BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_I13 (991 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ103706-1|AAZ43087.1| 344|Anopheles gambiae pk-1 receptor prot... 27 0.66 AF515521-1|AAM61888.1| 233|Anopheles gambiae glutathione S-tran... 25 4.6 >DQ103706-1|AAZ43087.1| 344|Anopheles gambiae pk-1 receptor protein. Length = 344 Score = 27.5 bits (58), Expect = 0.66 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = -2 Query: 321 WSSIPYLYAVSMCVYPASNAYMTACSVSLVT*TTFPLGR 205 WS PY++ + CV A M+A + +++T T F + R Sbjct: 107 WSKYPYVFGETFCVLRGIAAEMSA-NATVLTITAFTIER 144 >AF515521-1|AAM61888.1| 233|Anopheles gambiae glutathione S-transferase u1 protein. Length = 233 Score = 24.6 bits (51), Expect = 4.6 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = -2 Query: 720 QNLKSSVVAG*GLTRSVKPKVSPVRCR*SSGFVLG*SWRCLWIW 589 Q + AG GLT + P VS V C + GF LG + + W Sbjct: 142 QRTGTRYAAGSGLTIADFPLVSSVMCLEAIGFGLGERYPKVQAW 185 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 893,261 Number of Sequences: 2352 Number of extensions: 19782 Number of successful extensions: 41 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 563,979 effective HSP length: 65 effective length of database: 411,099 effective search space used: 108530136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -