BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_I14 (932 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 36 0.047 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 36 0.047 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 33 0.44 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.58 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.76 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 31 1.8 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 30 2.3 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 30 2.3 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 30 2.3 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 30 2.3 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.9 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 30 3.1 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_55438| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) 29 4.1 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 29 4.1 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 29 5.4 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 29 5.4 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.1 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 29 7.1 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.1 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.4 SB_5940| Best HMM Match : Antimicrobial_3 (HMM E-Value=2.4) 28 9.4 SB_59124| Best HMM Match : Bac_luciferase (HMM E-Value=1.6) 28 9.4 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 28 9.4 SB_8818| Best HMM Match : I-set (HMM E-Value=0) 28 9.4 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 28 9.4 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 35.9 bits (79), Expect = 0.047 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 PPP P P P P PPPP PP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 35.9 bits (79), Expect = 0.047 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 PPP P P P P PPPP PP P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPP 397 Score = 35.9 bits (79), Expect = 0.047 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 PPP P P P P PPPP PP P Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPP 402 Score = 35.9 bits (79), Expect = 0.047 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 PPP P P P P PPPP PP P Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPP 410 Score = 35.9 bits (79), Expect = 0.047 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 PPP P P P P PPPP PP P Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 35.9 bits (79), Expect = 0.047 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 PPP P P P P PPPP PP P Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 35.9 bits (79), Expect = 0.047 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 PPP P P P P PPPP PP P Sbjct: 385 PPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 35.9 bits (79), Expect = 0.047 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 PPP P P P P PPPP PP P Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 35.9 bits (79), Expect = 0.047 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 PPP P P P P PPPP PP P Sbjct: 390 PPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 35.9 bits (79), Expect = 0.047 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 PPP P P P P PPPP PP P Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 35.9 bits (79), Expect = 0.047 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 PPP P P P P PPPP PP P Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 35.9 bits (79), Expect = 0.047 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 PPP P P P P PPPP PP P Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 35.1 bits (77), Expect = 0.082 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPP 843 PPP P P P P PPPP PP Sbjct: 403 PPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 35.1 bits (77), Expect = 0.082 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPP 843 PPP P P P P PPPP PP Sbjct: 405 PPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 35.1 bits (77), Expect = 0.082 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPP 843 PPP P P P P PPPP PP Sbjct: 406 PPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 32.7 bits (71), Expect = 0.44 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 PPP P P P P PP P PP P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPP 399 Score = 32.7 bits (71), Expect = 0.44 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 PPP P P P PPPP PP P Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPP 403 Score = 32.7 bits (71), Expect = 0.44 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 PPP P P P P PPP PP P Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPP 404 Score = 32.7 bits (71), Expect = 0.44 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 PPP P P P P P PP PP P Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPP 406 Score = 32.7 bits (71), Expect = 0.44 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 P P P P P P PPPP PP P Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPP 408 Score = 32.7 bits (71), Expect = 0.44 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 PPP P P P PPPP PP P Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPP 411 Score = 32.7 bits (71), Expect = 0.44 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 PPP P P P PPPP PP P Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 32.7 bits (71), Expect = 0.44 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 PPP P P P PPPP PP P Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPP 414 Score = 32.7 bits (71), Expect = 0.44 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 PPP P P P PPPP PP P Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPP 415 Score = 32.7 bits (71), Expect = 0.44 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 PP P P P P PPPP PP P Sbjct: 392 PPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 32.7 bits (71), Expect = 0.44 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 PPP P P P P PPP PP P Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 32.7 bits (71), Expect = 0.44 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 PPP P P P P PP P PP P Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 32.7 bits (71), Expect = 0.44 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 PPP P P P P P PP PP P Sbjct: 399 PPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 32.7 bits (71), Expect = 0.44 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 PPP P P P P PPP PP P Sbjct: 400 PPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 29.5 bits (63), Expect = 4.1 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 P P P P P P PPPP P P Sbjct: 393 PQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 32.7 bits (71), Expect = 0.44 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 PPP P P P P P PP PP P Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSP 237 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPP-PPXXPPXXXXXP 861 PPP P P P P PP PP PP P Sbjct: 207 PPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRP 240 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 32.3 bits (70), Expect = 0.58 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 766 PPXXXPXPXXPXXXPXXXPPPPXXPP 843 PP P P P P PPPP PP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPP 1182 Score = 31.9 bits (69), Expect = 0.76 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPP 843 PPP P P P PPPP PP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPP 1183 Score = 31.9 bits (69), Expect = 0.76 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPP 843 PPP P P P PPPP PP Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 31.9 bits (69), Expect = 0.76 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPP 843 PPP P P P P PPPP P Sbjct: 1160 PPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 31.9 bits (69), Expect = 0.76 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPP 843 PPP P P P P PPPP P Sbjct: 688 PPPPPPPPPPPPPPQPSTPPPPPPSTP 714 Score = 31.9 bits (69), Expect = 0.76 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPP 843 PPP P P P PPPP PP Sbjct: 689 PPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/45 (28%), Positives = 15/45 (33%) Frame = +1 Query: 709 PXLXFXLLXXXXXXXXXXPPPXXXPXPXXPXXXPXXXPPPPXXPP 843 P + +L PPP P P P P PP PP Sbjct: 667 PSIPIQILPIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 28.3 bits (60), Expect = 9.4 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 P P P P P PPPP PP P Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPP 707 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPP 843 PPP P P P P PPP PP Sbjct: 196 PPPPPPPPPGFPGGAPPPPPPPFGAPP 222 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXP-PPPXXPP 843 PPP P P P P P PPP PP Sbjct: 104 PPPPYPPPPNPPYPPPPNAPYPPPPNPP 131 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPP-PXXPP 843 PPP P P P P PPP P PP Sbjct: 162 PPPPNPPPPNAPYPPPPYPPPPNPPYPP 189 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXP-PPPXXPP 843 PPP P P P P P PPP PP Sbjct: 167 PPPPNAPYPPPPYPPPPNPPYPPPPNPP 194 Score = 29.5 bits (63), Expect = 4.1 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 766 PPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 P P P P P PPPP PP P Sbjct: 144 PNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYP 175 Score = 29.5 bits (63), Expect = 4.1 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 766 PPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 PP P P P PPPP PP P Sbjct: 157 PPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYP 188 Score = 28.7 bits (61), Expect = 7.1 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXP 840 P P P P P P PPPP P Sbjct: 90 PNPPYPPPPYPPYPPPPPYPPPPNPP 115 Score = 28.7 bits (61), Expect = 7.1 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 PPP P P P P PP PP P Sbjct: 188 PPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNP 220 Score = 28.7 bits (61), Expect = 7.1 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXP 840 PPP P P P PPPP P Sbjct: 204 PPPPNPPYPPPPNAPNPPYPPPPNAP 229 Score = 28.3 bits (60), Expect = 9.4 Identities = 13/34 (38%), Positives = 13/34 (38%), Gaps = 1/34 (2%) Frame = +1 Query: 763 PPPXXXPXPXXPXXX-PXXXPPPPXXPPXXXXXP 861 PP P P P P PPPP PP P Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYP 117 Score = 28.3 bits (60), Expect = 9.4 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXP 840 PPP P P P P PP P P Sbjct: 95 PPPPYPPYPPPPPYPPPPNPPYPPPP 120 Score = 28.3 bits (60), Expect = 9.4 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 PPP P P P P PP PP P Sbjct: 109 PPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYP 141 Score = 28.3 bits (60), Expect = 9.4 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 PPP P P P P PP P PP P Sbjct: 133 PPPPNAPYPPSP-NAPYPPPPNPPYPPPLYPPP 164 Score = 28.3 bits (60), Expect = 9.4 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXP 840 PPP P P P P PPPP P Sbjct: 149 PPPPNPPYP-PPLYPPPPNPPPPNAP 173 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 860 GXXXXXGGXXGGGGXXXGXXXGXXGXGXXXGGG 762 G GG GGGG G G G G GGG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 164 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 860 GXXXXXGGXXGGGGXXXGXXXGXXGXGXXXGGG 762 G GG GGGG G G G G GGG Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 860 GXXXXXGGXXGGGGXXXGXXXGXXGXGXXXGGG 762 G GG GGGG G G G G GGG Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 860 GXXXXXGGXXGGGGXXXGXXXGXXGXGXXXGGG 762 G GG GGGG G G G G GGG Sbjct: 770 GGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGG 802 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 860 GXXXXXGGXXGGGGXXXGXXXGXXGXGXXXGGG 762 G GG GGGG G G G G GGG Sbjct: 789 GGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGG 821 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 860 GXXXXXGGXXGGGGXXXGXXXGXXGXGXXXGGG 762 G GG GGGG G G G G GGG Sbjct: 841 GYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGG 873 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 842 GGXXGGGGXXXGXXXGXXGXGXXXGGG 762 GG GGGG G G G G GGG Sbjct: 848 GGGGGGGGGGGGGGGGGGGGGGGGGGG 874 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 842 GGXXGGGGXXXGXXXGXXGXGXXXGGG 762 GG GGGG G G G G GGG Sbjct: 849 GGGGGGGGGGGGGGGGGGGGGGGGGGG 875 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 842 GGXXGGGGXXXGXXXGXXGXGXXXGGG 762 GG GGGG G G G G GGG Sbjct: 850 GGGGGGGGGGGGGGGGGGGGGGGGGGG 876 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 860 GXXXXXGGXXGGGGXXXGXXXGXXGXGXXXGGG 762 G GG GGGG G G G G GGG Sbjct: 65 GGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGG 97 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPP 843 PPP P P P P PPPP PP Sbjct: 225 PPPPAAPAPPPP---PAAAPPPPPPPP 248 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 860 GXXXXXGGXXGGGGXXXGXXXGXXGXGXXXGGG 762 G GG GGGG G G G G GGG Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGG 689 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 860 GXXXXXGGXXGGGGXXXGXXXGXXGXGXXXGGG 762 G GG GGGG G G G G GGG Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 691 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 860 GXXXXXGGXXGGGGXXXGXXXGXXGXGXXXGGG 762 G GG GGGG G G G G GGG Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 692 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 860 GXXXXXGGXXGGGGXXXGXXXGXXGXGXXXGGG 762 G GG GGGG G G G G GGG Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 694 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 860 GXXXXXGGXXGGGGXXXGXXXGXXGXGXXXGGG 762 G GG GGGG G G G G GGG Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 695 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 860 GXXXXXGGXXGGGGXXXGXXXGXXGXGXXXGGG 762 G GG GGGG G G G G GGG Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 696 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 860 GXXXXXGGXXGGGGXXXGXXXGXXGXGXXXGGG 762 G GG GGGG G G G G GGG Sbjct: 665 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 697 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 860 GXXXXXGGXXGGGGXXXGXXXGXXGXGXXXGGG 762 G GG GGGG G G G G GGG Sbjct: 666 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 698 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 860 GXXXXXGGXXGGGGXXXGXXXGXXGXGXXXGGG 762 G GG GGGG G G G G GGG Sbjct: 667 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 699 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 860 GXXXXXGGXXGGGGXXXGXXXGXXGXGXXXGGG 762 G GG GGGG G G G G GGG Sbjct: 668 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 700 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 860 GXXXXXGGXXGGGGXXXGXXXGXXGXGXXXGGG 762 G GG GGGG G G G G GGG Sbjct: 669 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 27.5 bits (58), Expect(2) = 2.9 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPP 843 PP P P P P PPPP PP Sbjct: 96 PPACCAPPPPPPPPPPP--PPPPPPPP 120 Score = 21.0 bits (42), Expect(2) = 2.9 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = +1 Query: 820 PPPPXXPPXXXXXP 861 PPPP PP P Sbjct: 138 PPPPPPPPPAPCMP 151 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 2/29 (6%) Frame = +1 Query: 763 PPPXXXPX--PXXPXXXPXXXPPPPXXPP 843 PPP P P P P PPPP PP Sbjct: 181 PPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXPXXXG 873 PPP P P P PPPP PP P G Sbjct: 355 PPPVGGAAPPPPPPPPVGGPPPP-PPPIEGRPPSSLG 390 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 842 GGXXGGGGXXXGXXXGXXGXGXXXGGG 762 GG GGGG G G G G GGG Sbjct: 1764 GGGMGGGGGMAGGGGGMGGGGMAAGGG 1790 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.5 bits (63), Expect = 4.1 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 PPP P P P PPPP P P Sbjct: 75 PPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPP 107 Score = 28.7 bits (61), Expect = 7.1 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 PPP P P P PPPP P P Sbjct: 66 PPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPP 98 >SB_55438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 29.5 bits (63), Expect = 4.1 Identities = 12/37 (32%), Positives = 23/37 (62%) Frame = -1 Query: 185 SSADRAESQHQREDEAQNTYKIHFTEIL*CRRIQNSN 75 + D E + + E+E +++Y+ +TEIL RR+ + N Sbjct: 341 NQVDGEEEEEEEEEEEEDSYEDEYTEILQRRRVVSFN 377 >SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) Length = 5087 Score = 29.5 bits (63), Expect = 4.1 Identities = 12/37 (32%), Positives = 23/37 (62%) Frame = -1 Query: 185 SSADRAESQHQREDEAQNTYKIHFTEIL*CRRIQNSN 75 + D E + + E+E +++Y+ +TEIL RR+ + N Sbjct: 985 NQVDGEEEEEEEEEEEEDSYEDEYTEILQRRRVVSFN 1021 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 29.5 bits (63), Expect = 4.1 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 P P P P P PPPP PP P Sbjct: 340 PTTPQPPTPTTPKTHPQLGPPPPPPPPPPTPPP 372 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 29.1 bits (62), Expect = 5.4 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXP 840 PPP P P P PPPP P Sbjct: 695 PPPPPPPPPLLSGTLPMPPPPPPPPP 720 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 29.1 bits (62), Expect = 5.4 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = -1 Query: 860 GXXXXXGGXXGGGGXXXGXXXGXXGXGXXXGGGXXXXXXXXXXSNXNXRXGTG 702 G GG GGGG G G G GGG N G G Sbjct: 31 GVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAG 83 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 29.1 bits (62), Expect = 5.4 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 PP P P P P PPPP P P Sbjct: 558 PPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPP 590 Score = 28.7 bits (61), Expect = 7.1 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 PPP P P PPPP PP P Sbjct: 557 PPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPP 589 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXPXXXG 873 PPP P P P P PPP PP P G Sbjct: 1255 PPPGMRPMPPQP---PFMPPPPRMQPPGPPGPPGPPG 1288 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 28.7 bits (61), Expect = 7.1 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPP 843 PPP P P P PPP PP Sbjct: 294 PPPADGSAPAPPPPPPPGGAPPPPPPP 320 Score = 28.7 bits (61), Expect = 7.1 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 781 PXPXXPXXXPXXXPPPPXXPPXXXXXP 861 P P P P PPPP PP P Sbjct: 305 PPPPPPGGAPPPPPPPPPPPPGDGGAP 331 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 28.7 bits (61), Expect = 7.1 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPP 843 PP P P P P PPP PP Sbjct: 359 PPTNNTPPPPPPTNKPPPPPPPTNGPP 385 Score = 28.7 bits (61), Expect = 7.1 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 PPP P P P PPPP P P Sbjct: 368 PPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPP 400 Score = 28.7 bits (61), Expect = 7.1 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 PPP P P P PPP PP P Sbjct: 374 PPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPP 406 Score = 28.7 bits (61), Expect = 7.1 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPPXXXXXP 861 PPP P P P PPPP P P Sbjct: 378 PPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 28.7 bits (61), Expect = 7.1 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPP 843 PP P P P P PPP PP Sbjct: 389 PPTNGPPPPPPPTNGPPPPPPPTNGPP 415 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 28.3 bits (60), Expect = 9.4 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 763 PPPXXXPXPXXPXXXPXXXPPPPXXPP 843 PPP P P PPPP PP Sbjct: 964 PPPGGGAPPLPPPPGGSAPPPPPPPPP 990 >SB_5940| Best HMM Match : Antimicrobial_3 (HMM E-Value=2.4) Length = 409 Score = 28.3 bits (60), Expect = 9.4 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = -1 Query: 236 VASHFLNFLEELPPGLGSSADRAESQHQREDEAQNTYKI 120 + S L+ +E+ PG+G DR + R+ EAQ ++ Sbjct: 12 IMSRILSTIEKTQPGVGVVHDRQRTHDPRDKEAQEEERV 50 >SB_59124| Best HMM Match : Bac_luciferase (HMM E-Value=1.6) Length = 1953 Score = 28.3 bits (60), Expect = 9.4 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -2 Query: 232 RPTFSIFLKSFHLGSGAALTAPRASTN 152 RP+F + LKS G+GAA P TN Sbjct: 1831 RPSFKLVLKSLEEGNGAARVRPCRITN 1857 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 28.3 bits (60), Expect = 9.4 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 842 GGXXGGGGXXXGXXXGXXGXGXXXGGGXXXXXXXXXXSNXN 720 GG GGGG G G G GGG SN N Sbjct: 99 GGFGGGGGGGFGGGGGGGGGFGGGGGGGFGSRARPASSNSN 139 >SB_8818| Best HMM Match : I-set (HMM E-Value=0) Length = 2787 Score = 28.3 bits (60), Expect = 9.4 Identities = 22/83 (26%), Positives = 41/83 (49%), Gaps = 7/83 (8%) Frame = -2 Query: 232 RPTFSIFLKSF-HLGSGA---ALTAPRASTNAKTKLKIRTKFILPKFYSAGEFKIPIQYR 65 RP +++ ++S + SG T T K+ LK++ FI P+F + P+ Y+ Sbjct: 2669 RPVYTLIIESLKYTDSGTYKCIATNEGGVTTIKSDLKVKEPFIAPEF-EGKDITAPMVYK 2727 Query: 64 STRTLRM---IKS*EFPIVSRXK 5 + +++ IKS PI++ K Sbjct: 2728 DGQDIKVSFKIKSRPKPIIAWYK 2750 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 28.3 bits (60), Expect = 9.4 Identities = 12/44 (27%), Positives = 14/44 (31%) Frame = +1 Query: 700 IPVPXLXFXLLXXXXXXXXXXPPPXXXPXPXXPXXXPXXXPPPP 831 +P P + PPP P P P PPPP Sbjct: 176 VPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,833,746 Number of Sequences: 59808 Number of extensions: 325252 Number of successful extensions: 1906 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 716 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1335 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2717121828 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -