BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_I08 (978 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 4.2 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 4.2 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 4.2 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 23 5.6 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 23.0 bits (47), Expect = 4.2 Identities = 10/22 (45%), Positives = 10/22 (45%), Gaps = 2/22 (9%) Frame = +3 Query: 759 PPXPXPXXPPXXPP--PPXXXP 818 PP P PP PP PP P Sbjct: 39 PPNPSQGPPPGGPPGAPPSQNP 60 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 23.0 bits (47), Expect = 4.2 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +3 Query: 60 SAHQVISTAPLVSQRPPLNLHKLTMNFAKIL 152 SA ++ T P PP+NL ++ ++IL Sbjct: 994 SAELIVRTEPQRPAGPPINLEARALSSSEIL 1024 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 23.0 bits (47), Expect = 4.2 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +3 Query: 60 SAHQVISTAPLVSQRPPLNLHKLTMNFAKIL 152 SA ++ T P PP+NL ++ ++IL Sbjct: 990 SAELIVRTEPQRPAGPPINLEARALSSSEIL 1020 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 22.6 bits (46), Expect = 5.6 Identities = 11/28 (39%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = +2 Query: 266 RQSGPGDRGPR-FG*SYRKMIFKTCAIN 346 R GPG +GPR F S+R C ++ Sbjct: 56 RNPGPGSKGPRDFPRSHRFKSLPRCQLS 83 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 213,348 Number of Sequences: 438 Number of extensions: 7926 Number of successful extensions: 18 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 32290713 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -