BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_I10 (918 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 22 9.0 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 9.0 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.8 bits (44), Expect = 9.0 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +3 Query: 408 STMSCVSPPRNTPXLLTEGSPQPQGPTER 494 S ++C PPR TP E + + T R Sbjct: 388 SCVACSPPPRQTPPSRKESGRRRRRRTPR 416 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.8 bits (44), Expect = 9.0 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -2 Query: 476 GLRGALSEQXRGVPRGRHAAHCRRYDAKSS 387 G R L ++ V G + H YD+KSS Sbjct: 506 GSRNPLLQEHDSVMLGEISPHHEYYDSKSS 535 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 265,282 Number of Sequences: 438 Number of extensions: 6887 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29871933 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -