BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_I15 (966 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve co... 23 3.6 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 22 6.2 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 22 8.2 >AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve cord defective protein protein. Length = 168 Score = 23.0 bits (47), Expect = 3.6 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +2 Query: 398 QPIESHRNTRDLRFLYPRGKLPVQRFLRLTPSQYILIW 511 Q E R R R+L + + +RLTP+Q + IW Sbjct: 51 QTYELERRFRQQRYLSAPEREHLASIIRLTPTQ-VKIW 87 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 22.2 bits (45), Expect = 6.2 Identities = 8/34 (23%), Positives = 17/34 (50%) Frame = +2 Query: 266 PILPSKIDDVQLDPNRRYVRSVTNPENNEASIEH 367 PI DD+ + + +S+TN + +++H Sbjct: 284 PIWTRNADDISQEEYGEFYKSLTNDWEDHLAVKH 317 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 21.8 bits (44), Expect = 8.2 Identities = 10/29 (34%), Positives = 12/29 (41%) Frame = +3 Query: 783 PPPXXXFXAXXXXTSXXXNPXLXPPPFFT 869 PPP A +S +P PPP T Sbjct: 11 PPPAPQSAATPISSSGMTSPAAAPPPATT 39 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,352 Number of Sequences: 336 Number of extensions: 3903 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 27306312 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -