPPP PP PP PP Sbjct: 1455 PPPPPPPAPPCPP 1467 Score = 24.6 bits (51), Expect(2) = 4.5 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 653 PXPPXPPXPPXXP 691 P PP PP PP P Sbjct: 1455 PPPPPPPAPPCPP 1467 Score = 23.0 bits (47), Expect(2) = 4.5 Identities = 9/14 (64%), Positives = 9/14 (64%), Gaps = 2/14 (14%) Frame = +2 Query: 644 PPPPX--PPXPPXP 679 PPPP PP PP P Sbjct: 1425 PPPPMAFPPMPPAP 1438 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 31.1 bits (67), Expect = 1.4 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 644 PPPPXPPXPPXPP 682 PPPP PP PP PP Sbjct: 359 PPPPPPPPPPTPP 371 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 705 WGGRXGXXGGXGGXGGXGGGG 643 W G G GG GG G GGGG Sbjct: 221 WNGVPGGFGGGGGVWGNGGGG 241 >SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) Length = 1439 Score = 30.7 bits (66), Expect = 1.8 Identities = 20/76 (26%), Positives = 22/76 (28%) Frame = +3 Query: 633 SSXXPPXPXXPXPPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXPSAHPPPXLXPXX 812 SS P P PP AP P + S P P A PPP + Sbjct: 388 SSSGVPTPVAAPPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTPVAAPPPSVFASS 447 Query: 813 XPTXPPFLPXLPXPXP 860 P P P P Sbjct: 448 SGVPTPVTAPPPAPPP 463 Score = 28.3 bits (60), Expect = 9.7 Identities = 21/79 (26%), Positives = 24/79 (30%), Gaps = 3/79 (3%) Frame = +3 Query: 633 SSXXPPXPXXPXPPXXXX--PPXAP-PXSPPXXXXSLXXXXXXXKSXXPXPSAHPPPXLX 803 SS P P PP PP P P + P + S P P PPP + Sbjct: 327 SSTVTPPVTEPAPPSSVVAPPPAVPTPATAPPPVVAPPPSVFASSSGVPTPVKAPPPSVF 386 Query: 804 PXXXPTXPPFLPXLPXPXP 860 P P P P Sbjct: 387 ASSSGVPTPVAAPPPAPPP 405 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 723 RXXGGXWGGRXGXXGGXGGXGGXGGG 646 R GG GGR G G G GG GGG Sbjct: 115 RGGGGYGGGRGGGGYGGGRGGGYGGG 140 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -1 Query: 714 GGXWGGRXGXXGGXGGXGGXGGGG 643 GG +GG G G GG GG GGG Sbjct: 117 GGGYGGGRGGGGYGGGRGGGYGGG 140 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = -1 Query: 714 GGXWGGR-XGXXGGXGGXGGXGGG 646 GG GGR G GG G GG GGG Sbjct: 109 GGYGGGRGGGGYGGGRGGGGYGGG 132 >SB_22536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 593 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 711 GXWGGRXGXXGGXGGXGGXGGGG 643 G WGG G GG GG GGG Sbjct: 276 GGWGGGSEDNGASGGGGGYSGGG 298 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 645 PPXPXXPXPPXXXXPPXAPPXSPP 716 PP P P PP PP P +PP Sbjct: 138 PPGPETPPPPDTPAPPVPPTEAPP 161 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 623 PXXFXXXPPPPXPPXPPXPPXXPXRPP 703 P PPPP PP PP P PP Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPP 214 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP P P P PP Sbjct: 196 PPPPPPPPPGFPGGAPPPPP 215 >SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2202 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 714 GGXWGGRXGXXGGXGGXGGXGGGG 643 GG GG G GG GG G G GG Sbjct: 302 GGNAGGNGGNAGGNGGMTGGGAGG 325 >SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) Length = 293 Score = 30.7 bits (66), Expect = 1.8 Identities = 22/74 (29%), Positives = 24/74 (32%), Gaps = 1/74 (1%) Frame = +3 Query: 645 PPXPXXPXPPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXPSAHPPPXLXPXXXPTX 824 PP P P PP P A P P S P P +PP P P Sbjct: 118 PPPPYSPIPPQVPYPGAAGPPMP-----------HPTASVYPPPGGYPPTSYPPQPYPAQ 166 Query: 825 P-PFLPXLPXPXPR 863 P P P P P+ Sbjct: 167 PYPQQGYPPQPPPQ 180 Score = 29.1 bits (62), Expect = 5.6 Identities = 17/62 (27%), Positives = 19/62 (30%), Gaps = 2/62 (3%) Frame = +3 Query: 654 PXXPXPPXXXXPPXA--PPXSPPXXXXSLXXXXXXXKSXXPXPSAHPPPXLXPXXXPTXP 827 P P P PP PP S P P P A+P P P P Sbjct: 137 PPMPHPTASVYPPPGGYPPTSYPPQPYPAQPYPQQGYPPQPPPQAYPQPGYPPQGYPPTG 196 Query: 828 PF 833 P+ Sbjct: 197 PY 198 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 4/24 (16%) Frame = +2 Query: 644 PPPPXPPXPP----XPPXXPXRPP 703 PPPP PP P PP P RPP Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPP 800 Score = 28.3 bits (60), Expect = 9.7 Identities = 18/53 (33%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = +3 Query: 696 APPXSPPXXXXSLXXXXXXXKSXXPXPSAHPPPXLXPXXXPTXP--PFLPXLP 848 APP PP + S P PPP P PT P P LP +P Sbjct: 776 APPPPPPPTKPATPRVPPNIPSRPPGARPTPPP--PPPGKPTKPTKPSLPPVP 826 Score = 28.3 bits (60), Expect = 9.7 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = +2 Query: 620 IPXXFXXXPPPPXPPXPPXPPXXPXRP 700 +P PP P PP PP P +P Sbjct: 791 VPPNIPSRPPGARPTPPPPPPGKPTKP 817 Score = 28.3 bits (60), Expect = 9.7 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 647 PPPXPPXPPXPPXXPXRPP 703 PPP PP P P P PP Sbjct: 806 PPPPPPGKPTKPTKPSLPP 824 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 647 PPPXPPXPPXPPXXPXRPP 703 P P PP PP PP RPP Sbjct: 1358 PRPRPPTPPRPPTPRPRPP 1376 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 614 TXIPXXFXXXPPPPXPPXPPXPPXXPXRP 700 T P P PP PP PP P P P Sbjct: 1350 TTSPIPSTPRPRPPTPPRPPTPRPRPPTP 1378 >SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) Length = 188 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP P PP P P Sbjct: 31 PPPPSPPPSPPPPSPPLDCP 50 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP PP P PP P P Sbjct: 154 PPPPSPPPSPPPPSPPLDCP 173 >SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) Length = 340 Score = 30.3 bits (65), Expect = 2.4 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 647 PPPXPPXPPXPPXXP 691 PPP PP PP PP P Sbjct: 162 PPPQPPPPPLPPPPP 176 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = +2 Query: 611 LTXIPXXFXXXPPPPXPPXPPXPPXXPXR 697 L+ P PPPP PP PP P P + Sbjct: 368 LSSTPCAPFAPPPPPPPPPPPAPGSTPVK 396 >SB_52684| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 29.9 bits (64), Expect = 3.2 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXP 691 PP P PP PP PP P Sbjct: 139 PPQPSPPQPPQPPPQP 154 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 29.9 bits (64), Expect = 3.2 Identities = 20/60 (33%), Positives = 22/60 (36%) Frame = +3 Query: 687 PPXAPPXSPPXXXXSLXXXXXXXKSXXPXPSAHPPPXLXPXXXPTXPPFLPXLPXPXPRP 866 PP P + L + P PS PPP L P PP P LP P P P Sbjct: 423 PPAPLPKAHNEKIAPLPSLRASAATLPPLPSDEPPP-LPPDEEKPPPPPAPALP-PLPLP 480 >SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) Length = 304 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 711 GXWGGRXGXXGGXGGXGGXGGGG 643 G GGR G GG G G GGGG Sbjct: 43 GRGGGRGGPRGGGRGGGRGGGGG 65 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -3 Query: 715 GGEXGGAXGGXXXXGGXGXXGXGG 644 GG+ GG GG GG G G GG Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGG 682 >SB_5429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 29.9 bits (64), Expect = 3.2 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXP 691 PP P PP PP PP P Sbjct: 157 PPQPSPPQPPQPPPQP 172 >SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) Length = 295 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 877 TXPPXXPTPPPQXXTGXPFXPXXPP 951 T PP PT PP T P P PP Sbjct: 233 TDPPVPPTNPPVPPTNPPAPPTNPP 257 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 614 TXIPXXFXXXPPPPXPPXPPXPPXXPXRPP 703 T P PP P PP PP P PP Sbjct: 224 TQTPPTKAPTDPPVPPTNPPVPPTNPPAPP 253 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +3 Query: 756 KSXXPXPSAHPPPXLXPXXXPTXPPFLPXLPXP 854 +S P P A PPP L P PP LP P P Sbjct: 509 RSPPPPPPASPPPPL-PAEEDNSPPPLPAGPPP 540 Score = 28.3 bits (60), Expect = 9.7 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 PPPP P PP P PP Sbjct: 513 PPPPASPPPPLPAEEDNSPP 532 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/31 (45%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +3 Query: 777 SAHPPPXLXPXXXPTXPP-FLPXLPXPXPRP 866 +A PPP P PT PP LP P P+P Sbjct: 427 TATPPPTPPPTPPPTPPPTTLPPTTQPPPQP 457 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 29.5 bits (63), Expect = 4.2 Identities = 23/73 (31%), Positives = 26/73 (35%) Frame = -3 Query: 865 GRGXGXGRXGRKGGXVGXXXGXRXGGGWAEGXGXXDLXXXXXXGSEXXXXGGEXGGAXGG 686 G+G G G +GG +G GGGW G G G GG G GG Sbjct: 17 GQGPGGGWGRGQGGGMGRG----PGGGWGRGSGGG--WGRMQGGGMGRGPGGGWGRMQGG 70 Query: 685 XXXXGGXGXXGXG 647 G G G G Sbjct: 71 GMGRGPGGGLGRG 83 >SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.5 bits (63), Expect = 4.2 Identities = 20/66 (30%), Positives = 22/66 (33%), Gaps = 1/66 (1%) Frame = -3 Query: 838 GRKGGXVGXXXGXRXGGGWAEGXGXX-DLXXXXXXGSEXXXXGGEXGGAXGGXXXXGGXG 662 G GG G GGG +G G D GG+ GG G GG G Sbjct: 2 GYDGGGGDGDGGDGDGGGGGDGGGDGGDCDGDGGDCDGGDDDGGDDGGDGGVDCERGGDG 61 Query: 661 XXGXGG 644 GG Sbjct: 62 DVDGGG 67 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 3/30 (10%) Frame = +2 Query: 623 PXXFXXXPPPPXPPX---PPXPPXXPXRPP 703 P PPPP PP P PP P PP Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPPPVMPP 106 >SB_36422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Frame = +2 Query: 644 PP--PPXPPXPPXPPXXPXRPP 703 PP PP PP P PP P PP Sbjct: 29 PPEAPPLPPFAPLPPPVPPPPP 50 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 29.1 bits (62), Expect = 5.6 Identities = 20/55 (36%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Frame = -3 Query: 805 GXRXGGGWAEGXGXXDLXXXXXXGSEXXXXGGEXGGA-XGGXXXXGGXGXXGXGG 644 G GGG +G G D G+ GG+ GG GG GG G G GG Sbjct: 48 GGDGGGGGGDGDGDDD----DGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGG 98 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 29.1 bits (62), Expect = 5.6 Identities = 19/74 (25%), Positives = 22/74 (29%), Gaps = 3/74 (4%) Frame = +3 Query: 648 PXPXXPXPPXXXXPPXAPPXS---PPXXXXSLXXXXXXXKSXXPXPSAHPPPXLXPXXXP 818 P P P PP P S PP + + P P+ PP P Sbjct: 151 PLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGP 210 Query: 819 TXPPFLPXLPXPXP 860 PP P P P Sbjct: 211 PLPPSRDQAPAPPP 224 Score = 28.3 bits (60), Expect = 9.7 Identities = 19/72 (26%), Positives = 21/72 (29%) Frame = +3 Query: 645 PPXPXXPXPPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXPSAHPPPXLXPXXXPTX 824 PP P P P PP P S P+ PP P P Sbjct: 177 PPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATP---PPP 233 Query: 825 PPFLPXLPXPXP 860 PP +P P P Sbjct: 234 PPSRDQVPLPPP 245 Score = 28.3 bits (60), Expect = 9.7 Identities = 19/69 (27%), Positives = 19/69 (27%), Gaps = 4/69 (5%) Frame = +3 Query: 636 SXXPPXPXXPXPPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXPSAH----PPPXLX 803 S PP P PP PP P P PS PPP L Sbjct: 189 SSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLR 248 Query: 804 PXXXPTXPP 830 P PP Sbjct: 249 GQIAPPPPP 257 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 29.1 bits (62), Expect = 5.6 Identities = 17/49 (34%), Positives = 19/49 (38%) Frame = -3 Query: 793 GGGWAEGXGXXDLXXXXXXGSEXXXXGGEXGGAXGGXXXXGGXGXXGXG 647 GGG ++G G S GG GG GG GG G G G Sbjct: 183 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGG--GRGGGGGYGGG 229 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 29.1 bits (62), Expect = 5.6 Identities = 20/55 (36%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Frame = -3 Query: 805 GXRXGGGWAEGXGXXDLXXXXXXGSEXXXXGGEXGGA-XGGXXXXGGXGXXGXGG 644 G GGG +G G D G+ GG+ GG GG GG G G GG Sbjct: 63 GGDGGGGGGDGDGDDD----DGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGG 113 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 29.1 bits (62), Expect = 5.6 Identities = 17/49 (34%), Positives = 19/49 (38%) Frame = -3 Query: 793 GGGWAEGXGXXDLXXXXXXGSEXXXXGGEXGGAXGGXXXXGGXGXXGXG 647 GGG ++G G S GG GG GG GG G G G Sbjct: 92 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGG--GRGGGGSYGGG 138 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 768 PXPSAHPPPXLXPXXXPTXPPFLPXLPXPXPRP 866 P P PP P PT PP P P P P Sbjct: 1016 PDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPP 1048 >SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) Length = 968 Score = 28.7 bits (61), Expect = 7.4 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRP 700 PPPP P PP P P P Sbjct: 304 PPPPQTPPPPQTPAPPQTP 322 >SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 965 Score = 28.7 bits (61), Expect = 7.4 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRP 700 PPPP P PP PP P Sbjct: 464 PPPPMSPPPPTPPPPATSP 482 >SB_48061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 307 Score = 28.7 bits (61), Expect = 7.4 Identities = 17/58 (29%), Positives = 19/58 (32%) Frame = +3 Query: 633 SSXXPPXPXXPXPPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXPSAHPPPXLXP 806 +S P P P PP P PP PP L + P PPP P Sbjct: 139 TSATTPIPQIPPPPTYLHPSQYPPSPPP---WELPRVPSANATLPPHLQYGPPPPTSP 193 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 28.7 bits (61), Expect = 7.4 Identities = 18/73 (24%), Positives = 21/73 (28%), Gaps = 1/73 (1%) Frame = +3 Query: 645 PPXPXXPXPPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXPSAHPPPXLXPXXXP-T 821 PP PP PP P + P PPP + P P Sbjct: 228 PPVGMLGHPPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGG 287 Query: 822 XPPFLPXLPXPXP 860 PP + P P P Sbjct: 288 MPPNMEQPPPPPP 300 >SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) Length = 315 Score = 28.7 bits (61), Expect = 7.4 Identities = 20/83 (24%), Positives = 27/83 (32%), Gaps = 5/83 (6%) Frame = +3 Query: 633 SSXXPPXPXXPXPPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXPSAHP----PPXL 800 S+ P P PP +P P + P P P PP + Sbjct: 138 SATTKPVMTPTTPAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPI 197 Query: 801 XPXXXP-TXPPFLPXLPXPXPRP 866 P P T PP +P + P +P Sbjct: 198 PPIDPPRTQPPPIPPIDPPRTQP 220 >SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 795 Score = 28.3 bits (60), Expect = 9.7 Identities = 20/75 (26%), Positives = 21/75 (28%), Gaps = 2/75 (2%) Frame = +3 Query: 648 PXPXXPXPPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXPS--AHPPPXLXPXXXPT 821 P P P P P PP PP P P + PPP P Sbjct: 685 PPPPLPTPIASSEPLPLPPPPPPTGIDIPHSPSKDDLPLPPPPEEVSLPPPDESPPSSKH 744 Query: 822 XPPFLPXLPXPXPRP 866 P P PRP Sbjct: 745 PPTVSPSSSSAPPRP 759 >SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 28.3 bits (60), Expect = 9.7 Identities = 18/71 (25%), Positives = 21/71 (29%) Frame = +3 Query: 648 PXPXXPXPPXXXXPPXAPPXSPPXXXXSLXXXXXXXKSXXPXPSAHPPPXLXPXXXPTXP 827 P P PP PP + P S P S PS + P + P Sbjct: 942 PSMYQPQPPGIMQPPTSIPPSQPMAPPSFPPSSMGGFPPSSQPSMYNPGQVQPGYPGAMT 1001 Query: 828 PFLPXLPXPXP 860 P P P P Sbjct: 1002 PGAPSPGVPSP 1012 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 28.3 bits (60), Expect = 9.7 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXR 697 PPPP PP PP P R Sbjct: 819 PPPPPPPPPPEEPSNKSR 836 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 28.3 bits (60), Expect = 9.7 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 768 PXPSAHPPPXLXPXXXPTXPPFLPXLPXPXPRP 866 P P PP L P P PP P P P P Sbjct: 557 PPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPP 589 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 28.3 bits (60), Expect = 9.7 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +3 Query: 648 PXPXXPXPPXXXXPPXAPPXSPPXXXXSL 734 P P P PP P PP +PP S+ Sbjct: 784 PPPEYPPPPPGLARPNPPPPNPPLQVTSI 812 >SB_59124| Best HMM Match : Bac_luciferase (HMM E-Value=1.6) Length = 1953 Score = 28.3 bits (60), Expect = 9.7 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -3 Query: 238 RPTFSIFLKSFHLGSGAALTAPRASTN 158 RP+F + LKS G+GAA P TN Sbjct: 1831 RPSFKLVLKSLEEGNGAARVRPCRITN 1857 >SB_50215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 28.3 bits (60), Expect = 9.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 644 PPPPXPPXPPXP 679 PPPP PP PP P Sbjct: 79 PPPPRPPTPPPP 90 >SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1430 Score = 28.3 bits (60), Expect = 9.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 644 PPPPXPPXPPXP 679 PPPP PP PP P Sbjct: 794 PPPPPPPPPPPP 805 Score = 28.3 bits (60), Expect = 9.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 647 PPPXPPXPPXPP 682 PPP PP PP PP Sbjct: 794 PPPPPPPPPPPP 805 >SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) Length = 1706 Score = 28.3 bits (60), Expect = 9.7 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPP 703 P PP PP PP P +PP Sbjct: 1260 PLPPLPPPDAQPPSLPPQPP 1279 >SB_10368| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 413 Score = 28.3 bits (60), Expect = 9.7 Identities = 21/76 (27%), Positives = 24/76 (31%), Gaps = 2/76 (2%) Frame = +3 Query: 645 PPXPXX-PXPPXXXXPPXAP-PXSPPXXXXSLXXXXXXXKSXXPXPSAHPPPXLXPXXXP 818 PP P P P P P P P + P P+ P P + P P Sbjct: 223 PPVPAMRPLPAMRPLPAMRPLPAMRPLPAMPPLPAMRPLPAMRPLPAMRPLPAMRP--LP 280 Query: 819 TXPPFLPXLPXPXPRP 866 PP P P RP Sbjct: 281 AMPPLPAMRPLPAMRP 296 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 28.3 bits (60), Expect = 9.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 644 PPPPXPPXPPXPPXXPXRPPXF 709 PPPP PP PP P PP F Sbjct: 198 PPPPAPPGALIPP--PPAPPTF 217 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,389,015 Number of Sequences: 59808 Number of extensions: 325638 Number of successful extensions: 5846 Number of sequences better than 10.0: 101 Number of HSP's better than 10.0 without gapping: 1119 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3245 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2812459436 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -