BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_I12 (1004 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z97634-12|CAI95599.1| 195|Homo sapiens non-metastatic cells 4, ... 32 2.9 BX649186-1|CAE46204.1| 669|Homo sapiens hypothetical protein pr... 31 5.0 BC068504-1|AAH68504.1| 849|Homo sapiens diaphanous homolog 3 (D... 31 5.0 BC048963-1|AAH48963.1| 849|Homo sapiens diaphanous homolog 3 (D... 31 5.0 BC034952-1|AAH34952.1| 849|Homo sapiens diaphanous homolog 3 (D... 31 5.0 AY818645-1|AAW78862.1| 1112|Homo sapiens diaphanous-related form... 31 5.0 AY750055-1|AAW73254.1| 1152|Homo sapiens diaphanous homolog 3 pr... 31 5.0 AL390878-5|CAI14158.2| 1193|Homo sapiens diaphanous homolog 3 (D... 31 5.0 AL390878-4|CAM19740.1| 1123|Homo sapiens diaphanous homolog 3 (D... 31 5.0 AL390878-3|CAM19739.1| 1182|Homo sapiens diaphanous homolog 3 (D... 31 5.0 AL390878-2|CAM19741.1| 1147|Homo sapiens diaphanous homolog 3 (D... 31 5.0 AL390878-1|CAM19738.1| 1112|Homo sapiens diaphanous homolog 3 (D... 31 5.0 AL359266-4|CAM15405.1| 1193|Homo sapiens diaphanous homolog 3 (D... 31 5.0 AL359266-3|CAM15403.1| 1123|Homo sapiens diaphanous homolog 3 (D... 31 5.0 AL359266-2|CAM15406.1| 1182|Homo sapiens diaphanous homolog 3 (D... 31 5.0 AL359266-1|CAM15404.1| 1147|Homo sapiens diaphanous homolog 3 (D... 31 5.0 AL356502-5|CAI14102.2| 1193|Homo sapiens diaphanous homolog 3 (D... 31 5.0 AL356502-4|CAM19400.1| 1123|Homo sapiens diaphanous homolog 3 (D... 31 5.0 AL356502-3|CAM19399.1| 1182|Homo sapiens diaphanous homolog 3 (D... 31 5.0 AL356502-2|CAM19401.1| 1147|Homo sapiens diaphanous homolog 3 (D... 31 5.0 AL356502-1|CAM19398.1| 1112|Homo sapiens diaphanous homolog 3 (D... 31 5.0 AL354829-5|CAM14267.1| 1193|Homo sapiens diaphanous homolog 3 (D... 31 5.0 AL354829-4|CAM14265.1| 1123|Homo sapiens diaphanous homolog 3 (D... 31 5.0 AL354829-3|CAI39756.2| 1182|Homo sapiens diaphanous homolog 3 (D... 31 5.0 AL354829-2|CAM14266.1| 1147|Homo sapiens diaphanous homolog 3 (D... 31 5.0 AL354829-1|CAI39757.2| 1112|Homo sapiens diaphanous homolog 3 (D... 31 5.0 AK092024-1|BAC03793.1| 699|Homo sapiens protein ( Homo sapiens ... 31 5.0 AB244758-1|BAE96352.1| 1123|Homo sapiens mammalian diaphanous ho... 31 5.0 AB244756-1|BAE96350.1| 1182|Homo sapiens mammalian diaphanous ho... 31 5.0 >Z97634-12|CAI95599.1| 195|Homo sapiens non-metastatic cells 4, protein expressed in protein. Length = 195 Score = 32.3 bits (70), Expect = 2.9 Identities = 18/51 (35%), Positives = 24/51 (47%) Frame = -2 Query: 289 GPRSPGPL*RCRHECFCPFFQFS*RSSTWAREQRWSCSKPAPERRRRIGSL 137 GPR+PGP RH P R +W RE+ KP +RR +G + Sbjct: 16 GPRAPGPSLLVRHGSGLPPSALK-RGPSWTRERTLVAVKPDGVQRRLVGDV 65 >BX649186-1|CAE46204.1| 669|Homo sapiens hypothetical protein protein. Length = 669 Score = 31.5 bits (68), Expect = 5.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 803 PXXXGGXGFXXPXKTTPPPPXXXAXLXFWGPXXXXPPPP 919 P G G P PPPP + F GP PPPP Sbjct: 579 PPLPSGGGVPPPPPPPPPPPLPGMRMPFSGP--VPPPPP 615 >BC068504-1|AAH68504.1| 849|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 849 Score = 31.5 bits (68), Expect = 5.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 803 PXXXGGXGFXXPXKTTPPPPXXXAXLXFWGPXXXXPPPP 919 P G G P PPPP + F GP PPPP Sbjct: 316 PPLPSGGGVPPPPPPPPPPPLPGMRMPFSGP--VPPPPP 352 >BC048963-1|AAH48963.1| 849|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 849 Score = 31.5 bits (68), Expect = 5.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 803 PXXXGGXGFXXPXKTTPPPPXXXAXLXFWGPXXXXPPPP 919 P G G P PPPP + F GP PPPP Sbjct: 316 PPLPSGGGVPPPPPPPPPPPLPGMRMPFSGP--VPPPPP 352 >BC034952-1|AAH34952.1| 849|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 849 Score = 31.5 bits (68), Expect = 5.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 803 PXXXGGXGFXXPXKTTPPPPXXXAXLXFWGPXXXXPPPP 919 P G G P PPPP + F GP PPPP Sbjct: 316 PPLPSGGGVPPPPPPPPPPPLPGMRMPFSGP--VPPPPP 352 >AY818645-1|AAW78862.1| 1112|Homo sapiens diaphanous-related formin 3 protein. Length = 1112 Score = 31.5 bits (68), Expect = 5.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 803 PXXXGGXGFXXPXKTTPPPPXXXAXLXFWGPXXXXPPPP 919 P G G P PPPP + F GP PPPP Sbjct: 579 PPLPSGGGVPPPPPPPPPPPLPGMRMPFSGP--VPPPPP 615 >AY750055-1|AAW73254.1| 1152|Homo sapiens diaphanous homolog 3 protein. Length = 1152 Score = 31.5 bits (68), Expect = 5.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 803 PXXXGGXGFXXPXKTTPPPPXXXAXLXFWGPXXXXPPPP 919 P G G P PPPP + F GP PPPP Sbjct: 579 PPLPSGGGVPPPPPPPPPPPLPGMRMPFSGP--VPPPPP 615 >AL390878-5|CAI14158.2| 1193|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1193 Score = 31.5 bits (68), Expect = 5.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 803 PXXXGGXGFXXPXKTTPPPPXXXAXLXFWGPXXXXPPPP 919 P G G P PPPP + F GP PPPP Sbjct: 579 PPLPSGGGVPPPPPPPPPPPLPGMRMPFSGP--VPPPPP 615 >AL390878-4|CAM19740.1| 1123|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1123 Score = 31.5 bits (68), Expect = 5.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 803 PXXXGGXGFXXPXKTTPPPPXXXAXLXFWGPXXXXPPPP 919 P G G P PPPP + F GP PPPP Sbjct: 509 PPLPSGGGVPPPPPPPPPPPLPGMRMPFSGP--VPPPPP 545 >AL390878-3|CAM19739.1| 1182|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1182 Score = 31.5 bits (68), Expect = 5.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 803 PXXXGGXGFXXPXKTTPPPPXXXAXLXFWGPXXXXPPPP 919 P G G P PPPP + F GP PPPP Sbjct: 568 PPLPSGGGVPPPPPPPPPPPLPGMRMPFSGP--VPPPPP 604 >AL390878-2|CAM19741.1| 1147|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1147 Score = 31.5 bits (68), Expect = 5.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 803 PXXXGGXGFXXPXKTTPPPPXXXAXLXFWGPXXXXPPPP 919 P G G P PPPP + F GP PPPP Sbjct: 533 PPLPSGGGVPPPPPPPPPPPLPGMRMPFSGP--VPPPPP 569 >AL390878-1|CAM19738.1| 1112|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1112 Score = 31.5 bits (68), Expect = 5.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 803 PXXXGGXGFXXPXKTTPPPPXXXAXLXFWGPXXXXPPPP 919 P G G P PPPP + F GP PPPP Sbjct: 579 PPLPSGGGVPPPPPPPPPPPLPGMRMPFSGP--VPPPPP 615 >AL359266-4|CAM15405.1| 1193|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1193 Score = 31.5 bits (68), Expect = 5.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 803 PXXXGGXGFXXPXKTTPPPPXXXAXLXFWGPXXXXPPPP 919 P G G P PPPP + F GP PPPP Sbjct: 579 PPLPSGGGVPPPPPPPPPPPLPGMRMPFSGP--VPPPPP 615 >AL359266-3|CAM15403.1| 1123|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1123 Score = 31.5 bits (68), Expect = 5.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 803 PXXXGGXGFXXPXKTTPPPPXXXAXLXFWGPXXXXPPPP 919 P G G P PPPP + F GP PPPP Sbjct: 509 PPLPSGGGVPPPPPPPPPPPLPGMRMPFSGP--VPPPPP 545 >AL359266-2|CAM15406.1| 1182|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1182 Score = 31.5 bits (68), Expect = 5.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 803 PXXXGGXGFXXPXKTTPPPPXXXAXLXFWGPXXXXPPPP 919 P G G P PPPP + F GP PPPP Sbjct: 568 PPLPSGGGVPPPPPPPPPPPLPGMRMPFSGP--VPPPPP 604 >AL359266-1|CAM15404.1| 1147|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1147 Score = 31.5 bits (68), Expect = 5.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 803 PXXXGGXGFXXPXKTTPPPPXXXAXLXFWGPXXXXPPPP 919 P G G P PPPP + F GP PPPP Sbjct: 533 PPLPSGGGVPPPPPPPPPPPLPGMRMPFSGP--VPPPPP 569 >AL356502-5|CAI14102.2| 1193|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1193 Score = 31.5 bits (68), Expect = 5.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 803 PXXXGGXGFXXPXKTTPPPPXXXAXLXFWGPXXXXPPPP 919 P G G P PPPP + F GP PPPP Sbjct: 579 PPLPSGGGVPPPPPPPPPPPLPGMRMPFSGP--VPPPPP 615 >AL356502-4|CAM19400.1| 1123|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1123 Score = 31.5 bits (68), Expect = 5.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 803 PXXXGGXGFXXPXKTTPPPPXXXAXLXFWGPXXXXPPPP 919 P G G P PPPP + F GP PPPP Sbjct: 509 PPLPSGGGVPPPPPPPPPPPLPGMRMPFSGP--VPPPPP 545 >AL356502-3|CAM19399.1| 1182|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1182 Score = 31.5 bits (68), Expect = 5.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 803 PXXXGGXGFXXPXKTTPPPPXXXAXLXFWGPXXXXPPPP 919 P G G P PPPP + F GP PPPP Sbjct: 568 PPLPSGGGVPPPPPPPPPPPLPGMRMPFSGP--VPPPPP 604 >AL356502-2|CAM19401.1| 1147|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1147 Score = 31.5 bits (68), Expect = 5.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 803 PXXXGGXGFXXPXKTTPPPPXXXAXLXFWGPXXXXPPPP 919 P G G P PPPP + F GP PPPP Sbjct: 533 PPLPSGGGVPPPPPPPPPPPLPGMRMPFSGP--VPPPPP 569 >AL356502-1|CAM19398.1| 1112|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1112 Score = 31.5 bits (68), Expect = 5.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 803 PXXXGGXGFXXPXKTTPPPPXXXAXLXFWGPXXXXPPPP 919 P G G P PPPP + F GP PPPP Sbjct: 579 PPLPSGGGVPPPPPPPPPPPLPGMRMPFSGP--VPPPPP 615 >AL354829-5|CAM14267.1| 1193|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1193 Score = 31.5 bits (68), Expect = 5.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 803 PXXXGGXGFXXPXKTTPPPPXXXAXLXFWGPXXXXPPPP 919 P G G P PPPP + F GP PPPP Sbjct: 579 PPLPSGGGVPPPPPPPPPPPLPGMRMPFSGP--VPPPPP 615 >AL354829-4|CAM14265.1| 1123|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1123 Score = 31.5 bits (68), Expect = 5.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 803 PXXXGGXGFXXPXKTTPPPPXXXAXLXFWGPXXXXPPPP 919 P G G P PPPP + F GP PPPP Sbjct: 509 PPLPSGGGVPPPPPPPPPPPLPGMRMPFSGP--VPPPPP 545 >AL354829-3|CAI39756.2| 1182|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1182 Score = 31.5 bits (68), Expect = 5.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 803 PXXXGGXGFXXPXKTTPPPPXXXAXLXFWGPXXXXPPPP 919 P G G P PPPP + F GP PPPP Sbjct: 568 PPLPSGGGVPPPPPPPPPPPLPGMRMPFSGP--VPPPPP 604 >AL354829-2|CAM14266.1| 1147|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1147 Score = 31.5 bits (68), Expect = 5.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 803 PXXXGGXGFXXPXKTTPPPPXXXAXLXFWGPXXXXPPPP 919 P G G P PPPP + F GP PPPP Sbjct: 533 PPLPSGGGVPPPPPPPPPPPLPGMRMPFSGP--VPPPPP 569 >AL354829-1|CAI39757.2| 1112|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1112 Score = 31.5 bits (68), Expect = 5.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 803 PXXXGGXGFXXPXKTTPPPPXXXAXLXFWGPXXXXPPPP 919 P G G P PPPP + F GP PPPP Sbjct: 579 PPLPSGGGVPPPPPPPPPPPLPGMRMPFSGP--VPPPPP 615 >AK092024-1|BAC03793.1| 699|Homo sapiens protein ( Homo sapiens cDNA FLJ34705 fis, clone MESAN2003035, highly similar to Mus musculus diaphanous-related formin (Dia2) mRNA. ). Length = 699 Score = 31.5 bits (68), Expect = 5.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 803 PXXXGGXGFXXPXKTTPPPPXXXAXLXFWGPXXXXPPPP 919 P G G P PPPP + F GP PPPP Sbjct: 579 PPLPSGGGVLPPPPPPPPPPLPGMRMPFSGP--VPPPPP 615 >AB244758-1|BAE96352.1| 1123|Homo sapiens mammalian diaphanous homologue 2_splice_variant2 protein. Length = 1123 Score = 31.5 bits (68), Expect = 5.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 803 PXXXGGXGFXXPXKTTPPPPXXXAXLXFWGPXXXXPPPP 919 P G G P PPPP + F GP PPPP Sbjct: 509 PPLPSGGGVPPPPPPPPPPPLPGMRMPFSGP--VPPPPP 545 >AB244756-1|BAE96350.1| 1182|Homo sapiens mammalian diaphanous homologue 2 protein. Length = 1182 Score = 31.5 bits (68), Expect = 5.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 803 PXXXGGXGFXXPXKTTPPPPXXXAXLXFWGPXXXXPPPP 919 P G G P PPPP + F GP PPPP Sbjct: 568 PPLPSGGGVPPPPPPPPPPPLPGMRMPFSGP--VPPPPP 604 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 97,592,077 Number of Sequences: 237096 Number of extensions: 1790406 Number of successful extensions: 5473 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 3172 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4927 length of database: 76,859,062 effective HSP length: 91 effective length of database: 55,283,326 effective search space used: 13433848218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -