BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_I04 (889 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g02560.2 68416.m00247 40S ribosomal protein S7 (RPS7B) simila... 127 8e-30 At3g02560.1 68416.m00246 40S ribosomal protein S7 (RPS7B) simila... 127 8e-30 At5g16130.1 68418.m01884 40S ribosomal protein S7 (RPS7C) 40S ri... 123 2e-28 At1g48830.2 68414.m05465 40S ribosomal protein S7 (RPS7A) simila... 116 2e-26 At1g48830.1 68414.m05464 40S ribosomal protein S7 (RPS7A) simila... 116 2e-26 At3g19590.1 68416.m02484 WD-40 repeat family protein / mitotic c... 30 1.8 At1g49910.1 68414.m05597 WD-40 repeat family protein / mitotic c... 30 1.8 At4g08113.1 68417.m01331 myosin heavy chain-related similar to M... 28 7.2 At2g07110.1 68415.m00813 hypothetical protein 28 7.2 At1g52960.1 68414.m05990 hypothetical protein very low similarit... 28 9.5 >At3g02560.2 68416.m00247 40S ribosomal protein S7 (RPS7B) similar to ribosomal protein S7 GB:AAD26256 from [Secale cereale] Length = 191 Score = 127 bits (307), Expect = 8e-30 Identities = 65/131 (49%), Positives = 95/131 (72%), Gaps = 2/131 (1%) Frame = +3 Query: 81 KIIKASGAEADSFETSISQALVELE-TNSDLKAQLRELYITKAKEIELH-NKKSIIIYVP 254 KI K G FE ++QAL +LE TN +LK++L++LYI +A ++++ N+K+++IYVP Sbjct: 7 KIHKDKGVAPTEFEEQVTQALFDLENTNQELKSELKDLYINQAVQMDISGNRKAVVIYVP 66 Query: 255 MPKLKAFQKIQIRLVRELEKKFSGKHVVFVGDRKILPKPSHKTRVANKQKRPRSRTLTSV 434 KAF+KI +RLVRELEKKFSGK V+FV R+I+ P + V +RPR+RTLTSV Sbjct: 67 FRLRKAFRKIHLRLVRELEKKFSGKDVIFVATRRIMRPPKKGSAV----QRPRNRTLTSV 122 Query: 435 YDAILEDLVFP 467 ++A+LED+ +P Sbjct: 123 HEAMLEDVAYP 133 >At3g02560.1 68416.m00246 40S ribosomal protein S7 (RPS7B) similar to ribosomal protein S7 GB:AAD26256 from [Secale cereale] Length = 191 Score = 127 bits (307), Expect = 8e-30 Identities = 65/131 (49%), Positives = 95/131 (72%), Gaps = 2/131 (1%) Frame = +3 Query: 81 KIIKASGAEADSFETSISQALVELE-TNSDLKAQLRELYITKAKEIELH-NKKSIIIYVP 254 KI K G FE ++QAL +LE TN +LK++L++LYI +A ++++ N+K+++IYVP Sbjct: 7 KIHKDKGVAPTEFEEQVTQALFDLENTNQELKSELKDLYINQAVQMDISGNRKAVVIYVP 66 Query: 255 MPKLKAFQKIQIRLVRELEKKFSGKHVVFVGDRKILPKPSHKTRVANKQKRPRSRTLTSV 434 KAF+KI +RLVRELEKKFSGK V+FV R+I+ P + V +RPR+RTLTSV Sbjct: 67 FRLRKAFRKIHLRLVRELEKKFSGKDVIFVATRRIMRPPKKGSAV----QRPRNRTLTSV 122 Query: 435 YDAILEDLVFP 467 ++A+LED+ +P Sbjct: 123 HEAMLEDVAYP 133 >At5g16130.1 68418.m01884 40S ribosomal protein S7 (RPS7C) 40S ribosomal protein S7 homolog - Brassica oleracea, EMBL:AF144752 Length = 190 Score = 123 bits (296), Expect = 2e-28 Identities = 66/131 (50%), Positives = 92/131 (70%), Gaps = 2/131 (1%) Frame = +3 Query: 81 KIIKASGAEADSFETSISQALVELE-TNSDLKAQLRELYITKAKEIELH-NKKSIIIYVP 254 KI K AE E ++QAL +LE TN +LK++L++LYI +A +++ N+K+++IYVP Sbjct: 7 KIKKDKNAEPTECEEQVAQALFDLENTNQELKSELKDLYINQAVHMDISGNRKAVVIYVP 66 Query: 255 MPKLKAFQKIQIRLVRELEKKFSGKHVVFVGDRKILPKPSHKTRVANKQKRPRSRTLTSV 434 KAF+KI RLVRELEKKFSGK V+FV R+I+ P V +RPR+RTLTSV Sbjct: 67 FRLRKAFRKIHPRLVRELEKKFSGKDVIFVTTRRIMRPPKKGAAV----QRPRNRTLTSV 122 Query: 435 YDAILEDLVFP 467 ++A+LED+ FP Sbjct: 123 HEAMLEDVAFP 133 >At1g48830.2 68414.m05465 40S ribosomal protein S7 (RPS7A) similar to 40S ribosomal protein S7 homolog GI:5532505 from [Brassica oleracea] Length = 191 Score = 116 bits (280), Expect = 2e-26 Identities = 60/131 (45%), Positives = 91/131 (69%), Gaps = 2/131 (1%) Frame = +3 Query: 81 KIIKASGAEADSFETSISQALVELE-TNSDLKAQLRELYITKAKEIELHN-KKSIIIYVP 254 KI K G E + ++QA +LE TN +LK++L++LY+ A ++++ +K+I++ VP Sbjct: 7 KIHKEKGVELSELDEQVAQAFFDLENTNQELKSELKDLYVNSAVQVDISGGRKAIVVNVP 66 Query: 255 MPKLKAFQKIQIRLVRELEKKFSGKHVVFVGDRKILPKPSHKTRVANKQKRPRSRTLTSV 434 KA++KI +RLVRELEKKFSGK V+ + R+I+ +P K A KRPR+RTLTSV Sbjct: 67 YRLRKAYRKIHVRLVRELEKKFSGKDVILIATRRIV-RPPKKGSAA---KRPRNRTLTSV 122 Query: 435 YDAILEDLVFP 467 ++AIL+D+V P Sbjct: 123 HEAILDDVVLP 133 >At1g48830.1 68414.m05464 40S ribosomal protein S7 (RPS7A) similar to 40S ribosomal protein S7 homolog GI:5532505 from [Brassica oleracea] Length = 191 Score = 116 bits (280), Expect = 2e-26 Identities = 60/131 (45%), Positives = 91/131 (69%), Gaps = 2/131 (1%) Frame = +3 Query: 81 KIIKASGAEADSFETSISQALVELE-TNSDLKAQLRELYITKAKEIELHN-KKSIIIYVP 254 KI K G E + ++QA +LE TN +LK++L++LY+ A ++++ +K+I++ VP Sbjct: 7 KIHKEKGVELSELDEQVAQAFFDLENTNQELKSELKDLYVNSAVQVDISGGRKAIVVNVP 66 Query: 255 MPKLKAFQKIQIRLVRELEKKFSGKHVVFVGDRKILPKPSHKTRVANKQKRPRSRTLTSV 434 KA++KI +RLVRELEKKFSGK V+ + R+I+ +P K A KRPR+RTLTSV Sbjct: 67 YRLRKAYRKIHVRLVRELEKKFSGKDVILIATRRIV-RPPKKGSAA---KRPRNRTLTSV 122 Query: 435 YDAILEDLVFP 467 ++AIL+D+V P Sbjct: 123 HEAILDDVVLP 133 >At3g19590.1 68416.m02484 WD-40 repeat family protein / mitotic checkpoint protein, putative contains 5 WD-40 repeats (PF00400) (1 weak); similar to testis mitotic checkpoint protein BUB3 (GB:AAC28439,SP|O43684)[Homo sapiens] Length = 340 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +2 Query: 395 QTKEATLKDIDLCVRCYPRGLG 460 Q +E++LK CVRCYP G G Sbjct: 179 QRRESSLKYQTRCVRCYPNGTG 200 >At1g49910.1 68414.m05597 WD-40 repeat family protein / mitotic checkpoint protein, putative contains 5 WD-40 repeats (PF00400) (1 weak); similar to testis mitotic checkpoint protein BUB3 (GB:AAC28439,SP:O43684)[Homo sapiens] Length = 339 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +2 Query: 395 QTKEATLKDIDLCVRCYPRGLG 460 Q +E++LK CVRCYP G G Sbjct: 178 QRRESSLKYQTRCVRCYPNGTG 199 >At4g08113.1 68417.m01331 myosin heavy chain-related similar to Myosin heavy chain, skeletal muscle, extraocular (MyHC-eo) (SP:Q9UKX3) {Homo sapiens} Length = 764 Score = 28.3 bits (60), Expect = 7.2 Identities = 23/93 (24%), Positives = 38/93 (40%), Gaps = 3/93 (3%) Frame = +3 Query: 57 RKVVKMSTKIIKASGAEADSFETSISQALVELETNSDLKAQLRELYITKAKEI---ELHN 227 + +++ T +KA SF+ I + +EL T+ DL+ E EI EL Sbjct: 547 KALIRELTSSVKAGQDRKVSFQAEIERLKMELSTSKDLEKGFAEKIGFMEMEIRGEELSK 606 Query: 228 KKSIIIYVPMPKLKAFQKIQIRLVRELEKKFSG 326 K + V + KA ++ L K +G Sbjct: 607 KVVDLTSVAQGEKKAVHDAKVELAAAYSKLLAG 639 >At2g07110.1 68415.m00813 hypothetical protein Length = 150 Score = 28.3 bits (60), Expect = 7.2 Identities = 22/67 (32%), Positives = 33/67 (49%) Frame = -1 Query: 487 ACLRSQXGKTKSSRIASYTEVNVLERGLFCLLATRVLWLGLGRILRSPTKTTCLPLNFFS 308 ACL+S G K R+ + ERGLFC L R + IL+ ++ C+ L Sbjct: 47 ACLKSY-GSLKPDRLVIVNAFSFSERGLFCRL--RKVEKEYETILKRTLQSICV-LRVVP 102 Query: 307 SSRTSLI 287 ++ TS+I Sbjct: 103 NTTTSVI 109 >At1g52960.1 68414.m05990 hypothetical protein very low similarity to SP|Q9UUA2 DNA repair and recombination protein pif1, mitochondrial precursor {Schizosaccharomyces pombe} Length = 996 Score = 27.9 bits (59), Expect = 9.5 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 8/58 (13%) Frame = +3 Query: 216 ELHNKKSIIIY--VPMPKLKAFQKIQIRLVREL-----EKKFSGKHVVFVGD-RKILP 365 EL + ++II+ PM F+ + R +R++ +K F GK +VF GD R++LP Sbjct: 640 ELVKEANLIIWDETPMMSKHCFESLD-RTLRDIMNNPGDKPFGGKGIVFGGDFRQVLP 696 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,499,632 Number of Sequences: 28952 Number of extensions: 257853 Number of successful extensions: 699 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 685 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 693 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2081245872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -