BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_I09 (925 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_1170 + 34663853-34663928,34664038-34664078,34664317-346643... 30 3.0 12_01_0378 - 2946916-2947590 28 9.1 >02_05_1170 + 34663853-34663928,34664038-34664078,34664317-34664386, 34664499-34664647,34664784-34664879,34665406-34665476, 34665637-34665698,34665778-34665841,34665950-34666034, 34666129-34666255,34666381-34666454,34666539-34666599, 34666683-34666771,34666897-34667206,34667763-34667815, 34668299-34668370,34668648-34668914,34669015-34669047, 34669163-34669245,34669522-34669594,34669834-34670170, 34670302-34670633,34670816-34671135,34671261-34671612, 34671691-34671906 Length = 1170 Score = 29.9 bits (64), Expect = 3.0 Identities = 39/130 (30%), Positives = 53/130 (40%), Gaps = 23/130 (17%) Frame = +1 Query: 85 LDAPKMKPAIVILCLFVASLYAADSDVPNDILE------EQLYNSV-VVADYDSAVEKSX 243 LD P + A ++L F L++ DS P IL E NS V D A E S Sbjct: 646 LDCPLFRNARIVLDDFEVILHSPDSIAPVGILHPLKFHLEHKPNSFGTVGDSAIAQENSS 705 Query: 244 HLYE----------EKKSEVXTNVVNKLIRNNKMNCME------YAYQLWLQXLQGTSSG 375 +LYE EKK E + V N C+ ++ W+Q GTS G Sbjct: 706 YLYEVDGAIAHSDVEKKQETLSPVTTVDACTNIDLCISKTGKKLFSIGCWIQDPCGTSEG 765 Query: 376 IVSQLSSDLS 405 + + L + LS Sbjct: 766 LKTDLVAVLS 775 >12_01_0378 - 2946916-2947590 Length = 224 Score = 28.3 bits (60), Expect = 9.1 Identities = 14/47 (29%), Positives = 27/47 (57%) Frame = +1 Query: 82 GLDAPKMKPAIVILCLFVASLYAADSDVPNDILEEQLYNSVVVADYD 222 G+ ++P +++L ASL AA++ VP + ++ +VV D+D Sbjct: 87 GVHYDAIRPRLLLLLAGGASLGAANATVPGVFHQPRMSTTVVAIDFD 133 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,728,802 Number of Sequences: 37544 Number of extensions: 293018 Number of successful extensions: 680 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 673 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 680 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2635816500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -