BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_I02 (1307 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 52 8e-07 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 51 1e-06 At1g61080.1 68414.m06877 proline-rich family protein 46 4e-05 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 44 2e-04 At3g15000.1 68416.m01897 expressed protein similar to DAG protei... 42 9e-04 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 42 9e-04 At1g31750.1 68414.m03895 proline-rich family protein contains pr... 42 9e-04 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 42 0.001 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 41 0.002 At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family... 40 0.004 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 40 0.005 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 40 0.005 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 38 0.011 At1g15830.1 68414.m01900 expressed protein 38 0.015 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 38 0.019 At2g43150.1 68415.m05358 proline-rich extensin-like family prote... 38 0.019 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 38 0.019 At3g06130.1 68416.m00704 heavy-metal-associated domain-containin... 37 0.025 At1g24490.1 68414.m03084 60 kDa inner membrane family protein si... 37 0.025 At1g10620.1 68414.m01204 protein kinase family protein contains ... 37 0.025 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 37 0.034 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 36 0.044 At5g45350.1 68418.m05567 proline-rich family protein contains pr... 36 0.044 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 36 0.044 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 36 0.044 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 36 0.059 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 36 0.059 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 36 0.059 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 36 0.078 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 36 0.078 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 36 0.078 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 36 0.078 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 36 0.078 At1g29380.1 68414.m03592 hypothetical protein 36 0.078 At1g26150.1 68414.m03192 protein kinase family protein similar t... 36 0.078 At4g20020.2 68417.m02930 expressed protein 35 0.10 At4g20020.1 68417.m02931 expressed protein 35 0.10 At3g06750.1 68416.m00800 hydroxyproline-rich glycoprotein family... 35 0.10 At2g04170.1 68415.m00402 meprin and TRAF homology domain-contain... 35 0.10 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 35 0.10 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 35 0.14 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 35 0.14 At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibri... 35 0.14 At2g30560.1 68415.m03722 glycine-rich protein 35 0.14 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 35 0.14 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 35 0.14 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 34 0.18 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 34 0.18 At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; g... 34 0.18 At4g18570.1 68417.m02749 proline-rich family protein common fami... 34 0.18 At3g44340.1 68416.m04764 sec23/sec24 transport family protein co... 34 0.18 At5g46730.1 68418.m05757 glycine-rich protein 34 0.24 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 34 0.24 At4g01985.1 68417.m00265 expressed protein 34 0.24 At3g50180.1 68416.m05486 hypothetical protein 34 0.24 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 34 0.24 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 34 0.24 At5g38560.1 68418.m04662 protein kinase family protein contains ... 33 0.31 At5g19090.1 68418.m02269 heavy-metal-associated domain-containin... 33 0.31 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 33 0.31 At1g79480.1 68414.m09263 hypothetical protein low similarity to ... 33 0.31 At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identica... 33 0.31 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 33 0.41 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 33 0.41 At3g10300.3 68416.m01236 calcium-binding EF hand family protein ... 33 0.41 At3g10300.2 68416.m01235 calcium-binding EF hand family protein ... 33 0.41 At3g10300.1 68416.m01234 calcium-binding EF hand family protein ... 33 0.41 At5g62210.1 68418.m07811 embryo-specific protein-related contain... 33 0.55 At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protei... 33 0.55 At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protei... 33 0.55 At4g34440.1 68417.m04894 protein kinase family protein contains ... 33 0.55 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 33 0.55 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 33 0.55 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 33 0.55 At5g59170.1 68418.m07416 proline-rich family protein contains pr... 32 0.72 At5g07510.1 68418.m00860 glycine-rich protein (GRP14) oleosin; g... 32 0.72 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 32 0.72 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 32 0.72 At1g76930.2 68414.m08956 proline-rich extensin-like family prote... 32 0.72 At1g76930.1 68414.m08955 proline-rich extensin-like family prote... 32 0.72 At1g75550.1 68414.m08780 glycine-rich protein 32 0.72 At1g27710.1 68414.m03387 glycine-rich protein 32 0.72 At1g26240.1 68414.m03201 proline-rich extensin-like family prote... 32 0.72 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 32 0.72 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 32 0.96 At4g38770.1 68417.m05490 proline-rich family protein (PRP4) simi... 32 0.96 At3g08530.1 68416.m00990 clathrin heavy chain, putative similar ... 32 0.96 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 32 0.96 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 32 0.96 At1g02710.1 68414.m00222 glycine-rich protein 32 0.96 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 31 1.3 At4g03120.1 68417.m00425 proline-rich family protein similar to ... 31 1.3 At3g51290.1 68416.m05614 proline-rich family protein 31 1.3 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 31 1.3 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 31 1.7 At4g32640.1 68417.m04646 sec23/sec24 transport protein-related 31 1.7 At4g30460.1 68417.m04325 glycine-rich protein 31 1.7 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 31 1.7 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 31 1.7 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 31 1.7 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 31 1.7 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 31 1.7 At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp... 31 1.7 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 31 2.2 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 31 2.2 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 31 2.2 At5g08230.1 68418.m00965 PWWP domain-containing protein putative... 31 2.2 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 31 2.2 At5g04170.1 68418.m00405 calcium-binding EF hand family protein ... 31 2.2 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 31 2.2 At4g13390.1 68417.m02092 proline-rich extensin-like family prote... 31 2.2 At3g13225.1 68416.m01660 WW domain-containing protein contains P... 31 2.2 At3g11130.1 68416.m01349 clathrin heavy chain, putative similar ... 31 2.2 At3g07540.1 68416.m00900 formin homology 2 domain-containing pro... 31 2.2 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 31 2.2 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 31 2.2 At5g19090.2 68418.m02270 heavy-metal-associated domain-containin... 30 2.9 At3g49840.1 68416.m05449 proline-rich family protein contains pr... 30 2.9 At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 30 2.9 At2g16630.1 68415.m01909 proline-rich family protein contains pr... 30 2.9 At1g70990.1 68414.m08190 proline-rich family protein 30 2.9 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 30 3.9 At4g28300.2 68417.m04053 hydroxyproline-rich glycoprotein family... 30 3.9 At4g28300.1 68417.m04052 hydroxyproline-rich glycoprotein family... 30 3.9 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 30 3.9 At2g18470.1 68415.m02151 protein kinase family protein contains ... 30 3.9 At1g22610.1 68414.m02823 C2 domain-containing protein contains I... 30 3.9 At1g12810.1 68414.m01488 proline-rich family protein contains pr... 30 3.9 At1g11850.2 68414.m01364 expressed protein 30 3.9 At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family... 30 3.9 At4g08380.1 68417.m01384 proline-rich extensin-like family prote... 29 5.1 At3g50140.1 68416.m05481 expressed protein contains Pfam profile... 29 5.1 At4g23470.2 68417.m03383 hydroxyproline-rich glycoprotein family... 29 6.7 At4g23470.1 68417.m03382 hydroxyproline-rich glycoprotein family... 29 6.7 At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containi... 29 6.7 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 29 6.7 At3g57670.1 68416.m06425 zinc finger (C2H2 type) protein (WIP2) ... 29 6.7 At3g18810.1 68416.m02389 protein kinase family protein contains ... 29 6.7 At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar... 29 6.7 At1g27750.1 68414.m03391 ubiquitin system component Cue domain-c... 29 6.7 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 29 6.7 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 29 6.7 At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp... 29 6.7 At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family... 29 8.9 At5g10270.1 68418.m01192 cyclin-dependent kinase, putative / CDK... 29 8.9 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 29 8.9 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 29 8.9 At4g08370.1 68417.m01382 proline-rich extensin-like family prote... 29 8.9 At3g07100.1 68416.m00845 protein transport protein Sec24, putati... 29 8.9 At2g05440.2 68415.m00575 glycine-rich protein 29 8.9 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 29 8.9 At1g76500.1 68414.m08901 DNA-binding family protein contains Pfa... 29 8.9 At1g23050.1 68414.m02880 hydroxyproline-rich glycoprotein family... 29 8.9 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 52.0 bits (119), Expect = 8e-07 Identities = 39/147 (26%), Positives = 43/147 (29%) Frame = +3 Query: 849 PXPRGXXPPXEGGXHRAPPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFXXGGXRP 1028 P P PP PP P PPP P + P Sbjct: 403 PPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPV------YSPPPPPP 456 Query: 1029 PPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFLP 1208 PP P PP PP PPP + P + PP P SPP PPV P Sbjct: 457 PPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPP---PPPPPPPPPVYSPP 513 Query: 1209 XGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 + P P P PP P Sbjct: 514 PPPVYSSPPPPPSPAPTPVYCTRPPPP 540 Score = 43.6 bits (98), Expect = 3e-04 Identities = 37/147 (25%), Positives = 42/147 (28%) Frame = +3 Query: 843 FSPXPRGXXPPXEGGXHRAPPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFXXGGX 1022 +SP P PP + PP P P PPP P + Sbjct: 436 YSPPPPPPPPPP---VYSPPPPPPPPPPPPVYSPPPPPPPPPPPP-------PVYSPPPP 485 Query: 1023 RPPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXF 1202 PPP P PP PP PPP + P + P SP PP Sbjct: 486 SPPPPPPPVYSPPPPPP-PPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHS 544 Query: 1203 LPXGGXGAXXPXPGXGGXXPPXRXXPP 1283 P P P PP PP Sbjct: 545 PPPPQFSPPPPEPYYYSSPPPPHSSPP 571 Score = 43.2 bits (97), Expect = 4e-04 Identities = 43/163 (26%), Positives = 50/163 (30%), Gaps = 14/163 (8%) Frame = +3 Query: 843 FSPXPRGXXPPXEGGXHRAPPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFXXGGX 1022 +SP P PP + PP + P P PPP P + Sbjct: 464 YSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVY---SS 520 Query: 1023 RPPPXXP-----XXXXPPXPPXGXPPPXXXFFSXPXALP----PXKXPXXSPPXGGGGXX 1175 PPP P PP PP PPP FS P P P SPP Sbjct: 521 PPPPPSPAPTPVYCTRPPPPPPHSPPPPQ--FSPPPPEPYYYSSPPPPHSSPPPHSPPPP 578 Query: 1176 SXKNPPV-XFL----PXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 PP+ +L P + P P PP PP P Sbjct: 579 HSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPP 621 Score = 40.7 bits (91), Expect = 0.002 Identities = 32/118 (27%), Positives = 36/118 (30%) Frame = +3 Query: 849 PXPRGXXPPXEGGXHRAPPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFXXGGXRP 1028 P P+ PP E + +PP P P PPP P Sbjct: 546 PPPQFSPPPPEPYYYSSPP----PPHSSPPPHSP-PPPHSPPPPIYPYLSPPPPPTPVSS 600 Query: 1029 PPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXF 1202 PP P PP PP PPP PP SPP S PPV + Sbjct: 601 PPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYY 658 Score = 39.1 bits (87), Expect = 0.006 Identities = 26/91 (28%), Positives = 27/91 (29%) Frame = +3 Query: 1017 GXRPPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPV 1196 G P P P P PPP FS P L P PP PPV Sbjct: 389 GRSVSPRPPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPV 448 Query: 1197 XFLPXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 + P P P PP PP P Sbjct: 449 -YSPPPPPPPPPPPPVYSPPPPPPPPPPPPP 478 Score = 35.9 bits (79), Expect = 0.059 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP P PPP P P P PPP Sbjct: 592 PPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPP 634 Score = 34.7 bits (76), Expect = 0.14 Identities = 20/68 (29%), Positives = 22/68 (32%), Gaps = 2/68 (2%) Frame = +1 Query: 958 PPXXPPXXXXXXFGXFXLXGGXAPPPXXXXXXPPPXPP--XGXPPPXXXFFPXPXXXPRX 1131 PP PP + PPP PPP PP PPP + P P Sbjct: 629 PPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVH 688 Query: 1132 KXPXXPPP 1155 PPP Sbjct: 689 YSSPPPPP 696 Score = 34.3 bits (75), Expect = 0.18 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP P PPP P P R P PPP Sbjct: 503 PPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTR---PPPPPP 542 Score = 34.3 bits (75), Expect = 0.18 Identities = 19/67 (28%), Positives = 21/67 (31%), Gaps = 1/67 (1%) Frame = +1 Query: 958 PPXXPPXXXXXXFGXFXLXGGXAPPPXXXXXXPPPXPPX-GXPPPXXXFFPXPXXXPRXK 1134 PP PP PPP PPP P PPP ++ P P Sbjct: 609 PPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPPVH 668 Query: 1135 XPXXPPP 1155 PPP Sbjct: 669 YSSPPPP 675 Score = 33.9 bits (74), Expect = 0.24 Identities = 26/98 (26%), Positives = 28/98 (28%) Frame = +1 Query: 997 GXFXLXGGXAPPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPPGXGGGXX 1176 G F +P P PPP P PPP F P P PPP Sbjct: 384 GSFSCGRSVSPRPPVVTPLPPPSLP--SPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPP 441 Query: 1177 XSKTXPXFSSXGGGXXXXXPXRGXVGXAPPXGXXPPXP 1290 P +S P V PP PP P Sbjct: 442 PPPPPPVYSPP---PPPPPPPPPPVYSPPPPPPPPPPP 476 Score = 32.3 bits (70), Expect = 0.72 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 664 PPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEESPPP 706 Score = 31.1 bits (67), Expect = 1.7 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP P P P PPP Sbjct: 505 PPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPP 547 Score = 30.7 bits (66), Expect = 2.2 Identities = 26/86 (30%), Positives = 27/86 (31%), Gaps = 6/86 (6%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPX---GXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPV 1196 PPP P P PP PPP +S P PP SPP S P V Sbjct: 661 PPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPP-PPSAPCEESPPPAPVVHHSPPPPMV 719 Query: 1197 XFLPXG---GXGAXXPXPGXGGXXPP 1265 P P P G PP Sbjct: 720 HHSPPPPVIHQSPPPPSPEYEGPLPP 745 Score = 29.5 bits (63), Expect = 5.1 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +2 Query: 1136 PPXXPPXGXGGGGLXQKPXRXFPPXGGGGXXPPPXGGGWXXPPPAXXAPPPP 1291 PP P L P PP PPP PPP PPPP Sbjct: 410 PPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPP 461 Score = 29.5 bits (63), Expect = 5.1 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +2 Query: 1124 PXXXPPXXPPXGXGGGGLXQKPXRXFPPXGGGGXXPPPXGGGWXXPPPAXXAPPPP 1291 P PP PP P PP PPP PPP PPPP Sbjct: 447 PVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPP-PPPPPVYSPPPPP 501 Score = 29.1 bits (62), Expect = 6.7 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 1202 PPXGGGGXXPPPXGGGWXXPPPAXXAPPPP 1291 PP PPP + PPP PPPP Sbjct: 433 PPVYSPPPPPPPPPPVYSPPPPPPPPPPPP 462 Score = 28.7 bits (61), Expect = 8.9 Identities = 18/58 (31%), Positives = 19/58 (32%), Gaps = 2/58 (3%) Frame = +2 Query: 1124 PXXXPPXXPPXGXGGGGLXQKPXRXFPPXGGGGXX--PPPXGGGWXXPPPAXXAPPPP 1291 P PP PP P PP PPP + PPP PPPP Sbjct: 451 PPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPP 508 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 51.2 bits (117), Expect = 1e-06 Identities = 23/51 (45%), Positives = 23/51 (45%) Frame = +2 Query: 1139 PXXPPXGXGGGGLXQKPXRXFPPXGGGGXXPPPXGGGWXXPPPAXXAPPPP 1291 P PP GGG P P GGG PPP GG PPP PPPP Sbjct: 652 PRPPPRSAGGGKSTNLPSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPPP 702 Score = 43.6 bits (98), Expect = 3e-04 Identities = 22/48 (45%), Positives = 22/48 (45%) Frame = -3 Query: 1266 GGGXXHPPPXGGGXXPPPPXGGKXRXGF*XXPPPPXPXGGXXGGFXXG 1123 GGG PPP GG PPPP GG PPPP P G G G Sbjct: 676 GGGPPPPPPPPGGGPPPPPGGG--------PPPPPPPPGALGRGAGGG 715 Score = 39.5 bits (88), Expect = 0.005 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = -3 Query: 1299 PXXGGGGAXXAGGGXXHPPPXGGGXXPPPPXGGKXRXGF*XXPPPPXPXGGXXG 1138 P GGG P P GG PPPP GG PPPP P G G Sbjct: 656 PRSAGGGKSTNLPSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPPPGALG 709 Score = 37.5 bits (83), Expect = 0.019 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 1014 GGXRPPPXXPXXXXPPXPPXGXPPP 1088 GG PPP P PP PP G PPP Sbjct: 676 GGGPPPPPPPPGGGPPPPPGGGPPP 700 Score = 35.5 bits (78), Expect = 0.078 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 1009 LXGGXAPPPXXXXXXPPPXPPXGXPPP 1089 L GG PPP PP PP G PPP Sbjct: 674 LPGGGPPPPPPPPGGGPPPPPGGGPPP 700 Score = 34.7 bits (76), Expect = 0.14 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPPGXGGG 1170 PP PPP PP G PPP P P P P G GGG Sbjct: 672 PPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPP----PGALGRGAGGG 715 Score = 34.3 bits (75), Expect = 0.18 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 1015 GGXAPPPXXXXXXPPPXPPXGXPPP 1089 GG PPP PPP P G PPP Sbjct: 677 GGPPPPPPPPGGGPPPPPGGGPPPP 701 Score = 33.9 bits (74), Expect = 0.24 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 1014 GGXRPPPXXPXXXXPPXPPXGXPPP 1088 GG PPP P PP P G PPP Sbjct: 677 GGPPPPPPPPGGGPPPPPGGGPPPP 701 Score = 30.7 bits (66), Expect = 2.2 Identities = 19/57 (33%), Positives = 20/57 (35%) Frame = +3 Query: 1023 RPPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPP 1193 RPP PP PP G PPP P PP P + G GG P Sbjct: 671 RPPLPGGGPPPPPPPPGGGPPPPPG--GGP---PPPPPPPGALGRGAGGGNKVHRAP 722 Score = 29.5 bits (63), Expect = 5.1 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPP--XGXPPPXXXFFPXPXXXP 1125 A PP PPP PP G PPP P P P Sbjct: 670 ARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPPP 705 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 46.4 bits (105), Expect = 4e-05 Identities = 42/153 (27%), Positives = 46/153 (30%), Gaps = 1/153 (0%) Frame = +3 Query: 834 LXXFSPXPRGXXPPXEGGX-HRAPPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFX 1010 L F+P P PP H APP P G P PPP P Sbjct: 469 LKHFAPPPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPPLPTTI-------- 520 Query: 1011 XGGXRPPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNP 1190 PPP P P PP PPP P PP PP +P Sbjct: 521 -AAPPPPPPPPRAAVAPPPPP--PPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSP 577 Query: 1191 PVXFLPXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 P +P G G+ P P PP P Sbjct: 578 PP--MPMGNSGSGGPPPPPPPMPLANGATPPPP 608 Score = 38.7 bits (86), Expect = 0.008 Identities = 26/89 (29%), Positives = 28/89 (31%), Gaps = 3/89 (3%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXP---RXKXPXXPPPGXGGGXXXSKTXPX 1197 PPP PP PP PPP P P P + P PPP P Sbjct: 526 PPPPPRAAVAPPPPP---PPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPM 582 Query: 1198 FSSXGGGXXXXXPXRGXVGXAPPXGXXPP 1284 +S GG P A P PP Sbjct: 583 GNSGSGGPPPPPPPMPLANGATPPPPPPP 611 Score = 35.1 bits (77), Expect = 0.10 Identities = 26/91 (28%), Positives = 27/91 (29%), Gaps = 3/91 (3%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXG---XPPPXXXFFPXPXXXPRXKXPXXPPPGXGGGXXXSKTXPX 1197 PPP PPP PP G PPP P P R P P G G P Sbjct: 541 PPPGTAAAPPPPPPPPGTQAAPPPP----PPPPMQNRAPSPPPMPMGNSGSGGPPPPPPP 596 Query: 1198 FSSXGGGXXXXXPXRGXVGXAPPXGXXPPXP 1290 G P + G PP P Sbjct: 597 MPLANGATPPPPPPPMAMANG-AAGPPPPPP 626 Score = 33.1 bits (72), Expect = 0.41 Identities = 27/101 (26%), Positives = 29/101 (28%), Gaps = 1/101 (0%) Frame = +3 Query: 870 PPXEGGXHRAPPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXX-WXXFXXGGXRPPPXXPX 1046 PP G APP P + P PPP GG PPP Sbjct: 539 PPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMP 598 Query: 1047 XXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGG 1169 PP PPP + A PP P G G Sbjct: 599 LANGATPP---PPPPPMAMANGAAGPPPPPPRMGMANGAAG 636 Score = 31.1 bits (67), Expect = 1.7 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 3/52 (5%) Frame = -3 Query: 1281 GAXXAGGGXXHPPPX---GGGXXPPPPXGGKXRXGF*XXPPPPXPXGGXXGG 1135 G +GG PPP G PPPP G PPPP P G G Sbjct: 583 GNSGSGGPPPPPPPMPLANGATPPPPPPPMAMANGA-AGPPPPPPRMGMANG 633 Score = 29.9 bits (64), Expect = 3.9 Identities = 21/80 (26%), Positives = 22/80 (27%), Gaps = 2/80 (2%) Frame = +3 Query: 1056 PPXPPXGXPPPXXXF--FSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFLPXGGXGAX 1229 PP PP PPP S P PP P PP +P Sbjct: 416 PPPPPPPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPP 475 Query: 1230 XPXPGXGGXXPPXRXXPPXP 1289 P P P PP P Sbjct: 476 PPPPLPPAVMPLKHFAPPPP 495 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 44.0 bits (99), Expect = 2e-04 Identities = 41/151 (27%), Positives = 46/151 (30%), Gaps = 4/151 (2%) Frame = +3 Query: 849 PXPRGXXPPXEGGXHRAPPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFXXGGXRP 1028 P P PP H PP P P PPP P Sbjct: 527 PPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSP----------P 576 Query: 1029 PPXX--PXXXXPPXPPXGXPPPXXXFFSXPXAL--PPXKXPXXSPPXGGGGXXSXKNPPV 1196 PP P P PP PPP S P + PP P SPP ++PPV Sbjct: 577 PPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPV 636 Query: 1197 XFLPXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 + P P P PP + PP P Sbjct: 637 VYSP-------PPRPPKIN-SPPVQSPPPAP 659 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 +PPP PPP PP PPP P P P PPP Sbjct: 549 SPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPP 592 Score = 35.9 bits (79), Expect = 0.059 Identities = 25/92 (27%), Positives = 26/92 (28%), Gaps = 3/92 (3%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXP---XXPPPGXGGGXXXSKTXP 1194 +PPP PPP P PPP P P P P PPP P Sbjct: 525 SPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPP 584 Query: 1195 XFSSXGGGXXXXXPXRGXVGXAPPXGXXPPXP 1290 S P PP PP P Sbjct: 585 PVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPP 616 Score = 35.5 bits (78), Expect = 0.078 Identities = 28/88 (31%), Positives = 29/88 (32%), Gaps = 1/88 (1%) Frame = +3 Query: 1023 RPPPXXPXXXXPPXPPXGXPPPXXXFFSXPXAL-PPXKXPXXSPPXGGGGXXSXKNPPVX 1199 R PP P PP P PPP S P + P P SPP S PP Sbjct: 516 RSPPPAPVNSPPP-PVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSP--PPPV 572 Query: 1200 FLPXGGXGAXXPXPGXGGXXPPXRXXPP 1283 F P P P PP PP Sbjct: 573 FSPP--PPVYSPPPPVHSPPPPVHSPPP 598 Score = 31.9 bits (69), Expect = 0.96 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 +PPP PPP PPP P P P PPP Sbjct: 517 SPPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPP 560 >At3g15000.1 68416.m01897 expressed protein similar to DAG protein (required for chloroplast differentiation and palisade development) GB:Q38732 [Antirrhinum majus] Length = 395 Score = 41.9 bits (94), Expect = 9e-04 Identities = 27/89 (30%), Positives = 27/89 (30%), Gaps = 3/89 (3%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPX---GXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPV 1196 PPP P PP PP PPP S P PP PP PP Sbjct: 241 PPPQRPPMGGPPPPPHIGGSAPPPPHMGGSAPP--PPHMGQNYGPPPPNNMGGPRHPPPY 298 Query: 1197 XFLPXGGXGAXXPXPGXGGXXPPXRXXPP 1283 P G P GG PP P Sbjct: 299 GAPPQNNMGGPRPPQNYGGTPPPNYGGAP 327 Score = 37.9 bits (84), Expect = 0.015 Identities = 21/51 (41%), Positives = 22/51 (43%) Frame = -3 Query: 1299 PXXGGGGAXXAGGGXXHPPPXGGGXXPPPPXGGKXRXGF*XXPPPPXPXGG 1147 P GG GG PPP GG PPPP G+ PPPP GG Sbjct: 246 PPMGGPPPPPHIGGSAPPPPHMGGSAPPPPHMGQN-----YGPPPPNNMGG 291 Score = 34.7 bits (76), Expect = 0.14 Identities = 27/98 (27%), Positives = 28/98 (28%), Gaps = 6/98 (6%) Frame = +3 Query: 1014 GGXRPPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXK--XPXXSPPXGG--GGXXSX 1181 GG PPP PP G PP PP P PP G Sbjct: 249 GGPPPPPHIGGSAPPPPHMGGSAPPPPHMGQNYGPPPPNNMGGPRHPPPYGAPPQNNMGG 308 Query: 1182 KNPPVXF--LPXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 PP + P G P GG PP P P Sbjct: 309 PRPPQNYGGTPPPNYGGAPPANNMGGAPPPNYGGGPPP 346 Score = 34.3 bits (75), Expect = 0.18 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = +2 Query: 1217 GGXXPPPXGGGWXXPPP--AXXAPPPPXXG 1300 GG PPP GG PPP APPPP G Sbjct: 249 GGPPPPPHIGGSAPPPPHMGGSAPPPPHMG 278 Score = 33.9 bits (74), Expect = 0.24 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 1202 PPXGGGGXXPPPXGGGWXXPPPAXXAPPPPXXG 1300 PP G PPP GG PPP A PPP G Sbjct: 327 PPANNMGGAPPPNYGG--GPPPQYGAVPPPQYG 357 Score = 31.9 bits (69), Expect = 0.96 Identities = 29/98 (29%), Positives = 31/98 (31%), Gaps = 8/98 (8%) Frame = +1 Query: 1015 GGXAPPPXXXXXXPPPXPPXG--XPPPXXXFFPXPXXXPRXKXPXXPPPGXGGGXXXSKT 1188 GG PPP PPP G PPP P P PPP G + Sbjct: 249 GGPPPPPHIGGSAPPPPHMGGSAPPPPHMGQNYGPPPPNNMGGPRHPPP-YGAPPQNNMG 307 Query: 1189 XPXFSSXGGG----XXXXXPXRGXVGXAPP--XGXXPP 1284 P GG P +G APP G PP Sbjct: 308 GPRPPQNYGGTPPPNYGGAPPANNMGGAPPPNYGGGPP 345 Score = 30.7 bits (66), Expect = 2.2 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 1148 PPXGXGGGGLXQKPXRXFPPXGGGGXXPPPXGGGWXXPPPAXXAPPPPXXG 1300 PP GG P PP G PP G PP APP G Sbjct: 283 PPPPNNMGGPRHPPPYGAPPQNNMGGPRPPQNYGGTPPPNYGGAPPANNMG 333 Score = 30.3 bits (65), Expect = 2.9 Identities = 25/92 (27%), Positives = 28/92 (30%), Gaps = 3/92 (3%) Frame = +1 Query: 1018 GXAPPPXXXXXXPPPXPPXG--XPPPXXXFFPXPXXXPRXKXPXXPPPGXGGGXXXSKTX 1191 G PP PPP P G PPP P + PPP GG Sbjct: 239 GGPPPQRPPMGGPPPPPHIGGSAPPPPHMGGSAPPPPHMGQNYGPPPPNNMGG--PRHPP 296 Query: 1192 PXFSSXGGGXXXXXPXRGXVGXAPP-XGXXPP 1284 P + P + G PP G PP Sbjct: 297 PYGAPPQNNMGGPRPPQNYGGTPPPNYGGAPP 328 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 41.9 bits (94), Expect = 9e-04 Identities = 25/86 (29%), Positives = 26/86 (30%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFL 1205 PPP P PP PP PPP P PP PP PP + Sbjct: 527 PPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYS 586 Query: 1206 PXGGXGAXXPXPGXGGXXPPXRXXPP 1283 P P P PP PP Sbjct: 587 PP-PPPVHSPPPPVHSPPPPVHSPPP 611 Score = 41.5 bits (93), Expect = 0.001 Identities = 28/88 (31%), Positives = 29/88 (32%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFL 1205 PPP P PP PP PPP S P + P SPP PPV Sbjct: 518 PPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPP----PVHSPPPPVHSP 573 Query: 1206 PXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 P P P PP PP P Sbjct: 574 P---PPVHSPPPPVYSPPPPPVHSPPPP 598 Score = 39.5 bits (88), Expect = 0.005 Identities = 26/89 (29%), Positives = 27/89 (30%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPPGXGGGXXXSKTXPXFS 1203 +PPP PPP PP PPP P P P PPP P Sbjct: 526 SPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVY 585 Query: 1204 SXGGGXXXXXPXRGXVGXAPPXGXXPPXP 1290 S P V PP PP P Sbjct: 586 SPPPPPVHSPPP--PVHSPPPPVHSPPPP 612 Score = 38.3 bits (85), Expect = 0.011 Identities = 26/89 (29%), Positives = 28/89 (31%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPPGXGGGXXXSKTXPXFS 1203 +PPP PPP P PPP + P P P P PPP P Sbjct: 500 SPPPPSPIHSPPPPPVYSPPPPPPVYSPPP--PPPVYSPPPPPPVHSPPPPVHSPPPPVH 557 Query: 1204 SXGGGXXXXXPXRGXVGXAPPXGXXPPXP 1290 S P V PP PP P Sbjct: 558 SPPPPVHSPPP---PVHSPPPPVHSPPPP 583 Score = 37.9 bits (84), Expect = 0.015 Identities = 37/147 (25%), Positives = 41/147 (27%), Gaps = 5/147 (3%) Frame = +3 Query: 858 RGXXPPXEGGXH--RAPPXAXGPXQGRXXGXXPRP---PPXXPXXXXXXXXWXXFXXGGX 1022 R PP + H +PP A P P P P + Sbjct: 431 RSPPPPQQPHHHVVHSPPPASSPPTSPPVHSTPSPVHKPQPPKESPQPNDPYDQSPVKFR 490 Query: 1023 RPPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXF 1202 R PP P PP P PPP P PP P SPP PP + Sbjct: 491 RSPPPPPVHSPPPPSPIHSPPPP------PVYSPPPPPPVYSPPP----------PPPVY 534 Query: 1203 LPXGGXGAXXPXPGXGGXXPPXRXXPP 1283 P P P PP PP Sbjct: 535 SPPPPPPVHSPPPPVHSPPPPVHSPPP 561 Score = 37.5 bits (83), Expect = 0.019 Identities = 37/149 (24%), Positives = 39/149 (26%), Gaps = 4/149 (2%) Frame = +3 Query: 849 PXPRGXXPPXEGGXHRAPPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFXXGGXRP 1028 P P PP H PP P PPP P Sbjct: 494 PPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPP 553 Query: 1029 PPXX--PXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKN--PPV 1196 PP P P PP PPP P PP P SPP + PP Sbjct: 554 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPP-PVHSPPPPVHSPPPPVHSPPPP 612 Query: 1197 XFLPXGGXGAXXPXPGXGGXXPPXRXXPP 1283 + P P P PP PP Sbjct: 613 VYSPPPPPPVHSPPPPVFSPPPPVHSPPP 641 Score = 35.9 bits (79), Expect = 0.059 Identities = 26/91 (28%), Positives = 27/91 (29%), Gaps = 2/91 (2%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPXGXPPPXXXFF--PXPXXXPRXKXPXXPPPGXGGGXXXSKTXPX 1197 +PPP PPP PP PPP P P P PPP P Sbjct: 517 SPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 576 Query: 1198 FSSXGGGXXXXXPXRGXVGXAPPXGXXPPXP 1290 S P V PP PP P Sbjct: 577 VHSP--PPPVYSPPPPPVHSPPPPVHSPPPP 605 Score = 35.9 bits (79), Expect = 0.059 Identities = 31/116 (26%), Positives = 32/116 (27%) Frame = +3 Query: 846 SPXPRGXXPPXEGGXHRAPPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFXXGGXR 1025 SP P PP H PP P P P P Sbjct: 551 SPPPPVHSPPPP--VHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHS 608 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPP 1193 PPP P PP PP PPP P PP PP K+PP Sbjct: 609 PPP--PVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPP 662 Score = 34.3 bits (75), Expect = 0.18 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 +PPP PPP P PPP P P P P PPP Sbjct: 492 SPPPPPVHSPPPPSPIHSPPPPPVYSPPPP---PPVYSPPPPPP 532 Score = 34.3 bits (75), Expect = 0.18 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 +PPP PPP PP PPP P P P PPP Sbjct: 608 SPPPPVYS--PPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPP 649 Score = 32.7 bits (71), Expect = 0.55 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 1027 PPPXXXXXXPP---PXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PP P PP PPP P P P PPP Sbjct: 618 PPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPP 663 Score = 31.1 bits (67), Expect = 1.7 Identities = 27/103 (26%), Positives = 30/103 (29%) Frame = +3 Query: 846 SPXPRGXXPPXEGGXHRAPPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFXXGGXR 1025 SP P PP H PP P P PP P + Sbjct: 594 SPPPPVHSPPPP--VHSPPPPVYSPPPPPPVHSPP-PPVFSPPPPVHSPPPPVYSPPPPV 650 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPP 1154 P P PP PP PP + PP + P SPP Sbjct: 651 YSPPPPPVKSPPPPPVYSPP----LLPPKMSSPPTQTPVNSPP 689 Score = 30.7 bits (66), Expect = 2.2 Identities = 29/108 (26%), Positives = 29/108 (26%), Gaps = 5/108 (4%) Frame = +3 Query: 846 SPXPRGXXPPXEGGXHRAPPXAXGPXQGRXXGXXP---RPPPXXPXXXXXXXXWXXFXXG 1016 SP P PP H PP P P PPP Sbjct: 565 SPPPPVHSPPPP--VHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPV 622 Query: 1017 GXRPPPXX--PXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPP 1154 PPP P P PP PPP P P P SPP Sbjct: 623 HSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPP 670 Score = 29.9 bits (64), Expect = 3.9 Identities = 17/56 (30%), Positives = 20/56 (35%) Frame = +2 Query: 1124 PXXXPPXXPPXGXGGGGLXQKPXRXFPPXGGGGXXPPPXGGGWXXPPPAXXAPPPP 1291 P PP PP + P P PPP + PPP +PPPP Sbjct: 612 PVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPV---YSPPPPPVKSPPPP 664 Score = 29.9 bits (64), Expect = 3.9 Identities = 18/46 (39%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Frame = +1 Query: 1024 APPPXXXXXXPP---PXPPXGXPPPXXXFFPXPXXXPRXKXPXXPP 1152 +PPP PP P PP PPP + P P P K P PP Sbjct: 624 SPPPPVFSPPPPVHSPPPPVYSPPP-PVYSPPP---PPVKSPPPPP 665 >At1g31750.1 68414.m03895 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 176 Score = 41.9 bits (94), Expect = 9e-04 Identities = 22/63 (34%), Positives = 25/63 (39%) Frame = +3 Query: 1065 PPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFLPXGGXGAXXPXPG 1244 PP PPP + P PP P PP G + PP + P G G P PG Sbjct: 25 PPGAYPPPPQGAYPPPGGYPPQGYP---PPPHGYPPAAYPPPPGAYPPAGYPGPSGPRPG 81 Query: 1245 XGG 1253 GG Sbjct: 82 FGG 84 Score = 35.5 bits (78), Expect = 0.078 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = +1 Query: 1015 GGXAPPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPPGXGG 1167 G PPP P PP G PPP + P P P PG G Sbjct: 27 GAYPPPPQGAYPPPGGYPPQGYPPPPHGYPPAAYPPPPGAYPPAGYPGPSG 77 Score = 32.3 bits (70), Expect = 0.72 Identities = 19/55 (34%), Positives = 21/55 (38%) Frame = +3 Query: 1005 FXXGGXRPPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGG 1169 + G PPP PP G PPP + P A PP P PP G G Sbjct: 24 YPPGAYPPPPQGAYPPPGGYPPQGYPPPPHGY--PPAAYPP--PPGAYPPAGYPG 74 Score = 30.7 bits (66), Expect = 2.2 Identities = 24/84 (28%), Positives = 26/84 (30%), Gaps = 4/84 (4%) Frame = -2 Query: 1261 GXXPPXPGXGXXAPXPPXGRKXTGGFLXEXXPPPPXGGXXXGXXXGGXAXGXEKXXXXGG 1082 G PP G A PP G G+ P P GG G G Sbjct: 47 GYPPPPHGYPPAAYPPPPGAYPPAGYPGPSGPRPGFGGGVGGLIAGAATAAAAAMGGHHA 106 Query: 1081 GXPXGGXG----GXXLXGXXGGGR 1022 G GG G G G GGG+ Sbjct: 107 GH-HGGYGHHGHGKYKRGFFGGGK 129 Score = 30.3 bits (65), Expect = 2.9 Identities = 20/58 (34%), Positives = 22/58 (37%) Frame = +1 Query: 997 GXFXLXGGXAPPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPPGXGGG 1170 G + GG PP P PP PPP + P P P P PG GGG Sbjct: 35 GAYPPPGGY--PPQGYPPPPHGYPPAAYPPPPGAY--PPAGYP---GPSGPRPGFGGG 85 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPP 1154 PPP P PP PP PPP + P PP P PP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPP 427 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PP PPP +P P P P PP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPP 427 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 +PPP PPP PP PPP P P P P PP Sbjct: 378 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPP 421 Score = 38.3 bits (85), Expect = 0.011 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 1018 GXAPPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 G +PP PPP PP PPP P P P P PPP Sbjct: 373 GCSPPSPPPPPPPPPPPPPPPPPPPPP--PPPPPPPPYVYPSPPPP 416 Score = 35.5 bits (78), Expect = 0.078 Identities = 27/91 (29%), Positives = 28/91 (30%) Frame = +3 Query: 1017 GXRPPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPV 1196 G PP P PP PP PPP P PP P PP PP Sbjct: 373 GCSPPSPPPPPPPPPPPPPPPPPPPPP--PPPPPPPPYVYPSPPPP-------PPSPPPY 423 Query: 1197 XFLPXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 + P P P PP PP P Sbjct: 424 VYPPPPPPYVYPPPPSPPYVYPP---PPPSP 451 Score = 34.7 bits (76), Expect = 0.14 Identities = 21/71 (29%), Positives = 22/71 (30%), Gaps = 2/71 (2%) Frame = +3 Query: 948 PRPPPXXPXXXXXXXXWXXFXXGGXRPPPXXPXXXXPPXPPX--GXPPPXXXFFSXPXAL 1121 P PPP P PPP P PP PP PPP + P Sbjct: 390 PPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPP 449 Query: 1122 PPXKXPXXSPP 1154 P SPP Sbjct: 450 SPQPYMYPSPP 460 Score = 33.5 bits (73), Expect = 0.31 Identities = 19/67 (28%), Positives = 22/67 (32%), Gaps = 1/67 (1%) Frame = +1 Query: 958 PPXXPPXXXXXXFGXFXLXGGXAPPPXXXXXX-PPPXPPXGXPPPXXXFFPXPXXXPRXK 1134 PP PP + PPP PPP PP PPP + P P + Sbjct: 393 PPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQ 452 Query: 1135 XPXXPPP 1155 P P Sbjct: 453 PYMYPSP 459 Score = 30.3 bits (65), Expect = 2.9 Identities = 21/78 (26%), Positives = 22/78 (28%) Frame = +3 Query: 849 PXPRGXXPPXEGGXHRAPPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFXXGGXRP 1028 P P PP PP P P PPP P + P Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVY----P 435 Query: 1029 PPXXPXXXXPPXPPXGXP 1082 PP P PP PP P Sbjct: 436 PPPSPPYVYPPPPPSPQP 453 Score = 28.7 bits (61), Expect = 8.9 Identities = 17/56 (30%), Positives = 19/56 (33%) Frame = +2 Query: 1124 PXXXPPXXPPXGXGGGGLXQKPXRXFPPXGGGGXXPPPXGGGWXXPPPAXXAPPPP 1291 P PP PP P +P PPP + PPP PPPP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYV--YPPPPPPYVYPPPP 438 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 40.7 bits (91), Expect = 0.002 Identities = 30/125 (24%), Positives = 32/125 (25%) Frame = +3 Query: 915 GPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFXXGGXRPPPXXPXXXXPPXPPXGXPPPXX 1094 G G G P P P PPP P P P PPP Sbjct: 62 GDDSGGDDGGYTPPAPVPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPT 121 Query: 1095 XFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFLPXGGXGAXXPXPGXGGXXPPXRX 1274 S P PP P +P +PP P P PP Sbjct: 122 PTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPV 181 Query: 1275 XPPXP 1289 PP P Sbjct: 182 SPPPP 186 >At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 162 Score = 39.9 bits (89), Expect = 0.004 Identities = 23/58 (39%), Positives = 24/58 (41%), Gaps = 6/58 (10%) Frame = +2 Query: 1136 PPXXPPXGXGGGGLXQKPXRXFPPXGGGGXXPPPXGG---GWXXPPP---AXXAPPPP 1291 PP PP GG P GGG PPP GG G+ PPP PPPP Sbjct: 67 PPPSPPSSGGGSSYYYPPPSQ---SGGGSKYPPPYGGGGQGYYYPPPYSGNYPTPPPP 121 Score = 35.1 bits (77), Expect = 0.10 Identities = 22/57 (38%), Positives = 25/57 (43%), Gaps = 9/57 (15%) Frame = -3 Query: 1299 PXXGGGGAXX------AGGGXXHPPPXGGGXXP---PPPXGGKXRXGF*XXPPPPXP 1156 P GGG + +GGG +PPP GGG PPP G PPPP P Sbjct: 72 PSSGGGSSYYYPPPSQSGGGSKYPPPYGGGGQGYYYPPPYSGNY-----PTPPPPNP 123 Score = 34.7 bits (76), Expect = 0.14 Identities = 23/84 (27%), Positives = 24/84 (28%) Frame = +1 Query: 1033 PXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPPGXGGGXXXSKTXPXFSSXG 1212 P PP PP P P P PPP GG SK P + G Sbjct: 45 PVQSSPPPPSPPPPSTPTTACPPPPSPPSSGGGSSYYYPPPSQSGG--GSKYPPPYGGGG 102 Query: 1213 GGXXXXXPXRGXVGXAPPXGXXPP 1284 G P G PP P Sbjct: 103 QGYYYPPPYSGNYPTPPPPNPIVP 126 Score = 29.5 bits (63), Expect = 5.1 Identities = 21/59 (35%), Positives = 22/59 (37%), Gaps = 3/59 (5%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXS---PPXGGGGXXSXKNPP 1193 PPP P PP P PP S PP + S PP GGGG PP Sbjct: 56 PPPSTPTTACPPPP----SPPSSGGGSSYYYPPPSQSGGGSKYPPPYGGGGQGYYYPPP 110 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 39.5 bits (88), Expect = 0.005 Identities = 27/90 (30%), Positives = 28/90 (31%) Frame = +3 Query: 882 GGXHRAPPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFXXGGXRPPPXXPXXXXPP 1061 GG PP + P P PPP P PPP P PP Sbjct: 40 GGNDNNPPPSPSPEPEPEPADCPPPPPPPPCP----------------PPPSPPPCPPPP 83 Query: 1062 XPPXGXPPPXXXFFSXPXALPPXKXPXXSP 1151 PP PPP P LPP P P Sbjct: 84 SPPPSPPPPQ---LPPPPQLPPPAPPKPQP 110 Score = 38.3 bits (85), Expect = 0.011 Identities = 18/44 (40%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXAL-PPXKXPXXSPP 1154 PPP P PP PP PPP P L PP + P +PP Sbjct: 63 PPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPP 106 Score = 37.9 bits (84), Expect = 0.015 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PP PPP P P P P PPP Sbjct: 63 PPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLP--PPPQLPPP 103 Score = 35.1 bits (77), Expect = 0.10 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 P P PPP PP PPP P P P P PPP Sbjct: 54 PEPEPADCPPPPPPPPCPPPPS----PPPCPPPPSPPPSPPPP 92 Score = 33.5 bits (73), Expect = 0.31 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PP PP PP P P P + P PP Sbjct: 64 PPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPP 106 Score = 33.1 bits (72), Expect = 0.41 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +1 Query: 1015 GGXAPPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 G PP P P P PPP P P P P PPP Sbjct: 41 GNDNNPPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPP 87 Score = 32.3 bits (70), Expect = 0.72 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPP 1154 P P PP PP PPP P + PP P PP Sbjct: 54 PEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPP 96 Score = 32.3 bits (70), Expect = 0.72 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP P PPP P P P PP Sbjct: 71 PPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPP 113 Score = 31.1 bits (67), Expect = 1.7 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +3 Query: 1014 GGXRPPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPP 1154 G PP P P P PPP P + PP P PP Sbjct: 41 GNDNNPPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPP 87 Score = 30.7 bits (66), Expect = 2.2 Identities = 14/44 (31%), Positives = 16/44 (36%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 +PPP PPP PP PP P P+ P P Sbjct: 75 SPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTPDLP 118 Score = 29.1 bits (62), Expect = 6.7 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 1211 GGGGXXPPPXGGGWXXPPPAXXAPPPP 1291 GG PPP P PA PPPP Sbjct: 40 GGNDNNPPPSPSPEPEPEPADCPPPPP 66 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 39.5 bits (88), Expect = 0.005 Identities = 39/150 (26%), Positives = 40/150 (26%), Gaps = 5/150 (3%) Frame = +3 Query: 849 PXPRGXXPPXEGGXHRAPPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFXXGGXRP 1028 P P PP R PP P R PPP P P Sbjct: 588 PPPLAQPPPP-----RPPPPPPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPP 642 Query: 1029 PPXXPXXXXPPX---PPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVX 1199 PP P P PP PPP S P P PP + K P Sbjct: 643 PPPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPPAPP 702 Query: 1200 FLPXGG--XGAXXPXPGXGGXXPPXRXXPP 1283 LP GA P P P PP Sbjct: 703 PLPPSSTRLGAPPPPPPPPLSKTPAPPPPP 732 Score = 37.1 bits (82), Expect = 0.025 Identities = 23/72 (31%), Positives = 26/72 (36%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFL 1205 PPP P PP PPP + P PP PP G G + PP Sbjct: 701 PPPLPPSSTRLGAPPPPPPPPLSKTPAPPP--PPLSKTPVPPPPPGLGRGTSSGPP---- 754 Query: 1206 PXGGXGAXXPXP 1241 P G G+ P P Sbjct: 755 PLGAKGSNAPPP 766 Score = 33.9 bits (74), Expect = 0.24 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 1027 PPPXXXXXXPPPX--PPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PP PPP P P P PPP Sbjct: 579 PPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPP 623 Score = 31.9 bits (69), Expect = 0.96 Identities = 23/83 (27%), Positives = 26/83 (31%) Frame = +3 Query: 1041 PXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFLPXGGX 1220 P PP PP PP P A PP P PP S ++ P P Sbjct: 567 PINKTPPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPP----PPSSRSIP---SPSAPP 619 Query: 1221 GAXXPXPGXGGXXPPXRXXPPXP 1289 P P G + PP P Sbjct: 620 PPPPPPPSFGSTGNKRQAQPPPP 642 Score = 30.7 bits (66), Expect = 2.2 Identities = 44/158 (27%), Positives = 45/158 (28%), Gaps = 23/158 (14%) Frame = +3 Query: 846 SPXPRGXXPPXEG--GXHRA---PPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFX 1010 +P P PP G G R PP P R PPP P Sbjct: 617 APPPPPPPPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGP 676 Query: 1011 XGGXRPPPXXP----------XXXXPPXPPXG------XPPPXXXFFSXPXALPP--XKX 1136 PPP P PP PP PPP P PP K Sbjct: 677 PSTPPPPPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKT 736 Query: 1137 PXXSPPXGGGGXXSXKNPPVXFLPXGGXGAXXPXPGXG 1250 P PP G G S PP L G A P P G Sbjct: 737 PVPPPPPGLGRGTSSGPPP---LGAKGSNAPPPPPPAG 771 Score = 30.3 bits (65), Expect = 2.9 Identities = 33/138 (23%), Positives = 34/138 (24%), Gaps = 8/138 (5%) Frame = +3 Query: 900 PPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFXXGGXRPPPXXPXXXXPP---XPP 1070 PP P P PP P F PPP P P Sbjct: 485 PPPPPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPPPLFTSTTSFSPS 544 Query: 1071 XGXPPPXXXFFSXPXAL-----PPXKXPXXSPPXGGGGXXSXKNPPVXFLPXGGXGAXXP 1235 PPP FS L P K P PP PP+ P P Sbjct: 545 QPPPPPPLPSFSNRDPLTTLHQPINKTPPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPP 604 Query: 1236 XPGXGGXXPPXRXXPPXP 1289 P P PP P Sbjct: 605 PPPSSRSIPSPSAPPPPP 622 Score = 29.9 bits (64), Expect = 3.9 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP P P P PPP F P PPP Sbjct: 604 PPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPP 646 Score = 29.1 bits (62), Expect = 6.7 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +2 Query: 1136 PPXXPPXGXGGGGLXQKPXRXFPPXGGGGXXPPPXGGGWXXPPPAXXAPPPP 1291 PP PP P PP PPP P P+ PPPP Sbjct: 572 PPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPP 623 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 38.3 bits (85), Expect = 0.011 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP P PP PPP FP P P + PPP Sbjct: 78 PPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPPPESTNSPPP 120 Score = 33.1 bits (72), Expect = 0.41 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = +1 Query: 1015 GGXAPPPXXXXXXPPPXPP-XGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 G APPP PPP PP PPP P P PPP Sbjct: 26 GSAAPPP--TDSAPPPSPPADSSPPPALPSLPPAVFSPPPTVSSPPPP 71 Score = 33.1 bits (72), Expect = 0.41 Identities = 37/147 (25%), Positives = 40/147 (27%) Frame = +3 Query: 843 FSPXPRGXXPPXEGGXHRAPPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFXXGGX 1022 FSP P PP PP P P PP P F Sbjct: 59 FSPPPTVSSPPPPPLDSSPPP----PPDLTPPPSSPPPPDAPPPIPIV------FPPPID 108 Query: 1023 RPPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXF 1202 PPP PP PPP S P PP + P + GG K+ P Sbjct: 109 SPPPESTNSPPPPEVFEPPPPPADEDESPPAPPPPEQLPPPASSPQGGPKKPKKHHP--- 165 Query: 1203 LPXGGXGAXXPXPGXGGXXPPXRXXPP 1283 G P P PP P Sbjct: 166 ----GPATSPPAPSAPATSPPAPPNAP 188 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 37.9 bits (84), Expect = 0.015 Identities = 24/59 (40%), Positives = 24/59 (40%), Gaps = 5/59 (8%) Frame = +2 Query: 1139 PXXPPXGXGGGGLXQKPXRXFPPXGGGG-----XXPPPXGGGWXXPPPAXXAPPPPXXG 1300 P PP GGGG P P GGGG PPP GG P APPP G Sbjct: 136 PGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGG-GGEPVIPGAPPPKRGG 193 Score = 37.9 bits (84), Expect = 0.015 Identities = 24/59 (40%), Positives = 24/59 (40%), Gaps = 5/59 (8%) Frame = +2 Query: 1139 PXXPPXGXGGGGLXQKPXRXFPPXGGGG-----XXPPPXGGGWXXPPPAXXAPPPPXXG 1300 P PP GGGG P P GGGG PPP GG P APPP G Sbjct: 168 PGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGG-GGEPVIPGAPPPKRGG 225 Score = 37.5 bits (83), Expect = 0.019 Identities = 24/59 (40%), Positives = 24/59 (40%), Gaps = 5/59 (8%) Frame = +2 Query: 1139 PXXPPXGXGGGGLXQKPXRXFPPXGGGG-----XXPPPXGGGWXXPPPAXXAPPPPXXG 1300 P PP GGGG P P GGGG PPP GG P APPP G Sbjct: 120 PGAPPPIRGGGGEPAIPGAPPPKRGGGGEPVIPGAPPPKRGG-GGEPVIPGAPPPKRGG 177 Score = 34.3 bits (75), Expect = 0.18 Identities = 42/149 (28%), Positives = 44/149 (29%), Gaps = 2/149 (1%) Frame = +3 Query: 849 PXPRGXXPPXEGGXHRAPPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFXXGGXRP 1028 P G PP GG P A P +G G P P P G P Sbjct: 102 PVIPGAPPPNRGGGETVIPGAPPPIRG--GGGEPAIPGAPPPKRGGGG--EPVIPGA--P 155 Query: 1029 PPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFLP 1208 PP P P G PPP P + P P P GGGG P Sbjct: 156 PPKRGGGGEPVIP--GAPPPKRGGGGEP--VIPGAPP---PKRGGGGEPVIPGAPPPKRG 208 Query: 1209 XGGXGA--XXPXPGXGGXXPPXRXXPPXP 1289 GG P P GG P P P Sbjct: 209 GGGEPVIPGAPPPKRGGGGEPVIPGAPLP 237 Score = 34.3 bits (75), Expect = 0.18 Identities = 29/92 (31%), Positives = 32/92 (34%), Gaps = 3/92 (3%) Frame = -2 Query: 1288 GXGGXXRXGGXXPPXPGXGXXA--PXPPXGRKXTGG-FLXEXXPPPPXGGXXXGXXXGGX 1118 G GG G PP G G P P ++ GG + PPP GG G G Sbjct: 208 GGGGEPVIPGAPPPKRGGGGEPVIPGAPLPKRGGGGESVVPGAPPPKRGG---GVIVNGG 264 Query: 1117 AXGXEKXXXXGGGXPXGGXGGXXLXGXXGGGR 1022 GGG G GG GGGR Sbjct: 265 CETVPPGRG-GGGDKTNGRGGEGREEDNGGGR 295 Score = 33.9 bits (74), Expect = 0.24 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 5/59 (8%) Frame = +2 Query: 1139 PXXPPXGXGGGGLXQKPXRXFPPXGGGG-----XXPPPXGGGWXXPPPAXXAPPPPXXG 1300 P PP GGGG P P GGGG PPP GG PP G Sbjct: 216 PGAPPPKRGGGGEPVIPGAPLPKRGGGGESVVPGAPPPKRGGGVIVNGGCETVPPGRGG 274 Score = 32.7 bits (71), Expect = 0.55 Identities = 24/61 (39%), Positives = 24/61 (39%), Gaps = 7/61 (11%) Frame = +2 Query: 1139 PXXPPXGXGGGGLXQKPXRXFPPXGGGGXXP-------PPXGGGWXXPPPAXXAPPPPXX 1297 P PP GGGG P PP GGG P P GGG P APPP Sbjct: 200 PGAPPPKRGGGGEPVIPGAP-PPKRGGGGEPVIPGAPLPKRGGGGESVVPG--APPPKRG 256 Query: 1298 G 1300 G Sbjct: 257 G 257 Score = 30.3 bits (65), Expect = 2.9 Identities = 29/101 (28%), Positives = 30/101 (29%), Gaps = 10/101 (9%) Frame = -1 Query: 1289 GXGGXXPXGGAXPTXPRXGXXXXX--PPPXEEXNGXVFX*XXPPPXPGGGXXGXFXRG-- 1122 G GG GA P G PPP G PPP GGG Sbjct: 97 GGGGEPVIPGAPPPNRGGGETVIPGAPPPIRGGGGEPAIPGAPPPKRGGGGEPVIPGAPP 156 Query: 1121 -XXXGXGKKXXXGGGXPXGGXGG-----GXXXXXXGGGAXP 1017 G G+ G P G GG G GGG P Sbjct: 157 PKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEP 197 Score = 30.3 bits (65), Expect = 2.9 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 5/53 (9%) Frame = -3 Query: 1290 GGGGAXXAGGGXXHPPPXGGGXX-----PPPPXGGKXRXGF*XXPPPPXPXGG 1147 GGGG G PP GGG PPP GG PPP GG Sbjct: 97 GGGGEPVIPGAP--PPNRGGGETVIPGAPPPIRGGGGEPAIPGAPPPKRGGGG 147 Score = 30.3 bits (65), Expect = 2.9 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 5/56 (8%) Frame = -3 Query: 1299 PXXGGGGAXXAGGGXXHPPPXGGG-----XXPPPPXGGKXRXGF*XXPPPPXPXGG 1147 P GGG A G P GGG PPP GG PPP GG Sbjct: 124 PPIRGGGGEPAIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGGG 179 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 37.5 bits (83), Expect = 0.019 Identities = 39/147 (26%), Positives = 39/147 (26%) Frame = +3 Query: 849 PXPRGXXPPXEGGXHRAPPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFXXGGXRP 1028 P P PP H PP P P P P P Sbjct: 685 PPPPVHSPPPP--VHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSP 742 Query: 1029 PPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFLP 1208 PP P PP P PPP P PP P SPP PPV P Sbjct: 743 PPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPP--PPVHSPPP----PVHSPPPPVHSPP 796 Query: 1209 XGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 P P PP PP P Sbjct: 797 PPVHSPPPPSP-IYSPPPPVFSPPPKP 822 Score = 35.9 bits (79), Expect = 0.059 Identities = 27/85 (31%), Positives = 28/85 (32%) Frame = +3 Query: 1029 PPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFLP 1208 P P PP PP PPP FS P + P SPP S PPV P Sbjct: 639 PQSPPVHSPPPPPPVHSPPP--PVFSPPPPMHSPPPPVYSPPP---PVHSPPPPPVHSPP 693 Query: 1209 XGGXGAXXPXPGXGGXXPPXRXXPP 1283 P P PP PP Sbjct: 694 ---PPVHSPPPPVHSPPPPVHSPPP 715 Score = 35.9 bits (79), Expect = 0.059 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 +PPP PPP P PPP P P P PPP Sbjct: 733 SPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPP 776 Score = 35.5 bits (78), Expect = 0.078 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 +PPP PPP P PPP P P P PPP Sbjct: 741 SPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPP 784 Score = 35.1 bits (77), Expect = 0.10 Identities = 34/124 (27%), Positives = 35/124 (28%), Gaps = 12/124 (9%) Frame = +3 Query: 954 PPPXXPXXXXXXXXWXXFXXGGXRPPPXX---PXXXXPPXPPXGXPPPXXXFFSXPXALP 1124 PPP P + PPP P PP PP PPP P P Sbjct: 647 PPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSP 706 Query: 1125 P-----XKXPXXSPPXGGGG----XXSXKNPPVXFLPXGGXGAXXPXPGXGGXXPPXRXX 1277 P P SPP S PPV P P P PP Sbjct: 707 PPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSP 766 Query: 1278 PPXP 1289 PP P Sbjct: 767 PPPP 770 Score = 32.3 bits (70), Expect = 0.72 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 1054 PPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PP PPP P P P PPP Sbjct: 647 PPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPP 680 Score = 31.5 bits (68), Expect = 1.3 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 5/49 (10%) Frame = +1 Query: 1024 APPPXXXXXXPP-----PXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 +PPP PP P PP PPP P P P PPP Sbjct: 646 SPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPP 694 Score = 29.1 bits (62), Expect = 6.7 Identities = 15/46 (32%), Positives = 16/46 (34%), Gaps = 3/46 (6%) Frame = +1 Query: 1027 PPPXXXXXXP---PPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP P PP P PPP + P P P P P Sbjct: 782 PPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPPPKPVTPLP 827 Score = 28.7 bits (61), Expect = 8.9 Identities = 17/56 (30%), Positives = 19/56 (33%) Frame = +2 Query: 1124 PXXXPPXXPPXGXGGGGLXQKPXRXFPPXGGGGXXPPPXGGGWXXPPPAXXAPPPP 1291 P PP PP + P P PPP PPP +PPPP Sbjct: 643 PVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHS---PPPPPVHSPPPP 695 Score = 28.7 bits (61), Expect = 8.9 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 1229 PPPXGGGWXXPPPAXXAPPPP 1291 PPP + PPP +PPPP Sbjct: 742 PPPPAPIYSPPPPPVHSPPPP 762 >At2g43150.1 68415.m05358 proline-rich extensin-like family protein similar to CRANTZ hydroxyproline-rich glycoprotein [Manihot esculenta] gi|7211797|gb|AAF40442; similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 212 Score = 37.5 bits (83), Expect = 0.019 Identities = 39/150 (26%), Positives = 43/150 (28%), Gaps = 2/150 (1%) Frame = +3 Query: 846 SPXPRGXXPPXEGGXHRAPPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFXXGGXR 1025 SP P PP H PP P P PP P + Sbjct: 60 SPPPPVKSPPPPYYYHSPPPPVKSPPPPYVYSSPP-PPVKSP---PPPYYYHSPPPPVKS 115 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXAL--PPXKXPXXSPPXGGGGXXSXKNPPVX 1199 PPP P P PP PPP + S P + PP SPP PP Sbjct: 116 PPP--PYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPP----PVKSPPPPYY 169 Query: 1200 FLPXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 + P P PP PP P Sbjct: 170 YHSPPPPVKSPPPPYLYSSPPPPVKSPPPP 199 Score = 33.9 bits (74), Expect = 0.24 Identities = 29/88 (32%), Positives = 30/88 (34%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFL 1205 PPP P P PP PPP + S P PP K P PP S PPV Sbjct: 52 PPP--PYEYKSPPPPVKSPPPPYYYHSPP---PPVKSP--PPPY----VYSSPPPPVKSP 100 Query: 1206 PXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 P P P P PP P Sbjct: 101 PPPYYYHSPPPPVKSPPPPYYYHSPPPP 128 Score = 32.3 bits (70), Expect = 0.72 Identities = 28/88 (31%), Positives = 30/88 (34%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFL 1205 PPP P P PP PPP + S P PP K P PP PPV Sbjct: 36 PPP--PYEYKSPPPPVKSPPPPYEYKSPP---PPVKSP--PPPY----YYHSPPPPVKSP 84 Query: 1206 PXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 P + P P P PP P Sbjct: 85 PPPYVYSSPPPPVKSPPPPYYYHSPPPP 112 Score = 29.5 bits (63), Expect = 5.1 Identities = 23/89 (25%), Positives = 26/89 (29%) Frame = +3 Query: 846 SPXPRGXXPPXEGGXHRAPPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFXXGGXR 1025 SP P PP H PP P PPP P + + Sbjct: 124 SPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHS---PPP--PVKSPPPPYYYHSPPPPVK 178 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXP 1112 PP PP P PPP + S P Sbjct: 179 SPPPPYLYSSPPPPVKSPPPPVYIYASPP 207 >At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to auxin down regulated GB:X69640 GI:296442 from [Glycine max]; contains Pfam profile PF00234: Protease inhibitor/seed storage/LTP family Length = 297 Score = 37.5 bits (83), Expect = 0.019 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +2 Query: 1136 PPXXPPXGXGGGGLXQKPXRXFPPXGG-GGXXPPPXGGGWXXPP 1264 P PP GGGG KP P GG GG PPP GG PP Sbjct: 36 PVPKPPQHGGGGGGGSKPP---PHHGGKGGGKPPPHGGKGGGPP 76 Score = 37.5 bits (83), Expect = 0.019 Identities = 25/56 (44%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Frame = -3 Query: 1299 PXXGGGGAXXAGGGXXHPPPXGG-GXXPPPPXGGKXRXGF*XXPPPPXPXGGXXGG 1135 P GGGG GGG PP GG G PPP GGK PP GG GG Sbjct: 41 PQHGGGG----GGGSKPPPHHGGKGGGKPPPHGGKGGG-------PPHHGGGGGGG 85 Score = 36.3 bits (80), Expect = 0.044 Identities = 25/71 (35%), Positives = 27/71 (38%), Gaps = 5/71 (7%) Frame = +3 Query: 1017 GXRPPPXXPXXXXPPXP-PXGXPPPXXXFFSXPXALPPXKX--PXXSPPXGGGGXXSXKN 1187 G PP P PP P G PP P +PP P PP GGGG K Sbjct: 152 GLLPPVTTPPGLLPPVTTPPGLLPPIIN--PPPVTVPPPSSGYPPYGPPSGGGGGGGGKQ 209 Query: 1188 P--PVXFLPXG 1214 P P+ L G Sbjct: 210 PTCPINALKLG 220 Score = 35.9 bits (79), Expect = 0.059 Identities = 25/71 (35%), Positives = 26/71 (36%), Gaps = 16/71 (22%) Frame = +2 Query: 1124 PXXXPPXXPPXGXGGGGLXQKPXRXF-------PPXGGGGXXPPPXGGGW---------X 1255 P P P G GGGG + P PP GG G PP GGG Sbjct: 33 PHPPVPKPPQHGGGGGGGSKPPPHHGGKGGGKPPPHGGKGGGPPHHGGGGGGGGKSPPVV 92 Query: 1256 XPPPAXXAPPP 1288 PPP PPP Sbjct: 93 RPPPVVVRPPP 103 Score = 31.5 bits (68), Expect = 1.3 Identities = 38/153 (24%), Positives = 40/153 (26%), Gaps = 8/153 (5%) Frame = +3 Query: 849 PXPRGXXPPXEGGXHRAPPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFXXGGXRP 1028 P P PP GG G+ G +PPP GG P Sbjct: 33 PHPPVPKPPQHGGGGGGGSKPPPHHGGKGGG---KPPPHGGKGGGPPHHGGGGGGGGKSP 89 Query: 1029 PPXXPXXXXPPXPPXGXPP----PXXXFFSXPXALPPXKXPXXSPP--XGGGGXXSXKNP 1190 P P PP PP P P PP P PP G Sbjct: 90 PVVRPPPVVVRPPPIIRPPPVVYPPPIVRPPPITRPPIIIPPIQPPPVTTPPGLLPPITT 149 Query: 1191 PVXFLP--XGGXGAXXPXPGXGGXXPPXRXXPP 1283 P LP G P G PP PP Sbjct: 150 PPGLLPPVTTPPGLLPPVTTPPGLLPPIINPPP 182 Score = 30.3 bits (65), Expect = 2.9 Identities = 24/62 (38%), Positives = 25/62 (40%), Gaps = 5/62 (8%) Frame = -1 Query: 1166 PPXPGGGXXGXFXRGXXXGXGKKXXXGGGXPX--GGXGGGXXXXXXGGGA---XPPXXKX 1002 PP GGG G G GK GGG P GG GGG GGG PP + Sbjct: 40 PPQHGGGGGGGSKPPPHHG-GK----GGGKPPPHGGKGGGPPHHGGGGGGGGKSPPVVRP 94 Query: 1001 XP 996 P Sbjct: 95 PP 96 Score = 28.7 bits (61), Expect = 8.9 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = +1 Query: 1126 RXKXPXXPPP-GXGGGXXXSKTXPXFSSXGGGXXXXXPXRGXVGXAPP 1266 R P PP GGG SK P GGG P G G PP Sbjct: 32 RPHPPVPKPPQHGGGGGGGSKPPPHHGGKGGG---KPPPHGGKGGGPP 76 Score = 28.7 bits (61), Expect = 8.9 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +1 Query: 1054 PPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPPGXGGGXXXSK 1185 PP P G PP P P P PP GGG K Sbjct: 165 PPVTTPPGLLPPIINPPPVTVPPPSSGYPPYGPPSGGGGGGGGK 208 >At3g06130.1 68416.m00704 heavy-metal-associated domain-containing protein contains Pfam heavy metal associated domain PF00403 Length = 473 Score = 37.1 bits (82), Expect = 0.025 Identities = 32/112 (28%), Positives = 34/112 (30%), Gaps = 5/112 (4%) Frame = -2 Query: 1168 PPPPXGGXXXGXXXGGXAXGXEKXXXXGGGXPXGGXGGXXLXGXXGGGRXPPXXKXXQXX 989 P GG G GG A G GGG GG G GGG P K Sbjct: 261 PAAGGGGAGGGKGAGGGAKGGPGNQNQGGG-KNGGGGHPQDGKNGGGGGGPNAGKKGNGG 319 Query: 988 XXXXXXGXXG-----GGRGXXPXXRPWXGPXAXGGARXHPPSXGGXXPLGXG 848 G G GG G P G GG + P+ G G G Sbjct: 320 GGPMAGGVSGGFRPMGGGGPQNMSMPMGGQMGMGGPMGNMPAVQGLPATGPG 371 >At1g24490.1 68414.m03084 60 kDa inner membrane family protein similar to chloroplast membrane protein (ALBINO3) (GI:3927828) [Arabidopsis thaliana] Length = 1013 Score = 37.1 bits (82), Expect = 0.025 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = -3 Query: 1287 GGGAXXAGGGXXHPPPXGGGXXPPPPXGG 1201 GGG+ GGG PP GGG PP GG Sbjct: 402 GGGSPSPGGGSGSPPSTGGGSGSPPSTGG 430 Score = 34.7 bits (76), Expect = 0.14 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -3 Query: 1299 PXXGGGGAXXAGGGXXHPPPXGGGXXPPPPXGGKXRXG 1186 P G G GGG PP GGG P GG + G Sbjct: 408 PGGGSGSPPSTGGGSGSPPSTGGGGGSPSKGGGGGKSG 445 Score = 31.5 bits (68), Expect = 1.3 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 1163 PXPGGGXXGXFXRGXXXGXGKKXXXGGGXPXGGXGGG 1053 P PGGG G G GGG P G GGG Sbjct: 406 PSPGGGSGSPPSTGGGSGSPPSTGGGGGSPSKGGGGG 442 Score = 29.5 bits (63), Expect = 5.1 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 1202 PPXGGGGXXPPPXGGGWXXPPPAXXAPPPPXXG 1300 P GGG PP GGG PP P G Sbjct: 406 PSPGGGSGSPPSTGGGSGSPPSTGGGGGSPSKG 438 Score = 29.1 bits (62), Expect = 6.7 Identities = 16/56 (28%), Positives = 16/56 (28%) Frame = -1 Query: 1124 GXXXGXGKKXXXGGGXPXGGXGGGXXXXXXGGGAXPPXXKXXPXXXXXXXGGXXGG 957 G G GGG P G G G GG PP GG G Sbjct: 390 GSGNGTNSTSTSGGGSPSPGGGSGSPPSTGGGSGSPPSTGGGGGSPSKGGGGGKSG 445 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 37.1 bits (82), Expect = 0.025 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 +PPP PP PP PPP P P P P PP Sbjct: 59 SPPPATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPSPPQPQPP 102 Score = 33.9 bits (74), Expect = 0.24 Identities = 16/46 (34%), Positives = 20/46 (43%) Frame = +3 Query: 1023 RPPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXG 1160 +PPP P PP P PPP + P + P + P S P G Sbjct: 67 QPPPNQPPNTTPPPTPPSSPPPS---ITPPPSPPQPQPPPQSTPTG 109 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 36.7 bits (81), Expect = 0.034 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXP 1139 PPP P PP PP PPP S +PP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPP 80 Score = 31.9 bits (69), Expect = 0.96 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +1 Query: 1003 FXLXGGXAPPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 F L PP PPP PP PPP P P PPP Sbjct: 27 FLLVQSQDPPLFPQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPP 77 Score = 29.9 bits (64), Expect = 3.9 Identities = 16/44 (36%), Positives = 18/44 (40%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 +PPP PPP PP PPP P P + PPP Sbjct: 41 SPPP------PPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPP 78 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 36.3 bits (80), Expect = 0.044 Identities = 32/116 (27%), Positives = 32/116 (27%), Gaps = 1/116 (0%) Frame = +3 Query: 870 PPXEGGXHRAPPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFXXGGXRPPPXXPXX 1049 PP APP P PPP P PP P Sbjct: 707 PPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTH 766 Query: 1050 XXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKN-PPVXFLPXG 1214 P PP PPP P A PP P G S N PP LP G Sbjct: 767 SASPPPPTAPPPPPLGQTRAPSAPPP-----PPPKLGTKLSPSGPNVPPTPALPTG 817 Score = 30.7 bits (66), Expect = 2.2 Identities = 31/114 (27%), Positives = 33/114 (28%) Frame = +3 Query: 948 PRPPPXXPXXXXXXXXWXXFXXGGXRPPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPP 1127 PRPPP P PPP PP PP PP S P PP Sbjct: 687 PRPPPPPPPPPMQHSTVTKVP-----PPP-------PPAPPA--PPTPIVHTSSPPPPPP 732 Query: 1128 XKXPXXSPPXGGGGXXSXKNPPVXFLPXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 P P G + K+ P A P PP PP P Sbjct: 733 PPPPPAPPTPQSNGISAMKSSP------PAPPAPPRLPTHSASPPPPTAPPPPP 780 Score = 29.1 bits (62), Expect = 6.7 Identities = 33/133 (24%), Positives = 34/133 (25%), Gaps = 3/133 (2%) Frame = +3 Query: 900 PPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFXXGGXRPPPXXPXXXXPPXPPXGX 1079 PP P Q P PPP P PPP PP PP Sbjct: 691 PPPPPPPMQHSTVTKVPPPPPPAPPAPPT----PIVHTSSPPPPP-------PPPPPPAP 739 Query: 1080 PPPXXXFFSXPXALPP-XKXPXXSPPXGGGGXXSXKNPPVXFLPXGGXGAXXPXPGXGG- 1253 P P S + PP P P PP A P P G Sbjct: 740 PTPQSNGISAMKSSPPAPPAPPRLPTHSASPPPPTAPPPPPLGQTRAPSAPPPPPPKLGT 799 Query: 1254 -XXPPXRXXPPXP 1289 P PP P Sbjct: 800 KLSPSGPNVPPTP 812 >At5g45350.1 68418.m05567 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 177 Score = 36.3 bits (80), Expect = 0.044 Identities = 27/84 (32%), Positives = 29/84 (34%), Gaps = 2/84 (2%) Frame = +3 Query: 1017 GXRPPPXXPXXXXPPX--PPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNP 1190 G P P PP P G PPP P A PP P + P GG Sbjct: 15 GYPPAGYPPPGAYPPAGYPQQGYPPP-------PGAYPPAGYPPGAYPPAPGGYPPAPGY 67 Query: 1191 PVXFLPXGGXGAXXPXPGXGGXXP 1262 + P G G P PG GG P Sbjct: 68 G-GYPPAPGYGGYPPAPGHGGYPP 90 Score = 33.5 bits (73), Expect = 0.31 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = +2 Query: 1136 PPXXPPXGXGGGGLXQKPXRXFPPXGGGGXXPPPXGGGWXXPPPAXXAPPP 1288 P PP G G P +PP G G PP G G P P PP Sbjct: 41 PGAYPPAGYPPGAYPPAPG-GYPPAPGYGGYPPAPGYGGYPPAPGHGGYPP 90 Score = 32.7 bits (71), Expect = 0.55 Identities = 25/77 (32%), Positives = 26/77 (33%), Gaps = 2/77 (2%) Frame = +3 Query: 1065 PPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFLPXGGXGAXXPXPG 1244 PP G PPP A PP P P G PP + P G P PG Sbjct: 17 PPAGYPPPG--------AYPPAGYPQQGYPPPPGAYPPAGYPPGAYPP--APGGYPPAPG 66 Query: 1245 XGGXXPP--XRXXPPXP 1289 GG P PP P Sbjct: 67 YGGYPPAPGYGGYPPAP 83 Score = 30.7 bits (66), Expect = 2.2 Identities = 18/55 (32%), Positives = 20/55 (36%) Frame = +2 Query: 1136 PPXXPPXGXGGGGLXQKPXRXFPPXGGGGXXPPPXGGGWXXPPPAXXAPPPPXXG 1300 P PP G G P +PP G PP GG+ P PP P G Sbjct: 24 PGAYPPAGYPQQGYPPPPGA-YPPAGYPPGAYPPAPGGYPPAPGYGGYPPAPGYG 77 Score = 29.1 bits (62), Expect = 6.7 Identities = 20/69 (28%), Positives = 22/69 (31%), Gaps = 3/69 (4%) Frame = -2 Query: 1225 APXPPXGRKXTGGFLXEXXPPPPXGGXXXGXXXGG---XAXGXEKXXXXGGGXPXGGXGG 1055 A PP G G+ + PPPP G G G GG P G GG Sbjct: 19 AGYPPPGAYPPAGYPQQGYPPPPGAYPPAGYPPGAYPPAPGGYPPAPGYGGYPPAPGYGG 78 Query: 1054 XXLXGXXGG 1028 GG Sbjct: 79 YPPAPGHGG 87 Score = 28.7 bits (61), Expect = 8.9 Identities = 18/59 (30%), Positives = 20/59 (33%) Frame = +2 Query: 1124 PXXXPPXXPPXGXGGGGLXQKPXRXFPPXGGGGXXPPPXGGGWXXPPPAXXAPPPPXXG 1300 P P P G P +PP GG P P GG+ P PP P G Sbjct: 29 PAGYPQQGYPPPPGAYPPAGYPPGAYPP-APGGYPPAPGYGGYPPAPGYGGYPPAPGHG 86 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 36.3 bits (80), Expect = 0.044 Identities = 29/91 (31%), Positives = 29/91 (31%), Gaps = 4/91 (4%) Frame = +3 Query: 1029 PPXXPXXXXPPXPPXGX-PPPXXXFFSXPXA---LPPXKXPXXSPPXGGGGXXSXKNPPV 1196 PP P PP PP PPP S P L P P P S PPV Sbjct: 98 PPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPPV 157 Query: 1197 XFLPXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 F P P P PP PP P Sbjct: 158 LFSPPPPTVTRPPPPPTITRSPP----PPRP 184 Score = 35.1 bits (77), Expect = 0.10 Identities = 25/93 (26%), Positives = 26/93 (27%), Gaps = 5/93 (5%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXP-----XXPPPGXGGGXXXSKTX 1191 PPP PPP PPP F P P R P PPP KT Sbjct: 135 PPPPVNLSPPPPPVLLSPPPPPVLFSPPPPTVTRPPPPPTITRSPPPPRPQAAAYYKKTP 194 Query: 1192 PXFSSXGGGXXXXXPXRGXVGXAPPXGXXPPXP 1290 P G P + PP P Sbjct: 195 PPPPYKYGRVYPPPPPPPQAARSYKRSPPPPPP 227 Score = 30.7 bits (66), Expect = 2.2 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 +PPP PPP P PPP P P PPP Sbjct: 70 SPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPP--PPP 111 Score = 30.7 bits (66), Expect = 2.2 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 +PPP PPP P PPP P P PPP Sbjct: 106 SPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPP--PPP 147 Score = 30.3 bits (65), Expect = 2.9 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 +PPP PPP PPP P P P PPP Sbjct: 53 SPPPPVNLSPPPPPVNLSPPPPPVNLSPPP---PPVNLSPPPPP 93 Score = 29.9 bits (64), Expect = 3.9 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP P P P PPP Sbjct: 45 PPPPVNISSPPPPVNLSPPPPPVNLSPPP---PPVNLSPPPPP 84 Score = 29.9 bits (64), Expect = 3.9 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPP 1152 +PPP PPP P PPP P P P PP Sbjct: 97 SPPPPPVNLSPPPPPVNLSPPPPPVLL-SPPPPPVLLSPPPPP 138 Score = 29.5 bits (63), Expect = 5.1 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPP-XGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 +PPP PPP P PPP P P P PPP Sbjct: 79 SPPPPPVNLSPPPPPVLLSPPPPPVNLSPPP---PPVNLSPPPPP 120 Score = 29.1 bits (62), Expect = 6.7 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPP-XGXPPPXXXFFPXPXXXPRXKXPXXPP 1152 +PPP PPP P PPP P P P P PP Sbjct: 61 SPPPPPVNLSPPPPPVNLSPPPPPVNLSPPP--PPVLLSPPPPP 102 Score = 29.1 bits (62), Expect = 6.7 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPP-XGXPPPXXXFFPXPXXXPRXKXPXXPP 1152 +PPP PPP P PPP P P P P PP Sbjct: 88 SPPPPPVLLSPPPPPVNLSPPPPPVNLSPPP--PPVLLSPPPPP 129 Score = 29.1 bits (62), Expect = 6.7 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPP-XGXPPPXXXFFPXPXXXPRXKXPXXPP 1152 +PPP PPP P PPP P P P P PP Sbjct: 115 SPPPPPVLLSPPPPPVLLSPPPPPVNLSPPP--PPVLLSPPPPP 156 Score = 28.7 bits (61), Expect = 8.9 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 +PPP PPP PP PP P P P PPP Sbjct: 124 SPPPPPVLLSPPP-PPVNLSPPPPPVLLSPPPPPVLFSP--PPP 164 Score = 28.7 bits (61), Expect = 8.9 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = -3 Query: 1248 PPPXGGGXXPPPPXGGKXRXGF*XXPPPPXP 1156 PP G PPPP + + PPPP P Sbjct: 197 PPYKYGRVYPPPPPPPQAARSYKRSPPPPPP 227 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 36.3 bits (80), Expect = 0.044 Identities = 38/152 (25%), Positives = 43/152 (28%), Gaps = 4/152 (2%) Frame = +3 Query: 846 SPXPRGXXPPXEGGXHRAPPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFXXGGXR 1025 SP R PP PP + R P P P P + Sbjct: 433 SPSVRAYSPPP-------PPYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPPPYVYSSPP 485 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXP----XALPPXKXPXXSPPXGGGGXXSXKNPP 1193 PPP PP PPP + S P + PP P PP S PP Sbjct: 486 PPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPC----PESSPPPP 541 Query: 1194 VXFLPXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 V + P P PP PP P Sbjct: 542 VVYY---APVTQSPPPPSPVYYPPVTQSPPPP 570 Score = 36.3 bits (80), Expect = 0.044 Identities = 39/159 (24%), Positives = 44/159 (27%), Gaps = 11/159 (6%) Frame = +3 Query: 846 SPXPRGXXPPXEGGXHRAPPXAXGPXQGRXXGXXPRPPPXX-----PXXXXXXXXWXXFX 1010 SP R PP PP P PPP P + Sbjct: 450 SPSVRAYPPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPYV 509 Query: 1011 XGGXRPP-----PXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXX 1175 PP P P PP P PPP +++ PP P PP Sbjct: 510 YSSPPPPYVYSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPV----TQ 565 Query: 1176 SXKNP-PVXFLPXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 S P PV + P P P PP PP P Sbjct: 566 SPPPPSPVYYPPV----TNSPPPPSPVYYPPVTYSPPPP 600 Score = 33.1 bits (72), Expect = 0.41 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 +PPP PPP PP PPP P P PPP Sbjct: 512 SPPPPYVYSSPPPPPP-SPPPPCPESSPPPPVVYYAPVTQSPPP 554 Score = 30.7 bits (66), Expect = 2.2 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP P PP + P P PPP Sbjct: 485 PPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPP 527 Score = 29.5 bits (63), Expect = 5.1 Identities = 13/43 (30%), Positives = 15/43 (34%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPP 1152 +PPP PPP PPP + P P PP Sbjct: 465 SPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPP 507 Score = 29.5 bits (63), Expect = 5.1 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPP 1154 PPP P P P PPP ++ PP P PP Sbjct: 612 PPPPSPLYYPPVTP--SPPPPSPVYYPPVTPSPPPPSPVYYPP 652 Score = 28.7 bits (61), Expect = 8.9 Identities = 25/89 (28%), Positives = 28/89 (31%), Gaps = 1/89 (1%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNP-PVXF 1202 PPP P P PPP ++ PP P PP S P PV + Sbjct: 582 PPPPSPVYYPPVT--YSPPPPSPVYYPQVTPSPPPPSPLYYPPV----TPSPPPPSPVYY 635 Query: 1203 LPXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 P P P PP PP P Sbjct: 636 PPV----TPSPPPPSPVYYPPVTPSPPPP 660 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 35.9 bits (79), Expect = 0.059 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = +2 Query: 1136 PPXXPPXGXGGGGLXQKPXRXFPPXGGGGXXPPPXGG--GWXXPPPAXXAPPPP 1291 PP P G +P PP G GG PPP G G PPP P P Sbjct: 372 PPVPAPQMPSSAG-PPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAP 424 Score = 35.1 bits (77), Expect = 0.10 Identities = 24/79 (30%), Positives = 27/79 (34%) Frame = +3 Query: 1029 PPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFLP 1208 PP P PPP P + P + P +PP G GG K PP P Sbjct: 353 PPEPPKFLKVSSKKASAPPPPVPAPQMPSSAGPPRPPPPAPPPGSGG---PKPPP----P 405 Query: 1209 XGGXGAXXPXPGXGGXXPP 1265 G G P P G P Sbjct: 406 PGPKGPRPPPPMSLGPKAP 424 Score = 34.3 bits (75), Expect = 0.18 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -3 Query: 1248 PPPXGGGXXPPPPXGGKXRXGF*XXPPPPXPXG 1150 PPP GG PPPP G K PPPP G Sbjct: 393 PPPGSGGPKPPPPPGPKG-----PRPPPPMSLG 420 Score = 31.5 bits (68), Expect = 1.3 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGG 1166 P P P PP PP PPP P P K P PP G Sbjct: 375 PAPQMPSSAGPPRPPPPAPPPGSG-GPKPPPPPGPKGPRPPPPMSLG 420 Score = 30.3 bits (65), Expect = 2.9 Identities = 17/59 (28%), Positives = 17/59 (28%) Frame = +3 Query: 900 PPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFXXGGXRPPPXXPXXXXPPXPPXG 1076 PP P G PPP P G RPPP P PP G Sbjct: 371 PPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSG 429 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 35.9 bits (79), Expect = 0.059 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = +2 Query: 1136 PPXXPPXGXGGGGLXQKPXRXFPPXGGGGXXPPPXGG--GWXXPPPAXXAPPPP 1291 PP P G +P PP G GG PPP G G PPP P P Sbjct: 372 PPVPAPQMPSSAG-PPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAP 424 Score = 35.1 bits (77), Expect = 0.10 Identities = 24/79 (30%), Positives = 27/79 (34%) Frame = +3 Query: 1029 PPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFLP 1208 PP P PPP P + P + P +PP G GG K PP P Sbjct: 353 PPEPPKFLKVSSKKASAPPPPVPAPQMPSSAGPPRPPPPAPPPGSGG---PKPPP----P 405 Query: 1209 XGGXGAXXPXPGXGGXXPP 1265 G G P P G P Sbjct: 406 PGPKGPRPPPPMSLGPKAP 424 Score = 34.3 bits (75), Expect = 0.18 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -3 Query: 1248 PPPXGGGXXPPPPXGGKXRXGF*XXPPPPXPXG 1150 PPP GG PPPP G K PPPP G Sbjct: 393 PPPGSGGPKPPPPPGPKG-----PRPPPPMSLG 420 Score = 31.5 bits (68), Expect = 1.3 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGG 1166 P P P PP PP PPP P P K P PP G Sbjct: 375 PAPQMPSSAGPPRPPPPAPPPGSG-GPKPPPPPGPKGPRPPPPMSLG 420 Score = 30.3 bits (65), Expect = 2.9 Identities = 17/59 (28%), Positives = 17/59 (28%) Frame = +3 Query: 900 PPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFXXGGXRPPPXXPXXXXPPXPPXG 1076 PP P G PPP P G RPPP P PP G Sbjct: 371 PPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSG 429 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 35.9 bits (79), Expect = 0.059 Identities = 29/106 (27%), Positives = 30/106 (28%) Frame = +3 Query: 843 FSPXPRGXXPPXEGGXHRAPPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFXXGGX 1022 +SP P PP PP P P PPP P Sbjct: 550 YSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPP--PVHSPPPPPVFSPPPPVF 607 Query: 1023 RPPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXG 1160 PPP P P PP PPP P PP PP G Sbjct: 608 SPPP--PSPVYSPPPPSHSPPPPVYSPPPPTFSPPPTHNTNQPPMG 651 Score = 34.7 bits (76), Expect = 0.14 Identities = 25/86 (29%), Positives = 26/86 (30%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFL 1205 PP P PP P PPP P PP P SPP S PP + Sbjct: 577 PPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPP-----PPSHSPPPPVYS 631 Query: 1206 PXGGXGAXXPXPGXGGXXPPXRXXPP 1283 P P P PP P Sbjct: 632 PP--PPTFSPPPTHNTNQPPMGAPTP 655 Score = 33.1 bits (72), Expect = 0.41 Identities = 23/88 (26%), Positives = 23/88 (26%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFL 1205 PPP P P P PPP P P SPP PP Sbjct: 534 PPPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHS 593 Query: 1206 PXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 P P P P PP P Sbjct: 594 PPPPPVFSPPPPVFSPPPPSPVYSPPPP 621 Score = 31.9 bits (69), Expect = 0.96 Identities = 24/88 (27%), Positives = 25/88 (28%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFL 1205 P P P PP P PPP P P PP PP F Sbjct: 543 PSPPSPIYSPPP-PVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFS 601 Query: 1206 PXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 P + P P PP PP P Sbjct: 602 PPPPVFS-PPPPSPVYSPPPPSHSPPPP 628 Score = 31.5 bits (68), Expect = 1.3 Identities = 24/88 (27%), Positives = 26/88 (29%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFL 1205 PP PP PP P P +S P PP P P +PP Sbjct: 525 PPKVEDTRVPPPQPPMPSPSPPSPIYSPP---PPVHSP-PPPVYSSPPPPHVYSPPP--- 577 Query: 1206 PXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 P P P PP PP P Sbjct: 578 PVASPPPPSPPPPVHSPPPPPVFSPPPP 605 Score = 29.1 bits (62), Expect = 6.7 Identities = 25/89 (28%), Positives = 26/89 (29%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPPGXGGGXXXSKTXPXFS 1203 +PPP PPP PPP P P P P P S P FS Sbjct: 551 SPPPPVHS--PPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFS 608 Query: 1204 SXGGGXXXXXPXRGXVGXAPPXGXXPPXP 1290 P V PP PP P Sbjct: 609 ---------PPPPSPVYSPPPPSHSPPPP 628 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 35.5 bits (78), Expect = 0.078 Identities = 21/51 (41%), Positives = 23/51 (45%) Frame = +2 Query: 1139 PXXPPXGXGGGGLXQKPXRXFPPXGGGGXXPPPXGGGWXXPPPAXXAPPPP 1291 P PP GG Q+P PP GG PPP G PPP+ PPP Sbjct: 184 PGPPPPQYGG---QQRPMM-IPPPGGMMRGPPPP-HGMQGPPPSRPGMPPP 229 Score = 34.7 bits (76), Expect = 0.14 Identities = 31/110 (28%), Positives = 33/110 (30%) Frame = +3 Query: 915 GPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFXXGGXRPPPXXPXXXXPPXPPXGXPPPXX 1094 GP G RPP GG PPP P PP P G PPP Sbjct: 138 GPAPGMMQPQISRPPQIIRPPGQMPPQPPFAGQGG--PPP--PYGMRPPYP--GPPPPQY 191 Query: 1095 XFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFLPXGGXGAXXPXPG 1244 P +PP PP G + P P G P PG Sbjct: 192 GGQQRPMMIPPPGGMMRGPPPPHGMQGPPPSRPGMPPPGGAPMFAPPHPG 241 Score = 29.5 bits (63), Expect = 5.1 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 1152 PXGGGGXXSXKNPPVXFLPXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 P G PP P G P G GG PP PP P Sbjct: 139 PAPGMMQPQISRPPQIIRPPGQMPPQPPFAGQGGPPPPYGMRPPYP 184 Score = 29.5 bits (63), Expect = 5.1 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP P P P P P Sbjct: 201 PPPGGMMRGPPPPHGMQGPPPSRPGMPPPGGAPMFAPPHPGMP 243 Score = 28.7 bits (61), Expect = 8.9 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 1202 PPXGGGGXXPPPXGGGWXXPPPAXXAPPPPXXG 1300 PP G G PPP G PP PPPP G Sbjct: 165 PPFAGQGGPPPPYG---MRPP--YPGPPPPQYG 192 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 35.5 bits (78), Expect = 0.078 Identities = 27/89 (30%), Positives = 30/89 (33%), Gaps = 1/89 (1%) Frame = +3 Query: 1026 PPPXXPXXXXPPX-PPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXF 1202 PP P PP PP PPP P A+ P P +PP PP+ Sbjct: 85 PPALPPKPLPPPLSPPQTTPPP-------PPAITPPPPPAITPPLSPPPPAITPPPPLAT 137 Query: 1203 LPXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 P A P P PP PP P Sbjct: 138 TPP----ALPPKPLPPPLSPPQTTPPPPP 162 Score = 34.3 bits (75), Expect = 0.18 Identities = 31/107 (28%), Positives = 33/107 (30%), Gaps = 2/107 (1%) Frame = +3 Query: 849 PXPRGXXPPXEGGXHRA-PPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFXXGGXR 1025 P P+ PP A PP P P PP P Sbjct: 71 PPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAIT 130 Query: 1026 PPPXXPXXXXPPX-PPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGG 1163 PPP P PP PP PPP + P PP P SPP G Sbjct: 131 PPP--PLATTPPALPPKPLPPPLSPPQTTPPP-PPAITPPLSPPLVG 174 Score = 30.3 bits (65), Expect = 2.9 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +1 Query: 1030 PPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPP 1152 PP PP PP PPP P P P PP Sbjct: 131 PPPPLATTPPALPPKPLPPPLSPPQTTPPPPPAITPPLSPP 171 Score = 28.7 bits (61), Expect = 8.9 Identities = 24/90 (26%), Positives = 25/90 (27%), Gaps = 4/90 (4%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXP--XALPPXKXPXXSPPXGGGGXXSXKNPPVX 1199 P P P P P PPP S P PP P PP + PP Sbjct: 51 PQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPPAI 110 Query: 1200 F--LPXGGXGAXXPXPGXGGXXPPXRXXPP 1283 P P P PP PP Sbjct: 111 TPPPPPAITPPLSPPPPAITPPPPLATTPP 140 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 35.5 bits (78), Expect = 0.078 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP P PPP P P P PPP Sbjct: 113 PPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPP 155 Score = 34.7 bits (76), Expect = 0.14 Identities = 38/151 (25%), Positives = 41/151 (27%), Gaps = 4/151 (2%) Frame = +3 Query: 849 PXPRGXXPPXEGGXHRAPPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFXXGGXRP 1028 P P PP PP P PPP P +P Sbjct: 34 PSPHPVKPPKHPAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTP----KPPTVKP 89 Query: 1029 PPXXPXXXXPPXPPXGXPPPXXXFFSXPXAL--PPXKXPXXSPPXG--GGGXXSXKNPPV 1196 PP P PP P PPP P + PP P PP + K PP Sbjct: 90 PPP-PYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPP 148 Query: 1197 XFLPXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 P P P PP PP P Sbjct: 149 ---PVVTPPPPTPTPEAPCPPPPPTPYPPPP 176 Score = 32.3 bits (70), Expect = 0.72 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +1 Query: 1024 APPPXXXXXXPP---PXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 A PP PP P PP PPP P P P+ PPP Sbjct: 46 AKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPP 92 Score = 32.3 bits (70), Expect = 0.72 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +1 Query: 1030 PPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PP PPP P PPP + P P P PP Sbjct: 105 PPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPP 146 Score = 31.9 bits (69), Expect = 0.96 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP P PPP P P P P P Sbjct: 121 PPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAP 163 Score = 30.3 bits (65), Expect = 2.9 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PP PP PPP P P P K P P P Sbjct: 89 PPPPPY--VKPPPPPTVKPPPPPYVKPPP--PPTVKPPPPPTP 127 Score = 30.3 bits (65), Expect = 2.9 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 1030 PPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPP 1152 PP PPP P PPP P P P P PP Sbjct: 130 PPPPTPYTPPP-PTVKPPPPPVVTPPPPTPTPEAPCPPPPP 169 Score = 29.5 bits (63), Expect = 5.1 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXP--PP 1155 PPP PP PP PPP P P P P P PP Sbjct: 98 PPPPTV---KPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPP 139 Score = 28.7 bits (61), Expect = 8.9 Identities = 24/88 (27%), Positives = 25/88 (28%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFL 1205 PP P PP P P P P PP P PP PP + Sbjct: 31 PPKPSPHPVKPPKHPAKPPKP-------PTVKPPTHTP--KPPTVKPPPPYIPCPPPPYT 81 Query: 1206 PXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 P P P PP PP P Sbjct: 82 PKPPTVKPPPPPYVKPPPPPTVKPPPPP 109 Score = 28.7 bits (61), Expect = 8.9 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 Query: 1229 PPPXGGGWXXPPPAXXAPPPP 1291 PPP + PPP PPPP Sbjct: 121 PPPPPTPYTPPPPTPYTPPPP 141 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 35.5 bits (78), Expect = 0.078 Identities = 27/80 (33%), Positives = 27/80 (33%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFL 1205 PPP P PP P PPP FS PP P SPP S PP Sbjct: 411 PPPPPPSPPLPP--PVYSPPPSPPVFS-----PPPSPPVYSPPPPPSIHYSSPPPP---- 459 Query: 1206 PXGGXGAXXPXPGXGGXXPP 1265 P P P G PP Sbjct: 460 PVHHSSPPPPSPEFEGPLPP 479 Score = 33.9 bits (74), Expect = 0.24 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 +PPP PPP PP PPP P PPP Sbjct: 426 SPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHSSPPPP 469 Score = 31.5 bits (68), Expect = 1.3 Identities = 15/44 (34%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPXGXPPPXXXFF-PXPXXXPRXKXPXXPP 1152 +PP PPP PP PPP + P P P PP Sbjct: 417 SPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPP 460 Score = 28.7 bits (61), Expect = 8.9 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 4/48 (8%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPXG----XPPPXXXFFPXPXXXPRXKXPXXPPP 1155 +PP PPP PP PPP F P P P PPP Sbjct: 404 SPPIVALPPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPP--PPP 449 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 35.5 bits (78), Expect = 0.078 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +3 Query: 1026 PPPXXPXXXXPPXP---PXGXPPPXXXFFSXPXALPPXKXPXXSPP 1154 PPP P PP P P PPP + P PP P PP Sbjct: 70 PPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPPPP 115 Score = 35.5 bits (78), Expect = 0.078 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +1 Query: 1027 PPPXXXXXXPPPXP---PXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP P P PPP + P P P PPP Sbjct: 70 PPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPPPP 115 Score = 29.1 bits (62), Expect = 6.7 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 3/46 (6%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFP---XPXXXPRXKXPXXPPP 1155 P P PPP PP PPP P P P PPP Sbjct: 61 PLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPP 106 >At1g29380.1 68414.m03592 hypothetical protein Length = 228 Score = 35.5 bits (78), Expect = 0.078 Identities = 25/75 (33%), Positives = 26/75 (34%) Frame = -2 Query: 1249 PXPGXGXXAPXPPXGRKXTGGFLXEXXPPPPXGGXXXGXXXGGXAXGXEKXXXXGGGXPX 1070 P P P G TGG+ PP GG G GG G GGG Sbjct: 65 PGPTTPTGGYPPLDGTTPTGGYPPLYGTTPPGGGDVGGGG-GGYGGGTPGGGGGGGGDTG 123 Query: 1069 GGXGGXXLXGXXGGG 1025 G GG G GGG Sbjct: 124 AGAGG---GGYGGGG 135 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 35.5 bits (78), Expect = 0.078 Identities = 26/86 (30%), Positives = 29/86 (33%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFL 1205 PPP P PP P PPP S P PP + P +P NPP Sbjct: 100 PPPPLPTEAPPPANPVSSPPPE----SSPPPPPPTEAPPTTPIT---SPSPPTNPPPP-- 150 Query: 1206 PXGGXGAXXPXPGXGGXXPPXRXXPP 1283 P P P PP + PP Sbjct: 151 PESPPSLPAPDP-PSNPLPPPKLVPP 175 Score = 34.3 bits (75), Expect = 0.18 Identities = 38/152 (25%), Positives = 40/152 (26%), Gaps = 4/152 (2%) Frame = +3 Query: 846 SPXPRGXXPPXEGGXHRAPPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXX-WXXFXXGGX 1022 SP P PP APP P P PPP P Sbjct: 117 SPPPESSPPPPP--PTEAPPTT--PITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPPKL 172 Query: 1023 RPPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXS---PPXGGGGXXSXKNPP 1193 PP P P P PPP S P + P P S P G + PP Sbjct: 173 VPPSHSPPRHLPSPPASEIPPPPRHLPSPPASERPSTPPSDSEHPSPPPPGHPKRREQPP 232 Query: 1194 VXFLPXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 P G P P PP P Sbjct: 233 ----PPGSKRPTPSPPSPSDSKRPVHPSPPSP 260 Score = 30.7 bits (66), Expect = 2.2 Identities = 19/66 (28%), Positives = 20/66 (30%) Frame = +1 Query: 958 PPXXPPXXXXXXFGXFXLXGGXAPPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKX 1137 PP P G +PPP PPP P PP P P P Sbjct: 71 PPPEPSPPSPSLTGPPPTTIPVSPPPEPSP--PPPLPTEAPPPANPVSSPPPESSPPPPP 128 Query: 1138 PXXPPP 1155 P PP Sbjct: 129 PTEAPP 134 Score = 29.9 bits (64), Expect = 3.9 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPP 1152 +PPP PPP P PPP P P P P Sbjct: 99 SPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTPITSP 141 >At4g20020.2 68417.m02930 expressed protein Length = 406 Score = 35.1 bits (77), Expect = 0.10 Identities = 18/48 (37%), Positives = 21/48 (43%) Frame = +2 Query: 1148 PPXGXGGGGLXQKPXRXFPPXGGGGXXPPPXGGGWXXPPPAXXAPPPP 1291 PP GGG + P G G PPP GG+ P +PPPP Sbjct: 227 PPMQGGGGSYGPQQGYATPGQGQGTQAPPPFQGGYNQGP---RSPPPP 271 Score = 31.1 bits (67), Expect = 1.7 Identities = 20/54 (37%), Positives = 21/54 (38%) Frame = -3 Query: 1299 PXXGGGGAXXAGGGXXHPPPXGGGXXPPPPXGGKXRXGF*XXPPPPXPXGGXXG 1138 P GGGG+ G P G G PPP G G PPPP G G Sbjct: 228 PMQGGGGSYGPQQGYA-TPGQGQGTQAPPPFQGGYNQG-PRSPPPPYQAGYNQG 279 >At4g20020.1 68417.m02931 expressed protein Length = 419 Score = 35.1 bits (77), Expect = 0.10 Identities = 18/48 (37%), Positives = 21/48 (43%) Frame = +2 Query: 1148 PPXGXGGGGLXQKPXRXFPPXGGGGXXPPPXGGGWXXPPPAXXAPPPP 1291 PP GGG + P G G PPP GG+ P +PPPP Sbjct: 227 PPMQGGGGSYGPQQGYATPGQGQGTQAPPPFQGGYNQGP---RSPPPP 271 Score = 31.1 bits (67), Expect = 1.7 Identities = 20/54 (37%), Positives = 21/54 (38%) Frame = -3 Query: 1299 PXXGGGGAXXAGGGXXHPPPXGGGXXPPPPXGGKXRXGF*XXPPPPXPXGGXXG 1138 P GGGG+ G P G G PPP G G PPPP G G Sbjct: 228 PMQGGGGSYGPQQGYA-TPGQGQGTQAPPPFQGGYNQG-PRSPPPPYQAGYNQG 279 >At3g06750.1 68416.m00800 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 147 Score = 35.1 bits (77), Expect = 0.10 Identities = 23/62 (37%), Positives = 25/62 (40%), Gaps = 12/62 (19%) Frame = +2 Query: 1136 PPXXPPXGXGGGG--LXQKPX-------RXFPPXGG---GGXXPPPXGGGWXXPPPAXXA 1279 PP PP GGGG P + PP GG GG PPP G + PPP Sbjct: 51 PPPPPPSSSGGGGSYYYSPPPPSSSGGVKYPPPYGGDGYGGYYPPPYYGNYGTPPPPNPI 110 Query: 1280 PP 1285 P Sbjct: 111 VP 112 Score = 30.3 bits (65), Expect = 2.9 Identities = 17/42 (40%), Positives = 19/42 (45%) Frame = -3 Query: 1290 GGGGAXXAGGGXXHPPPXGGGXXPPPPXGGKXRXGF*XXPPP 1165 GGGG+ PP GG PPP GG G+ PPP Sbjct: 60 GGGGSYYYS---PPPPSSSGGVKYPPPYGGDGYGGY--YPPP 96 Score = 29.1 bits (62), Expect = 6.7 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = -3 Query: 1251 HPPPXGGGXXPPPPXGGKXRXGF*XXPPPPXPXGG 1147 +P P PPPP + PPPP GG Sbjct: 43 NPVPSSYSPPPPPPSSSGGGGSYYYSPPPPSSSGG 77 >At2g04170.1 68415.m00402 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to NtN2 [Medicago truncatula] GI:3776084; contains Pfam profile PF00917: MATH domain Length = 420 Score = 35.1 bits (77), Expect = 0.10 Identities = 21/59 (35%), Positives = 21/59 (35%) Frame = -3 Query: 1299 PXXGGGGAXXAGGGXXHPPPXGGGXXPPPPXGGKXRXGF*XXPPPPXPXGGXXGGFXXG 1123 P GG G G G P P G P P GG G P P P GG G G Sbjct: 52 PGFGGRGPRGPGFGPRGPGPWSGPRGPRPGGGGGPGPGPWSGPRGPRPGGGGGPGSGCG 110 Score = 33.1 bits (72), Expect = 0.41 Identities = 31/110 (28%), Positives = 32/110 (29%), Gaps = 3/110 (2%) Frame = -2 Query: 1162 PPXGGXXXGXXXGGXAXGXEKXXXXGGGXPXGGXGGXXLXGXXG-GGRXP--PXXKXXQX 992 P GG G GG G GG G G G G GGR P P Sbjct: 10 PGRGGRGFGGRGGGPGFGPGGPGFGPGGPGFGPGGPGFGPGGPGFGGRGPRGPGFGPRGP 69 Query: 991 XXXXXXXGXXGGGRGXXPXXRPWXGPXAXGGARXHPPSXGGXXPLGXGEK 842 G GG G P PW GP P G G G + Sbjct: 70 GPWSGPRGPRPGG-GGGPGPGPWSGPRGPRPGGGGGPGSGCGSGTGGGNQ 118 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 35.1 bits (77), Expect = 0.10 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P P PPP Sbjct: 132 PPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPP 174 Score = 34.3 bits (75), Expect = 0.18 Identities = 18/66 (27%), Positives = 20/66 (30%) Frame = +1 Query: 958 PPXXPPXXXXXXFGXFXLXGGXAPPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKX 1137 PP PP + PPP PPP PPP + P P Sbjct: 169 PPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYS 228 Query: 1138 PXXPPP 1155 PPP Sbjct: 229 SPPPPP 234 Score = 33.9 bits (74), Expect = 0.24 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPP--XGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 +PPP PPP PP PPP + P P PPP Sbjct: 159 SPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPP 204 Score = 31.9 bits (69), Expect = 0.96 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 72 PPPYVYSSPPPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPPPP 114 Score = 31.9 bits (69), Expect = 0.96 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 82 PPPYVYNSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 124 Score = 31.9 bits (69), Expect = 0.96 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 102 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 144 Score = 31.9 bits (69), Expect = 0.96 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 122 PPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPP 164 Score = 31.9 bits (69), Expect = 0.96 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 152 PPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPP 194 Score = 31.9 bits (69), Expect = 0.96 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 212 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 254 Score = 31.9 bits (69), Expect = 0.96 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 232 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 274 Score = 31.9 bits (69), Expect = 0.96 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 252 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 294 Score = 31.9 bits (69), Expect = 0.96 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 272 PPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPP 314 Score = 31.9 bits (69), Expect = 0.96 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 282 PPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPP 324 Score = 31.9 bits (69), Expect = 0.96 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 292 PPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYTSPPPPP 334 Score = 31.5 bits (68), Expect = 1.3 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 62 PPPYIYSSPPPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPPPP 104 Score = 31.1 bits (67), Expect = 1.7 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 92 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 134 Score = 31.1 bits (67), Expect = 1.7 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 112 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPP 154 Score = 31.1 bits (67), Expect = 1.7 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 142 PPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPP 184 Score = 31.1 bits (67), Expect = 1.7 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 202 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 244 Score = 31.1 bits (67), Expect = 1.7 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 222 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 264 Score = 31.1 bits (67), Expect = 1.7 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 242 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 284 Score = 31.1 bits (67), Expect = 1.7 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 262 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPP 304 Score = 31.1 bits (67), Expect = 1.7 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 302 PPPYVYSSPPPPPYVYKSPPPPPYVYTSPPPPPYVYKSPPPPP 344 Score = 30.7 bits (66), Expect = 2.2 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 2/61 (3%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPX--GXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVX 1199 PPP PP PP PPP +S P PP SPP S PP Sbjct: 70 PPPPPYVYSSPPPPPYVYNSPPPPPYVYSSP---PPPPYVYKSPPPPPYVYSSPPPPPYV 126 Query: 1200 F 1202 + Sbjct: 127 Y 127 Score = 30.7 bits (66), Expect = 2.2 Identities = 15/46 (32%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPX---GXPPPXXXFFPXPXXXPRXKXPXXPP 1152 +PPP PP PP PPP + P P + P PP Sbjct: 139 SPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPP 184 Score = 30.7 bits (66), Expect = 2.2 Identities = 20/63 (31%), Positives = 23/63 (36%), Gaps = 3/63 (4%) Frame = +3 Query: 1023 RPPPXXPXXXXPPXPP---XGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPP 1193 + PP P PP PP PPP +S P PP SPP S PP Sbjct: 158 KSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSP---PPPPYVYKSPPPPPYVYSSPPPPP 214 Query: 1194 VXF 1202 + Sbjct: 215 YVY 217 Score = 30.7 bits (66), Expect = 2.2 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 2/61 (3%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPX--GXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVX 1199 PPP PP PP PPP +S P PP SPP S PP Sbjct: 270 PPPPPYVYKSPPPPPYVYSSPPPPPYVYSSP---PPPPYVYSSPPPPPYVYKSPPPPPYV 326 Query: 1200 F 1202 + Sbjct: 327 Y 327 Score = 30.7 bits (66), Expect = 2.2 Identities = 25/83 (30%), Positives = 27/83 (32%), Gaps = 3/83 (3%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPX---GXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPV 1196 PPP PP PP PPP + S P PP SPP K PP Sbjct: 310 PPPPPYVYKSPPPPPYVYTSPPPPPYVYKSPP---PPPYVDSYSPPP---APYVYKPPPY 363 Query: 1197 XFLPXGGXGAXXPXPGXGGXXPP 1265 + P P P PP Sbjct: 364 VYKPPPYVYNYSPPPAPYVYKPP 386 Score = 30.3 bits (65), Expect = 2.9 Identities = 26/90 (28%), Positives = 28/90 (31%), Gaps = 2/90 (2%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPX--GXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVX 1199 PPP PP PP PPP +S P PP SPP S PP Sbjct: 90 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP---PPPPYVYKSPPPPPYVYSSPPPPPYV 146 Query: 1200 FLPXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 + P PP PP P Sbjct: 147 Y----SSPPPPPYVYKSPPPPPYVYSPPPP 172 Score = 29.9 bits (64), Expect = 3.9 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 2/61 (3%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPX--GXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVX 1199 PPP PP PP PPP +S P PP SPP S PP Sbjct: 200 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP---PPPPYVYKSPPPPPYVYSSPPPPPYV 256 Query: 1200 F 1202 + Sbjct: 257 Y 257 Score = 29.9 bits (64), Expect = 3.9 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 2/61 (3%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPX--GXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVX 1199 PPP PP PP PPP +S P PP SPP S PP Sbjct: 220 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP---PPPPYVYKSPPPPPYVYSSPPPPPYV 276 Query: 1200 F 1202 + Sbjct: 277 Y 277 Score = 29.9 bits (64), Expect = 3.9 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 2/61 (3%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPX--GXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVX 1199 PPP PP PP PPP +S P PP SPP S PP Sbjct: 240 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP---PPPPYVYKSPPPPPYVYSSPPPPPYV 296 Query: 1200 F 1202 + Sbjct: 297 Y 297 Score = 29.9 bits (64), Expect = 3.9 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 2/61 (3%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPX--GXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVX 1199 PPP PP PP PPP +S P PP SPP S PP Sbjct: 260 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP---PPPPYVYSSPPPPPYVYSSPPPPPYV 316 Query: 1200 F 1202 + Sbjct: 317 Y 317 Score = 29.5 bits (63), Expect = 5.1 Identities = 15/45 (33%), Positives = 16/45 (35%), Gaps = 2/45 (4%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPX--GXPPPXXXFFSXPXALPPXKXPXXSPP 1154 PPP PP PP PPP + P P P PP Sbjct: 130 PPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPP 174 Score = 29.5 bits (63), Expect = 5.1 Identities = 26/90 (28%), Positives = 29/90 (32%), Gaps = 2/90 (2%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPX--GXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVX 1199 PPP PP PP PPP + P PP SPP K+PP Sbjct: 290 PPPPPYVYSSPPPPPYVYSSPPPPPYVYKSP---PPPPYVYTSPPP---PPYVYKSPP-- 341 Query: 1200 FLPXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 P + P P PP P P Sbjct: 342 --PPPYVDSYSPPPAPYVYKPPPYVYKPPP 369 Score = 29.1 bits (62), Expect = 6.7 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 4/48 (8%) Frame = +3 Query: 1023 RPPPXXPXXXXPPXPPXGXPPPXXXFFSXPXA----LPPXKXPXXSPP 1154 +PPP PP P PPP +S P A PP SPP Sbjct: 366 KPPPYVYNYSPPPAPYVYKPPPYVYSYSPPPAPYVYKPPPYVYSYSPP 413 Score = 29.1 bits (62), Expect = 6.7 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXP 1149 PPP PPP P PPP P P P P P Sbjct: 403 PPPYVYSYSPPPAPYVYKPPPYVYSSPSP--PPYYSSPSPP 441 Score = 28.7 bits (61), Expect = 8.9 Identities = 17/49 (34%), Positives = 19/49 (38%), Gaps = 5/49 (10%) Frame = +3 Query: 1023 RPPPXXPXXXXPPXPPXGXPPPXXXFFSXPXA-----LPPXKXPXXSPP 1154 +PPP PP P PPP +S P A PP SPP Sbjct: 384 KPPPYVYSYSPPPAPYVYKPPPYVYSYSPPPAPYVYKPPPYVYSSPSPP 432 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 34.7 bits (76), Expect = 0.14 Identities = 19/57 (33%), Positives = 20/57 (35%), Gaps = 1/57 (1%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPP-PXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPP 1193 P P P PP PP P P FS P PP P PP + PP Sbjct: 23 PVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPP 79 Score = 32.7 bits (71), Expect = 0.55 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP P PPP P P PPP Sbjct: 26 PPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPP 68 Score = 29.5 bits (63), Expect = 5.1 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PP PPP P PP +P P P PPP Sbjct: 46 PPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPPPHVLPPPP 88 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 34.7 bits (76), Expect = 0.14 Identities = 29/116 (25%), Positives = 31/116 (26%), Gaps = 2/116 (1%) Frame = +3 Query: 948 PRPPPXXPXXXXXXXXWXXFXXGGXRPPPXXPXXXXPPXPPXGXPPPXXXFFSXPXA-LP 1124 P P P P P P PP P P P + LP Sbjct: 169 PYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPDSPLP 228 Query: 1125 -PXKXPXXSPPXGGGGXXSXKNPPVXFLPXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 P P SP G PP P G + P PG P PP P Sbjct: 229 LPGPPPSSSPTPGPDSPLPSPGPPPSPSPTPGPDSPLPSPGPDSPLPSPGPDPPLP 284 Score = 32.3 bits (70), Expect = 0.72 Identities = 25/88 (28%), Positives = 27/88 (30%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFL 1205 PPP P PP P P P P P P PP +P L Sbjct: 166 PPPPYPSPLPPPPSPSPTPGPDSPL---PSPGPDSPLPLPGPPPSPSPTPGPDSP----L 218 Query: 1206 PXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 P G + P PG PP P P Sbjct: 219 PSPGPDSPLPLPG----PPPSSSPTPGP 242 Score = 29.1 bits (62), Expect = 6.7 Identities = 35/135 (25%), Positives = 39/135 (28%), Gaps = 1/135 (0%) Frame = +3 Query: 843 FSPXPRGXXPPXEGGXHRAPPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFXXGGX 1022 +S P PP PP + P G P P P P G Sbjct: 157 WSSDPPLPPPPPPYPSPLPPPPSPSPTPG-PDSPLPSPGPDSPLPLPGPPPSPSPTPGPD 215 Query: 1023 RPPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNP-PVX 1199 P P P P G PPP P + P P SP G +P P Sbjct: 216 SPLPSP--GPDSPLPLPG-PPPSSSPTPGPDSPLPSPGPPPSPSPTPGPDSPLPSPGPDS 272 Query: 1200 FLPXGGXGAXXPXPG 1244 LP G P PG Sbjct: 273 PLPSPGPDPPLPSPG 287 >At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibrillarin 2 GI:9965655 from [Arabidopsis thaliana] Length = 320 Score = 34.7 bits (76), Expect = 0.14 Identities = 24/74 (32%), Positives = 24/74 (32%), Gaps = 3/74 (4%) Frame = -1 Query: 1169 PPPXPGGGXXGXFXRGXXXGXGKKXXXGGGXPXGGXGGGXXXXXXGG---GAXPPXXKXX 999 P GGG G RG G GG GG GGG GG G PP Sbjct: 4 PLTGSGGGFSGGRGRGGYSGGRGDGGFSGGRGGGGRGGGRGFSDRGGRGRGRGPPRGGAR 63 Query: 998 PXXXXXXXGGXXGG 957 GG GG Sbjct: 64 GGRGPAGRGGMKGG 77 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 34.7 bits (76), Expect = 0.14 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 1154 GGGXXGXFXRGXXXGXGKKXXXGGGXPXGGXGGGXXXXXXGGG 1026 GGG G G G G K GGG GG GGG GGG Sbjct: 83 GGGGGGGISGG---GAGGKSGCGGGKSGGGGGGGKNGGGCGGG 122 Score = 34.3 bits (75), Expect = 0.18 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 1154 GGGXXGXFXRGXXXGXGKKXXXGGGXPXGGXGGG 1053 GGG RG G G K GGG GG GGG Sbjct: 16 GGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGG 49 Score = 31.1 bits (67), Expect = 1.7 Identities = 17/45 (37%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = -1 Query: 1154 GGGXXGXFXRGXXXG--XGKKXXXGGGXPXGGXGGGXXXXXXGGG 1026 GG G +G G G + GGG GG GGG GGG Sbjct: 5 GGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGG 49 Score = 31.1 bits (67), Expect = 1.7 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -1 Query: 1154 GGGXXGXFXRGXXXGXGKKXXXGGGXPXGGXGGGXXXXXXGGG 1026 G G G G G G+ GGG G GGG GGG Sbjct: 8 GSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGG 50 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 34.7 bits (76), Expect = 0.14 Identities = 25/86 (29%), Positives = 27/86 (31%), Gaps = 1/86 (1%) Frame = -2 Query: 1153 GGXXXGXXXGGXAXGXEKXXXXGGGXPXGGXGGXXLXGXXGGGRXPPXXKXXQXXXXXXX 974 GG GG G + GGG GG GG G GGG K + Sbjct: 91 GGGGSSGGRGGFGGGGGRGGGRGGGSYGGGYGGRGSGGRGGGGGDNSCFKCGEPGHMARE 150 Query: 973 XGXXGGG-RGXXPXXRPWXGPXAXGG 899 GGG G R G GG Sbjct: 151 CSQGGGGYSGGGGGGRYGSGGGGGGG 176 Score = 29.1 bits (62), Expect = 6.7 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = -1 Query: 1148 GXXGXFXRGXXXGXGKKXXXGGGXPXGGXGGGXXXXXXGGG 1026 G G +G G G GG GG GGG GGG Sbjct: 80 GPDGAPVQGNSGGGGSSGGRGGFGGGGGRGGGRGGGSYGGG 120 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 34.7 bits (76), Expect = 0.14 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXP 1139 PPP P P PP PPP P LPP P Sbjct: 51 PPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPP 88 Score = 30.3 bits (65), Expect = 2.9 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXP 1113 PPP P P PP PPP F P Sbjct: 70 PPPKKSSCPPSPLPPPPPPPPPNYVFTYP 98 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 34.3 bits (75), Expect = 0.18 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PP PP PP +P P P P PPP Sbjct: 69 PPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSP-PPTPISPPP 110 Score = 30.7 bits (66), Expect = 2.2 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP P PP PP +P P P P PPP Sbjct: 56 PPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSP-PPPPIYPPP 97 Score = 30.3 bits (65), Expect = 2.9 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = +3 Query: 1056 PPXPPXGXP---PPXXXFFSXPXALPPXKXPXXSPP 1154 PP PP P PP +S P A PP P SPP Sbjct: 42 PPPPPYRSPVTIPPPPPVYSRPVAFPP-PPPIYSPP 76 Score = 28.7 bits (61), Expect = 8.9 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPP 1127 PPP P P PP PPP P + PP Sbjct: 77 PPPIYPPPIYSPPPPPIYPPPIYSPPPTPISPPP 110 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 34.3 bits (75), Expect = 0.18 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXK--XPXXSPP 1154 P P P PP PP PPP P PP + P SPP Sbjct: 1074 PLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPP 1118 Score = 32.3 bits (70), Expect = 0.72 Identities = 19/65 (29%), Positives = 19/65 (29%) Frame = +3 Query: 954 PPPXXPXXXXXXXXWXXFXXGGXRPPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXK 1133 PPP P PPP P PP PP PP P PP Sbjct: 1069 PPPLPPLPPSPPPPSPPLPPSSLPPPP--PAALFPPLPPPPSQPPPPPLSPPPSPPPPPP 1126 Query: 1134 XPXXS 1148 P S Sbjct: 1127 PPSQS 1131 Score = 31.1 bits (67), Expect = 1.7 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +2 Query: 1124 PXXXPPXXPPXGXGGGGLXQKPXRXFPPXGGGGXXPPPXGGGWXXPPPAXXAPPPP 1291 P PP PP L P PP PPP + PP PPPP Sbjct: 1065 PQESPPPLPP-------LPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPP 1113 Score = 31.1 bits (67), Expect = 1.7 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +2 Query: 1124 PXXXPPXXPPXGXGGGGLXQKPXRXFPPXGGGGXXPPPXGGGWXXPPPAXXAPPPP 1291 P PP PP P FPP PPP PPP+ PPPP Sbjct: 1076 PPSPPPPSPPLPPSSLP-PPPPAALFPPLPPPPSQPPPPP---LSPPPSPPPPPPP 1127 Score = 31.1 bits (67), Expect = 1.7 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPP 1154 P P P PP PP PP S P PP P SPP Sbjct: 1082 PSPPLPPSSLPPPPPAALFPPLPPPPSQPP--PPPLSPPPSPP 1122 Score = 30.7 bits (66), Expect = 2.2 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXAL-PPXKXPXXSPP 1154 PPP P PP PP PP P AL PP P PP Sbjct: 1069 PPPLPPLPPSPP-PPSPPLPPSSLPPPPPAALFPPLPPPPSQPP 1111 Score = 29.9 bits (64), Expect = 3.9 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 +PPP P PP PPP F P P + P PP Sbjct: 1078 SPPPPSPPLPPSSLPP---PPPAALFPPLPPPPSQPPPPPLSPP 1118 Score = 29.1 bits (62), Expect = 6.7 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 P P PP PP PPP P P P PPP Sbjct: 1074 PLPPSPPPPSPPLPPSSLPPPP----PAALFPPLPPPPSQPPP 1112 Score = 28.7 bits (61), Expect = 8.9 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +3 Query: 1032 PXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPP 1154 P P PP PP PP P +LPP PP Sbjct: 1062 PPLPQESPPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPP 1102 Score = 28.7 bits (61), Expect = 8.9 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +1 Query: 1030 PPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PP PP P PPP FP P P + P PPP Sbjct: 1076 PPSPPPPSPPLPPSSLPPPPPAALFP-PLPPPPSQPP--PPP 1114 >At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; glycine-rich protein 16 (GRP16) PMID:11431566 Length = 244 Score = 34.3 bits (75), Expect = 0.18 Identities = 38/138 (27%), Positives = 43/138 (31%), Gaps = 3/138 (2%) Frame = -2 Query: 1195 TGGFLXEXXPPPPXGGXXXGXXXGGXAXGXEKXXXXGGGXPXGGXGGXXLXGXXGGGRXP 1016 +GG + G G GG + G +K GG P G GG G GG Sbjct: 112 SGGASGDKPGEMSGAGGPSGDKPGGASGGGDKPGGASGGGPGGASGGAS-GGASGGASG- 169 Query: 1015 PXXKXXQXXXXXXXXGXXGGGRGXXPXXRPWXGP-XAXGGARXHPPSXG-GXXPLG-XGE 845 G GG G P GP A GGA P G P G G Sbjct: 170 -------GASGGASGGGPGGASGGGPGGASGGGPGGASGGASGDKPEGAPGDKPGGAWGG 222 Query: 844 KXXRPPXEWXXXAGEGGR 791 K + P A G R Sbjct: 223 KPGKKPGHKPEGARGGKR 240 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 34.3 bits (75), Expect = 0.18 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 A PP PPP PP PPP P P + P PPP Sbjct: 301 ADPPPQKSIPPPPPPP---PPPLLQQPPPPPSVSKAPPPPPPPP 341 >At3g44340.1 68416.m04764 sec23/sec24 transport family protein contains Pfam domains PF04811: Sec23/Sec24 trunk domain, PF04815: Sec23/Sec24 helical domain and PF04810: Sec23/Sec24 zinc finger Length = 1096 Score = 34.3 bits (75), Expect = 0.18 Identities = 38/150 (25%), Positives = 40/150 (26%), Gaps = 15/150 (10%) Frame = +3 Query: 846 SPXPR-GXXPPXEGGXHRAPPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFXXGGX 1022 SP R G PP PP P G PP P G Sbjct: 81 SPMARPGPPPPAAMARPGGPPQVSQPGGFPPVGRPVAPPSNQPPFGGRPSTGPLVGGGSS 140 Query: 1023 RPPPXX-----PXXXXPPXPPXGX-------PPPXXXFFSXPX--ALPPXKXPXXSPPXG 1160 P P P P PP G PPP S P +P PP G Sbjct: 141 FPQPGGFPASGPPGGVPSGPPSGARPIGFGSPPPMGPGMSMPPPSGMPGGPLSNGPPPSG 200 Query: 1161 GGGXXSXKNPPVXFLPXGGXGAXXPXPGXG 1250 G PP +P G P P G Sbjct: 201 MHGGHLSNGPPPSGMPGGPLSNGPPPPMMG 230 Score = 30.3 bits (65), Expect = 2.9 Identities = 20/59 (33%), Positives = 22/59 (37%) Frame = +2 Query: 1124 PXXXPPXXPPXGXGGGGLXQKPXRXFPPXGGGGXXPPPXGGGWXXPPPAXXAPPPPXXG 1300 P P PP GG+ P P G G PPP G G PPP+ P G Sbjct: 144 PGGFPASGPP-----GGVPSGPPSGARPIGFGS--PPPMGPGMSMPPPSGMPGGPLSNG 195 Score = 29.5 bits (63), Expect = 5.1 Identities = 28/102 (27%), Positives = 30/102 (29%), Gaps = 16/102 (15%) Frame = +3 Query: 1023 RPPPXXPXXXXPPXPPXGXPP----------PXXXFFSXPXALPPXK------XPXXSPP 1154 RPPP P P PP G P P + P PP P S P Sbjct: 47 RPPPPMPGSGPRPSPPFGQSPQSFPQQQQQQPRPSPMARPGPPPPAAMARPGGPPQVSQP 106 Query: 1155 XGGGGXXSXKNPPVXFLPXGGXGAXXPXPGXGGXXPPXRXXP 1280 G PP P GG + P G G P P Sbjct: 107 GGFPPVGRPVAPPSNQPPFGGRPSTGPLVGGGSSFPQPGGFP 148 Score = 29.5 bits (63), Expect = 5.1 Identities = 18/48 (37%), Positives = 19/48 (39%) Frame = -3 Query: 1299 PXXGGGGAXXAGGGXXHPPPXGGGXXPPPPXGGKXRXGF*XXPPPPXP 1156 P GGG + GG P GG P P G GF PPP P Sbjct: 133 PLVGGGSSFPQPGGFPASGPPGG--VPSGPPSGARPIGF-GSPPPMGP 177 Score = 29.1 bits (62), Expect = 6.7 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = +2 Query: 1124 PXXXPPXXPPXGXGGGGLXQKPXRXFPPXGGGGXXPPPXGGGWXXPPPAXXAPPPPXXG 1300 P P P G G P PP GG P GGG P P P G Sbjct: 97 PGGPPQVSQPGGFPPVGRPVAPPSNQPPFGGRPSTGPLVGGGSSFPQPGGFPASGPPGG 155 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 33.9 bits (74), Expect = 0.24 Identities = 21/69 (30%), Positives = 22/69 (31%) Frame = -2 Query: 1153 GGXXXGXXXGGXAXGXEKXXXXGGGXPXGGXGGXXLXGXXGGGRXPPXXKXXQXXXXXXX 974 GG G GG G + GGG GG GG G G G Sbjct: 176 GGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGS 235 Query: 973 XGXXGGGRG 947 G GGG G Sbjct: 236 GGGEGGGYG 244 Score = 32.3 bits (70), Expect = 0.72 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 1154 GGGXXGXFXRGXXXGXGKKXXXGGGXPXGGXGGGXXXXXXGGG 1026 GGG G G G G GGG GG GG GGG Sbjct: 172 GGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGG 214 Score = 31.5 bits (68), Expect = 1.3 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = -1 Query: 1154 GGGXXGXFXRGXXXGXGKKXXXGGGXPXGGXGGGXXXXXXGGGA 1023 GGG G G G GGG G GGG GGG+ Sbjct: 230 GGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGS 273 Score = 29.9 bits (64), Expect = 3.9 Identities = 26/96 (27%), Positives = 27/96 (28%), Gaps = 2/96 (2%) Frame = -2 Query: 1150 GXXXGXXXGGXAXGXEKXXXXGGGXPXGGXGGXXLXGXXGGG--RXPPXXKXXQXXXXXX 977 G G G A G GGG GG GG G GG Sbjct: 146 GNGAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGG 205 Query: 976 XXGXXGGGRGXXPXXRPWXGPXAXGGARXHPPSXGG 869 G GGG G + G A GG GG Sbjct: 206 AGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGG 241 Score = 29.9 bits (64), Expect = 3.9 Identities = 20/67 (29%), Positives = 21/67 (31%), Gaps = 1/67 (1%) Frame = -1 Query: 1154 GGGXXGXFXRGXXXGXGKKXXXGGGXPXGG-XGGGXXXXXXGGGAXPPXXKXXPXXXXXX 978 GG + G G G GGG GG GG GGGA Sbjct: 153 GGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGG 212 Query: 977 XGGXXGG 957 GG GG Sbjct: 213 GGGGSGG 219 Score = 29.9 bits (64), Expect = 3.9 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = -2 Query: 1153 GGXXXGXXXGGXAXGXEKXXXXG---GGXPXGGXGGXXLXGXXGGG 1025 GG G GG A G G GG GG GG G GGG Sbjct: 210 GGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGG 255 Score = 29.5 bits (63), Expect = 5.1 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 1151 GGXXGXFXRGXXXGXGKKXXXGGGXPXGGXGGGXXXXXXGGG 1026 GG G G G G GGG G GGG GGG Sbjct: 240 GGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGGG 281 Score = 29.1 bits (62), Expect = 6.7 Identities = 35/142 (24%), Positives = 37/142 (26%), Gaps = 2/142 (1%) Frame = -2 Query: 1288 GXGGXXRXGGXXPPXPGXGXXAPXPPXGRKXTGGFLXEXXPPPPXGGXXXGXXXGGXAX- 1112 G GG GG G + GG GG G GG A Sbjct: 38 GHGGGGGSGGVSSGGYGGESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGGGGGAASS 97 Query: 1111 -GXEKXXXXGGGXPXGGXGGXXLXGXXGGGRXPPXXKXXQXXXXXXXXGXXGGGRGXXPX 935 G GGG GG G G GG G G G G Sbjct: 98 GGYASGAGEGGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYG-NGAGEGGGAG 156 Query: 934 XRPWXGPXAXGGARXHPPSXGG 869 + G A GG H GG Sbjct: 157 ASGYGG-GAYGGGGGHGGGGGG 177 Score = 29.1 bits (62), Expect = 6.7 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 1154 GGGXXGXFXRGXXXGXGKKXXXGGGXPXGGXGGGXXXXXXGGG 1026 GGG G G G G GGG GG GG GGG Sbjct: 240 GGGYGGGAAGGYGGGGG--GGEGGGGSYGGEHGGGSGGGHGGG 280 Score = 28.7 bits (61), Expect = 8.9 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -1 Query: 1154 GGGXXGXFXRGXXXGXGKKXXXGGGXPXGGXGGGXXXXXXGGG 1026 GGG G G G+ G G GG GG GGG Sbjct: 89 GGGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGGGSGGGG 131 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 33.9 bits (74), Expect = 0.24 Identities = 32/120 (26%), Positives = 33/120 (27%), Gaps = 3/120 (2%) Frame = +3 Query: 939 GXXPRPPPXXPXXXXXXXXWXXFXXGGXRPPPXXPXXXXPPXPPXGXPPPXXXFF-SXPX 1115 G RPP P P P P P G PP S P Sbjct: 401 GRSTRPPVVVPSPPTTPSPGGSPPSPSISPSPPITVPSPPTTPSPGGSPPSPSIVPSPPS 460 Query: 1116 ALPPXKXPXXSP--PXGGGGXXSXKNPPVXFLPXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 P P SP P GG S P P G + P GG PP P P Sbjct: 461 TTPSPGSPPTSPTTPTPGGSPPSSPTTPT---PGGSPPSSPTTPTPGG-SPPSSPTTPSP 516 Score = 33.1 bits (72), Expect = 0.41 Identities = 22/91 (24%), Positives = 26/91 (28%) Frame = +1 Query: 1018 GXAPPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPPGXGGGXXXSKTXPX 1197 G + P PP P G PP P P P P PG P Sbjct: 401 GRSTRPPVVVPSPPTTPSPGGSPPSPSISPSPPITV-PSPPTTPSPGGSPPSPSIVPSPP 459 Query: 1198 FSSXGGGXXXXXPXRGXVGXAPPXGXXPPXP 1290 ++ G P G +PP P P Sbjct: 460 STTPSPGSPPTSPTTPTPGGSPPSSPTTPTP 490 Score = 33.1 bits (72), Expect = 0.41 Identities = 25/88 (28%), Positives = 26/88 (29%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFL 1205 P P P PP P P S P + P P S P S PP Sbjct: 516 PGGSPPSPSISPSPPITVPSPPSTPTS-PGSPPSPSSPTPSSPIPSPPTPS--TPPTPIS 572 Query: 1206 PXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 P P P G PP PP P Sbjct: 573 PGQNSPPIIPSPPFTGPSPPSSPSPPLP 600 Score = 29.9 bits (64), Expect = 3.9 Identities = 33/156 (21%), Positives = 36/156 (23%), Gaps = 8/156 (5%) Frame = +3 Query: 846 SPXPRGXXPPXEGGXHRAPPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFXXGGXR 1025 +P P G PP P P G P P P Sbjct: 416 TPSP-GGSPPSPSISPSPPITVPSPPTTPSPGGSPPSPSIVPSPPSTTPSPGSPPTSPTT 474 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXF- 1202 P P P P G PP P PP SP +PP+ Sbjct: 475 PTPGGSPPSSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPSPGGSPPSPSISPSPPITVP 534 Query: 1203 -------LPXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 P P P PP PP P Sbjct: 535 SPPSTPTSPGSPPSPSSPTPSSPIPSPPTPSTPPTP 570 Score = 29.9 bits (64), Expect = 3.9 Identities = 23/91 (25%), Positives = 25/91 (27%) Frame = +1 Query: 1018 GXAPPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPPGXGGGXXXSKTXPX 1197 G +PP PP P P P P P PP T P Sbjct: 517 GGSPPSPSISPSPPITVPSPPSTPTSPGSPPSPSSPTPSSPIPSPP-------TPSTPPT 569 Query: 1198 FSSXGGGXXXXXPXRGXVGXAPPXGXXPPXP 1290 S G P G +PP PP P Sbjct: 570 PISPGQNSPPIIPSPPFTGPSPPSSPSPPLP 600 Score = 29.1 bits (62), Expect = 6.7 Identities = 15/45 (33%), Positives = 16/45 (35%), Gaps = 2/45 (4%) Frame = +1 Query: 1030 PPXXXXXXPPPXPP--XGXPPPXXXFFPXPXXXPRXKXPXXPPPG 1158 PP PPP P PPP P P + P P PG Sbjct: 783 PPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPPPIYEGPLPPIPG 827 Score = 28.7 bits (61), Expect = 8.9 Identities = 14/45 (31%), Positives = 16/45 (35%), Gaps = 2/45 (4%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPP--PXXXFFPXPXXXPRXKXPXXPPP 1155 PP PPP P PP P ++ P P PPP Sbjct: 761 PPTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPP 805 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 33.9 bits (74), Expect = 0.24 Identities = 24/88 (27%), Positives = 27/88 (30%) Frame = -2 Query: 1288 GXGGXXRXGGXXPPXPGXGXXAPXPPXGRKXTGGFLXEXXPPPPXGGXXXGXXXGGXAXG 1109 G G + GG G G A G GG + GG G GG G Sbjct: 105 GKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRG 164 Query: 1108 XEKXXXXGGGXPXGGXGGXXLXGXXGGG 1025 + GGG G G G G G Sbjct: 165 GKSGGGAGGGVGGGVGAGGGAGGSVGAG 192 Score = 33.5 bits (73), Expect = 0.31 Identities = 26/95 (27%), Positives = 28/95 (29%) Frame = -2 Query: 1153 GGXXXGXXXGGXAXGXEKXXXXGGGXPXGGXGGXXLXGXXGGGRXPPXXKXXQXXXXXXX 974 GG G GG G + GGG GG GG G GG Sbjct: 90 GGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIG 149 Query: 973 XGXXGGGRGXXPXXRPWXGPXAXGGARXHPPSXGG 869 G GG G G A GG + GG Sbjct: 150 GGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGG 184 Score = 32.7 bits (71), Expect = 0.55 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = -1 Query: 1154 GGGXXGXFXRGXXXGXGKKXXXGGGXPXGGXGGGXXXXXXGGGAXPPXXKXXPXXXXXXX 975 GGG G G G G GG GG GG GGGA Sbjct: 54 GGGASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGG 113 Query: 974 GGXXGG 957 GG GG Sbjct: 114 GGAGGG 119 Score = 30.7 bits (66), Expect = 2.2 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 1151 GGXXGXFXRGXXXGXGKKXXXGGGXPXGGXGGGXXXXXXGGG 1026 GG G G G G GGG GG GGG GG Sbjct: 441 GGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGG 482 Score = 30.3 bits (65), Expect = 2.9 Identities = 25/101 (24%), Positives = 26/101 (25%) Frame = -2 Query: 1150 GXXXGXXXGGXAXGXEKXXXXGGGXPXGGXGGXXLXGXXGGGRXPPXXKXXQXXXXXXXX 971 G G GG G GGG G GG G GGG Sbjct: 82 GGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIG 141 Query: 970 GXXGGGRGXXPXXRPWXGPXAXGGARXHPPSXGGXXPLGXG 848 G GG G G GG G +G G Sbjct: 142 GGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAG 182 Score = 29.1 bits (62), Expect = 6.7 Identities = 16/44 (36%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = -1 Query: 1151 GGXXGXFXRGXXXGXGK-KXXXGGGXPXGGXGGGXXXXXXGGGA 1023 GG G G G GK + GG GG GGG GG+ Sbjct: 145 GGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGS 188 Score = 28.7 bits (61), Expect = 8.9 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = -1 Query: 1154 GGGXXGXFXRGXXXGXGKKXXXGGGXPXGGXGGGXXXXXXGGGA 1023 GG G RG G G GGG GG GG G G+ Sbjct: 154 GGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGS 197 Score = 28.7 bits (61), Expect = 8.9 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -1 Query: 1151 GGXXGXFXRGXXXGXGKKXXXGGGXPXGGXGGGXXXXXXGGGA 1023 GG G G G G GGG GG GG GG + Sbjct: 359 GGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGAS 401 Score = 28.7 bits (61), Expect = 8.9 Identities = 19/65 (29%), Positives = 19/65 (29%) Frame = -1 Query: 1151 GGXXGXFXRGXXXGXGKKXXXGGGXPXGGXGGGXXXXXXGGGAXPPXXKXXPXXXXXXXG 972 GG G G G G GG GG GG GGG G Sbjct: 398 GGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGG 457 Query: 971 GXXGG 957 G GG Sbjct: 458 GSVGG 462 Score = 28.7 bits (61), Expect = 8.9 Identities = 31/114 (27%), Positives = 33/114 (28%) Frame = -2 Query: 1288 GXGGXXRXGGXXPPXPGXGXXAPXPPXGRKXTGGFLXEXXPPPPXGGXXXGXXXGGXAXG 1109 G GG GG G G GG + GG G GG G Sbjct: 417 GAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGG---GRGSGGAGGG 473 Query: 1108 XEKXXXXGGGXPXGGXGGXXLXGXXGGGRXPPXXKXXQXXXXXXXXGXXGGGRG 947 GGG GG GG + G GGG G GGG G Sbjct: 474 TGGSVGAGGGVGVGGGGG--IGGGAGGGVGGGVGGGVGGGVRGAVGGAVGGGVG 525 Score = 28.7 bits (61), Expect = 8.9 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 1154 GGGXXGXFXRGXXXGXGKKXXXGGGXPXGGXGGGXXXXXXGG 1029 GGG G G G G GGG GG GGG GG Sbjct: 471 GGGTGGSVGAGGGVGVG-----GGGGIGGGAGGGVGGGVGGG 507 Score = 28.7 bits (61), Expect = 8.9 Identities = 20/68 (29%), Positives = 20/68 (29%) Frame = -1 Query: 1154 GGGXXGXFXRGXXXGXGKKXXXGGGXPXGGXGGGXXXXXXGGGAXPPXXKXXPXXXXXXX 975 GGG G G G G G G GG GGGA Sbjct: 501 GGGVGGGVGGGVRGAVGGAVGGGVGGAGRGSGGASGGAGAGGGAGGGVGGGANVGVGVGA 560 Query: 974 GGXXGGXA 951 GG GG A Sbjct: 561 GGSTGGGA 568 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 33.9 bits (74), Expect = 0.24 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 1054 PPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PP PPP P P PR + PPP Sbjct: 25 PPPQPPPPPPPPPPP--PPPRLGPRLRLRLLPPP 56 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 33.9 bits (74), Expect = 0.24 Identities = 35/151 (23%), Positives = 38/151 (25%), Gaps = 4/151 (2%) Frame = +3 Query: 849 PXPRGXXPPXEGGXHRAPPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXX---WXXFXXGG 1019 P P PP PP P P+PP P Sbjct: 32 PSPAPHKPPKHPVKPPKPPAVKPPKPPAVKPPTPKPPTVKPHPKPPTVKPHPKPPTVKPH 91 Query: 1020 XRPPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPP-XKXPXXSPPXGGGGXXSXKNPPV 1196 +PP P PP P P P P PP P PP + K PP Sbjct: 92 PKPPTVKPPHPKPPTKPH--PHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPS 149 Query: 1197 XFLPXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 P P P P PP P Sbjct: 150 TPKPPHHKPPPTPCPPPTPTPTPPVVTPPTP 180 Score = 32.7 bits (71), Expect = 0.55 Identities = 35/150 (23%), Positives = 41/150 (27%), Gaps = 5/150 (3%) Frame = +3 Query: 855 PRGXXPPXEGGXHRAPPXAXGPXQGRXXGXXP--RPPPXXPXXXXXXXXWXXFXXGGXRP 1028 P PP + H PP P + P +PPP P +P Sbjct: 99 PPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKP 158 Query: 1029 PPXX--PXXXXPPXPPXGXPPPXXXFFSXPXALPP-XKXPXXSPPXGGGGXXSXKNPPVX 1199 PP P P P P P + P PP P +PP PPV Sbjct: 159 PPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPV---ITPPTPTPPVI 215 Query: 1200 FLPXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 P P P PP P Sbjct: 216 TPPTPTPPVVTPPTPTPPVVTPPTPTPPTP 245 Score = 28.7 bits (61), Expect = 8.9 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +1 Query: 1030 PPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PP P PP PPP P P P P P P Sbjct: 141 PPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTP 182 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 33.9 bits (74), Expect = 0.24 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +1 Query: 1024 APP-PXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPPGXGG 1167 APP P PPP PP PP P P P P PPPG G Sbjct: 374 APPGPANQTSPPPPPPPSAAAPPPP---PPPKKGPAAPPPP-PPPGKKG 418 Score = 31.5 bits (68), Expect = 1.3 Identities = 18/55 (32%), Positives = 19/55 (34%) Frame = +3 Query: 1029 PPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPP 1193 PP P PP PPP + P PP K P PP G PP Sbjct: 372 PPAPPGPANQTSPP---PPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPP 423 Score = 31.5 bits (68), Expect = 1.3 Identities = 20/56 (35%), Positives = 21/56 (37%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPP 1193 PPP P P PP PPP + P PP K PP S K PP Sbjct: 384 PPPPPPPSAAAPPPP---PPPKKGPAAPPPPPPPGKKGAGPPPP---PPMSKKGPP 433 Score = 31.1 bits (67), Expect = 1.7 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PP P P P P K PPP Sbjct: 386 PPPPPSAAAPPPPPP----PKKGPAAPPPPPPPGKKGAGPPPP 424 Score = 31.1 bits (67), Expect = 1.7 Identities = 17/55 (30%), Positives = 18/55 (32%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPPGXGGGXXXSKT 1188 APPP P PP PP P P K P PP G +T Sbjct: 394 APPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPPGNPKGPTKSGET 448 Score = 30.7 bits (66), Expect = 2.2 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 1248 PPPXGGGXXPPPPXGGKXRXGF*XXPPPPXPXGG 1147 PP G PPPP GK G PPPP G Sbjct: 400 PPKKGPAAPPPPPPPGKKGAG--PPPPPPMSKKG 431 Score = 30.3 bits (65), Expect = 2.9 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 1248 PPPXGGGXXPPPPXGGKXRXGF*XXPPPPXPXGGXXGG 1135 PPP PPPP K PPPP P G G Sbjct: 386 PPPPPSAAAPPPPPPPKKGPA---APPPPPPPGKKGAG 420 Score = 29.9 bits (64), Expect = 3.9 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 6/58 (10%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXG------XPPPXXXFFPXPXXXPRXKXPXXPPPGXGGGXXXS 1182 PPP PPP P G PPP P P K PPG G S Sbjct: 388 PPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPPGNPKGPTKS 445 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 33.5 bits (73), Expect = 0.31 Identities = 23/88 (26%), Positives = 25/88 (28%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFL 1205 PPP P PP PPP S P + P P +PP P Sbjct: 70 PPPSPPVITSPPPTVASSPPPPVVIASPPPSTPATTPP--APPQTVSPPPPPDASPSPPA 127 Query: 1206 PXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 P P P G P P P Sbjct: 128 PTTTNPPPKPSPSPPGETPSPPGETPSP 155 Score = 32.3 bits (70), Expect = 0.72 Identities = 15/48 (31%), Positives = 16/48 (33%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPPGXGG 1167 +PPP PP P PPP P P P P P G Sbjct: 96 SPPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPG 143 Score = 32.3 bits (70), Expect = 0.72 Identities = 21/79 (26%), Positives = 23/79 (29%) Frame = +3 Query: 1029 PPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFLP 1208 PP P PP PP P P + P P P +P G K P P Sbjct: 106 PPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPK--PSPSTP 163 Query: 1209 XGGXGAXXPXPGXGGXXPP 1265 P P PP Sbjct: 164 TPTTTTSPPPPPATSASPP 182 Score = 29.9 bits (64), Expect = 3.9 Identities = 23/89 (25%), Positives = 26/89 (29%), Gaps = 3/89 (3%) Frame = +3 Query: 1032 PXXPXXXXPPXPPXGXPPPXXXFFSXPXAL---PPXKXPXXSPPXGGGGXXSXKNPPVXF 1202 P P PP P PPP P + PP P SPP + + P Sbjct: 32 PSAPPPVTPPPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPP- 90 Query: 1203 LPXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 P P PP PP P Sbjct: 91 -PVVIASPPPSTPATTPPAPPQTVSPPPP 118 Score = 29.5 bits (63), Expect = 5.1 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 2/46 (4%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXP--XXPPP 1155 APPP P PP PPP P P P PPP Sbjct: 21 APPPLQTQPTTPSAPPPVTPPPSPPQSPPPVVSSSPPPPVVSSPPP 66 Score = 29.5 bits (63), Expect = 5.1 Identities = 24/89 (26%), Positives = 26/89 (29%), Gaps = 2/89 (2%) Frame = +3 Query: 1029 PPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFL- 1205 PP P PP PPP P + PP P + P S PPV Sbjct: 40 PPPSPPQSPPPVVSSSPPPPVVS-SPPPSSSPPPSPPVITSPP--PTVASSPPPPVVIAS 96 Query: 1206 -PXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 P P P PP P P Sbjct: 97 PPPSTPATTPPAPPQTVSPPPPPDASPSP 125 >At5g19090.1 68418.m02269 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 587 Score = 33.5 bits (73), Expect = 0.31 Identities = 24/78 (30%), Positives = 24/78 (30%) Frame = -2 Query: 1288 GXGGXXRXGGXXPPXPGXGXXAPXPPXGRKXTGGFLXEXXPPPPXGGXXXGXXXGGXAXG 1109 G G GG P G P G K GG P GG G GG G Sbjct: 340 GGGKNGGKGGGGHPLDGKMGGGGGGPNGNKGGGGVQMNGGP---NGGKKGGGGGGGGGGG 396 Query: 1108 XEKXXXXGGGXPXGGXGG 1055 G P GG GG Sbjct: 397 PMSGGLPPGFRPMGGGGG 414 Score = 32.3 bits (70), Expect = 0.72 Identities = 39/141 (27%), Positives = 39/141 (27%), Gaps = 1/141 (0%) Frame = -2 Query: 1288 GXGGXXRXGGXXPPXPGXGXXAPXPPXGRKXTGGFLXEXXPPPPXGGXXXGXXXGGXAXG 1109 G GG G P G G G GG GG GG G Sbjct: 313 GGGGGGPGGKKGGPGGGGGNMGNQNQGGGGKNGG--------KGGGGHPLDGKMGGGGGG 364 Query: 1108 XEKXXXXGGGXPXGGX-GGXXLXGXXGGGRXPPXXKXXQXXXXXXXXGXXGGGRGXXPXX 932 GG GG GG G GGG P G GGG G Sbjct: 365 PNGNKGGGGVQMNGGPNGGKKGGGGGGGGGGGP-MSGGLPPGFRPMGGGGGGGGGPQSMS 423 Query: 931 RPWXGPXAXGGARXHPPSXGG 869 P G A GG P GG Sbjct: 424 MPMGG--AMGGPMGSLPQMGG 442 Score = 31.1 bits (67), Expect = 1.7 Identities = 25/73 (34%), Positives = 26/73 (35%), Gaps = 4/73 (5%) Frame = -1 Query: 1163 PXPGGGXXGXFXRGXXXGXGKKXXXGGGXPX----GGXGGGXXXXXXGGGAXPPXXKXXP 996 P GGG G +G G K GGG P GG GGG GGG P Sbjct: 326 PGGGGGNMGNQNQGGGGKNGGKG--GGGHPLDGKMGGGGGGPNGNKGGGGV---QMNGGP 380 Query: 995 XXXXXXXGGXXGG 957 GG GG Sbjct: 381 NGGKKGGGGGGGG 393 Score = 30.3 bits (65), Expect = 2.9 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = -1 Query: 1127 RGXXXGXGKKXXXGGGXPXGGXGGGXXXXXXGGGAXPP 1014 +G G G G GG GGG GGG PP Sbjct: 104 KGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGGPP 141 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 33.5 bits (73), Expect = 0.31 Identities = 18/47 (38%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXP---RXKXPXXPPP 1155 +PP PPP PP PPP P P P R + P PPP Sbjct: 14 SPPMRGRVPLPPPPPP--PPPPMRRRAPLPPPPPPPMRRRAPLPPPP 58 >At1g79480.1 68414.m09263 hypothetical protein low similarity to beta-1,3-glucanase-like protein GI:9758115 from [Arabidopsis thaliana] Length = 356 Score = 33.5 bits (73), Expect = 0.31 Identities = 22/86 (25%), Positives = 25/86 (29%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFL 1205 P P PP P PP PP +PP S NPPV + Sbjct: 70 PSSSYPGLSPPPGPITLPNPPDSSSNPNSNPNPPESSSNPNPPDSSSNPNSNPNPPVT-V 128 Query: 1206 PXGGXGAXXPXPGXGGXXPPXRXXPP 1283 P + P P P PP Sbjct: 129 PNPPESSSNPNPPDSSSNPNSNPNPP 154 >At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identical to gi_3883128_gb_AAC77827 Length = 133 Score = 33.5 bits (73), Expect = 0.31 Identities = 22/85 (25%), Positives = 23/85 (27%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFL 1205 P P P P P P A PP P +PP S PP Sbjct: 24 PGPAPTISPLPATPTPSQSPRATAPAPSPSANPPPSAPTTAPPVSQPPTESPPAPPTSTS 83 Query: 1206 PXGGXGAXXPXPGXGGXXPPXRXXP 1280 P G G P G P P Sbjct: 84 PSGAPGTNVPSGEAGPAQSPLSGSP 108 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 33.1 bits (72), Expect = 0.41 Identities = 17/49 (34%), Positives = 19/49 (38%) Frame = +1 Query: 1009 LXGGXAPPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 L G + PP PPP PP PP P P P+ P PP Sbjct: 258 LPPGRSAPPPPPAAAPPPQPPPPPPPK-----PQPPPPPKIARPPPAPP 301 Score = 30.7 bits (66), Expect = 2.2 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXP 1140 APPP PPP PP PPP P P+ P Sbjct: 272 APPPQP----PPPPPPKPQPPPPPKIARPPPAPPKGAAP 306 Score = 29.9 bits (64), Expect = 3.9 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 1017 GXRPPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPP 1154 G P P PP PP PPP P PP PP Sbjct: 252 GLPPLKLPPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPP 297 Score = 29.5 bits (63), Expect = 5.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXP 1139 PPP P PP PP PPP P A P P Sbjct: 273 PPPQPP----PPPPPKPQPPPPPKIARPPPAPPKGAAP 306 >At3g20850.1 68416.m02636 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 33.1 bits (72), Expect = 0.41 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPP 1154 PPP P PP PPP ++S P LPP P PP Sbjct: 55 PPPPTPVYSPPPAD---LPPPPTPYYSPPADLPP-PTPIYPPP 93 >At3g10300.3 68416.m01236 calcium-binding EF hand family protein low similarity to SP|P12815 Programmed cell death protein 6 (Probable calcium-binding protein ALG-2) {Mus musculus}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 335 Score = 33.1 bits (72), Expect = 0.41 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 1151 PXGXGGGGLXQKPXRXFPPXGGGGXXPPPXGGGWXXPPP 1267 P G G P PP G G PPP G PPP Sbjct: 5 PPSSQGYGYGGNPPPPQPPYGSTGNNPPPYGSSGSNPPP 43 >At3g10300.2 68416.m01235 calcium-binding EF hand family protein low similarity to SP|P12815 Programmed cell death protein 6 (Probable calcium-binding protein ALG-2) {Mus musculus}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 324 Score = 33.1 bits (72), Expect = 0.41 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 1151 PXGXGGGGLXQKPXRXFPPXGGGGXXPPPXGGGWXXPPP 1267 P G G P PP G G PPP G PPP Sbjct: 5 PPSSQGYGYGGNPPPPQPPYGSTGNNPPPYGSSGSNPPP 43 >At3g10300.1 68416.m01234 calcium-binding EF hand family protein low similarity to SP|P12815 Programmed cell death protein 6 (Probable calcium-binding protein ALG-2) {Mus musculus}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 232 Score = 33.1 bits (72), Expect = 0.41 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 1151 PXGXGGGGLXQKPXRXFPPXGGGGXXPPPXGGGWXXPPP 1267 P G G P PP G G PPP G PPP Sbjct: 5 PPSSQGYGYGGNPPPPQPPYGSTGNNPPPYGSSGSNPPP 43 >At5g62210.1 68418.m07811 embryo-specific protein-related contains weak similarity to embryo-specific protein 3 (GI:3335171) [Arabidopsis thaliana] Length = 223 Score = 32.7 bits (71), Expect = 0.55 Identities = 20/58 (34%), Positives = 24/58 (41%) Frame = +3 Query: 1029 PPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXF 1202 PP P PP P PP F P ++PP P SPP G S ++ V F Sbjct: 158 PPPSPDF--PPFSPSIPPPSPPYFPPEPPSIPP--PPPPSPPSAASGRGSGQSLVVAF 211 >At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 32.7 bits (71), Expect = 0.55 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +2 Query: 1163 GGGGLXQKPXRXFPPXGGGGXXPPPXGGGW-XXPPPAXXAPPPPXXG 1300 G G P P G G PPP G G PPP + PP G Sbjct: 176 GSYGQAPPPAAAIPSYDGSGSYPPPTGYGMEAVPPPTSYSGGPPSYG 222 Score = 28.7 bits (61), Expect = 8.9 Identities = 20/60 (33%), Positives = 23/60 (38%), Gaps = 9/60 (15%) Frame = -3 Query: 1263 GGXXHPPPXGGGXX---PP------PPXGGKXRXGF*XXPPPPXPXGGXXGGFXXGXXRR 1111 G +PPP G G PP PP G R G+ P GG GG+ G R Sbjct: 193 GSGSYPPPTGYGMEAVPPPTSYSGGPPSYGGPRGGYGSDAPSTGGRGGRSGGYDGGSAPR 252 >At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 32.7 bits (71), Expect = 0.55 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +2 Query: 1163 GGGGLXQKPXRXFPPXGGGGXXPPPXGGGW-XXPPPAXXAPPPPXXG 1300 G G P P G G PPP G G PPP + PP G Sbjct: 176 GSYGQAPPPAAAIPSYDGSGSYPPPTGYGMEAVPPPTSYSGGPPSYG 222 Score = 28.7 bits (61), Expect = 8.9 Identities = 20/60 (33%), Positives = 23/60 (38%), Gaps = 9/60 (15%) Frame = -3 Query: 1263 GGXXHPPPXGGGXX---PP------PPXGGKXRXGF*XXPPPPXPXGGXXGGFXXGXXRR 1111 G +PPP G G PP PP G R G+ P GG GG+ G R Sbjct: 193 GSGSYPPPTGYGMEAVPPPTSYSGGPPSYGGPRGGYGSDAPSTGGRGGRSGGYDGGSAPR 252 >At4g34440.1 68417.m04894 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 670 Score = 32.7 bits (71), Expect = 0.55 Identities = 26/92 (28%), Positives = 26/92 (28%), Gaps = 6/92 (6%) Frame = +3 Query: 1032 PXXPXXXXPPXPPXGXPPPXXXFFSXPXALP-----PXKXPXXSPPXGGGGXXSXKNPPV 1196 P P PP PP FS P A P P P SPP P Sbjct: 32 PPTPPSSPPPSSISAPPPDISASFSPPPAPPTQETSPPTSPSSSPPVVANPSPQTPENPS 91 Query: 1197 XFLPXGGXGAXXP-XPGXGGXXPPXRXXPPXP 1289 P G P P P R PP P Sbjct: 92 PPAPEGSTPVTPPAPPQTPSNQSPERPTPPSP 123 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 32.7 bits (71), Expect = 0.55 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 1/63 (1%) Frame = +2 Query: 1115 RXXPXXXPPXXPPXGXGGGGLXQKPXRXF-PPXGGGGXXPPPXGGGWXXPPPAXXAPPPP 1291 R P PP G Q R PP GG PPP G PPP PP Sbjct: 180 RGPPPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPHGMQGPPPPRPGMPPA 239 Query: 1292 XXG 1300 G Sbjct: 240 PGG 242 Score = 32.3 bits (70), Expect = 0.72 Identities = 23/83 (27%), Positives = 25/83 (30%) Frame = +3 Query: 1041 PXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFLPXGGX 1220 P PP P G PP P + P PP G PP + Sbjct: 162 PGQMLPPPPFGGQGPPMGRGPPPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMM----R 217 Query: 1221 GAXXPXPGXGGXXPPXRXXPPXP 1289 G P G G PP PP P Sbjct: 218 GPPPPPHGMQGPPPPRPGMPPAP 240 Score = 31.9 bits (69), Expect = 0.96 Identities = 24/87 (27%), Positives = 27/87 (31%), Gaps = 1/87 (1%) Frame = +3 Query: 870 PPXEGGXHRAPPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFXXGGXRPPPXXPXX 1049 PP GG + PP GP P+ P G R PP P Sbjct: 168 PPPFGG--QGPPMGRGPPPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPHG 225 Query: 1050 XXPPXPP-XGXPPPXXXFFSXPXALPP 1127 P PP G PP F +PP Sbjct: 226 MQGPPPPRPGMPPAPGGFAPPRPGMPP 252 Score = 31.1 bits (67), Expect = 1.7 Identities = 18/60 (30%), Positives = 21/60 (35%), Gaps = 5/60 (8%) Frame = +2 Query: 1136 PPXXPPXGXGGGGLXQKPXRXFPPXGGGGXXP-----PPXGGGWXXPPPAXXAPPPPXXG 1300 P P + + P + PP GG P PP G PP PPPP G Sbjct: 145 PQISRPPQLSAPPIIRPPGQMLPPPPFGGQGPPMGRGPPPPYGMRPPPQQFSGPPPPQYG 204 Score = 29.5 bits (63), Expect = 5.1 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = +1 Query: 1018 GXAPPPXXXXXXPPPXPPXGXPPPXXXFFP-XPXXXPRXKXPXXPPPGXGG 1167 G PPP PPP G PPP P P + P PP G G Sbjct: 179 GRGPPPPYG-MRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPHGMQG 228 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 32.7 bits (71), Expect = 0.55 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 1/63 (1%) Frame = +2 Query: 1115 RXXPXXXPPXXPPXGXGGGGLXQKPXRXF-PPXGGGGXXPPPXGGGWXXPPPAXXAPPPP 1291 R P PP G Q R PP GG PPP G PPP PP Sbjct: 180 RGPPPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPHGMQGPPPPRPGMPPA 239 Query: 1292 XXG 1300 G Sbjct: 240 PGG 242 Score = 32.3 bits (70), Expect = 0.72 Identities = 23/83 (27%), Positives = 25/83 (30%) Frame = +3 Query: 1041 PXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFLPXGGX 1220 P PP P G PP P + P PP G PP + Sbjct: 162 PGQMLPPPPFGGQGPPMGRGPPPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMM----R 217 Query: 1221 GAXXPXPGXGGXXPPXRXXPPXP 1289 G P G G PP PP P Sbjct: 218 GPPPPPHGMQGPPPPRPGMPPAP 240 Score = 31.9 bits (69), Expect = 0.96 Identities = 24/87 (27%), Positives = 27/87 (31%), Gaps = 1/87 (1%) Frame = +3 Query: 870 PPXEGGXHRAPPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFXXGGXRPPPXXPXX 1049 PP GG + PP GP P+ P G R PP P Sbjct: 168 PPPFGG--QGPPMGRGPPPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPHG 225 Query: 1050 XXPPXPP-XGXPPPXXXFFSXPXALPP 1127 P PP G PP F +PP Sbjct: 226 MQGPPPPRPGMPPAPGGFAPPRPGMPP 252 Score = 31.1 bits (67), Expect = 1.7 Identities = 18/60 (30%), Positives = 21/60 (35%), Gaps = 5/60 (8%) Frame = +2 Query: 1136 PPXXPPXGXGGGGLXQKPXRXFPPXGGGGXXP-----PPXGGGWXXPPPAXXAPPPPXXG 1300 P P + + P + PP GG P PP G PP PPPP G Sbjct: 145 PQISRPPQLSAPPIIRPPGQMLPPPPFGGQGPPMGRGPPPPYGMRPPPQQFSGPPPPQYG 204 Score = 29.5 bits (63), Expect = 5.1 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = +1 Query: 1018 GXAPPPXXXXXXPPPXPPXGXPPPXXXFFP-XPXXXPRXKXPXXPPPGXGG 1167 G PPP PPP G PPP P P + P PP G G Sbjct: 179 GRGPPPPYG-MRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPHGMQG 228 >At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putative similar to glycine-rich RNA-binding protein from {Sorghum bicolor} SP|Q99070, GI:1778373 from [Pisum sativum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 155 Score = 32.7 bits (71), Expect = 0.55 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = -1 Query: 1169 PPPXPGGGXXGXFXRGXXXGXGKKXXXGGGXPXGGXGGG 1053 P GGG G F R G G+ GG GG GGG Sbjct: 111 PADSGGGGGGGGFARRGGYGGGRGGYARGGFGRGGFGGG 149 >At5g59170.1 68418.m07416 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 288 Score = 32.3 bits (70), Expect = 0.72 Identities = 29/98 (29%), Positives = 31/98 (31%), Gaps = 2/98 (2%) Frame = +3 Query: 996 WXXFXXGGXRP--PPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGG 1169 W F G P PP P P PP PPP + P PP K P PP Sbjct: 40 WPPFKWGPKFPYSPPKPPPIEKYP-PPVQYPPPIKKYPPPPYEHPPVKYP---PPIKTYP 95 Query: 1170 XXSXKNPPVXFLPXGGXGAXXPXPGXGGXXPPXRXXPP 1283 K PP P P PP + PP Sbjct: 96 HPPVKYPPPEQYPP----PIKKYPPPEQYPPPIKKYPP 129 >At5g07510.1 68418.m00860 glycine-rich protein (GRP14) oleosin; glycine-rich protein 14 (GRP14) PMID:11431566; PIR:JQ1063 Length = 193 Score = 32.3 bits (70), Expect = 0.72 Identities = 21/69 (30%), Positives = 21/69 (30%) Frame = -2 Query: 1087 GGGXPXGGXGGXXLXGXXGGGRXPPXXKXXQXXXXXXXXGXXGGGRGXXPXXRPWXGPXA 908 GGG GG G G GGG P G GGG GP A Sbjct: 101 GGGRRFGGRFGKPGGGGLGGGGLPGGLGGLGGGGLPGGLGGLGGGENPLAKISKMFGPGA 160 Query: 907 XGGARXHPP 881 G A P Sbjct: 161 AGAASGDAP 169 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 32.3 bits (70), Expect = 0.72 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXG 1160 PPP P PP PP PPP P + PP P G Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPS---PPPPSPPPPAFAVGKTPEG 105 Score = 32.3 bits (70), Expect = 0.72 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 1054 PPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPPGXGGG 1170 PPP PP PPP P P P PPP G Sbjct: 64 PPPPPPTSPPPPSPP--PPSPPPPSPPPPSPPPPAFAVG 100 Score = 31.5 bits (68), Expect = 1.3 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXP 1113 PPP PPP PP PPP P P Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPPSP 92 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 32.3 bits (70), Expect = 0.72 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = +1 Query: 1027 PPPXXXXXXP-PPXPP-XGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP P PP PP PPP FP P PR P PPP Sbjct: 56 PPPFPALFPPEPPLPPRFELPPP---LFP-PPPLPRLPPPLLPPP 96 Score = 31.9 bits (69), Expect = 0.96 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 P P PP PP P P P PR P PPP Sbjct: 68 PLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPP 110 Score = 31.5 bits (68), Expect = 1.3 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPP 1154 PPP P P PP PPP P PP P PP Sbjct: 76 PPPLFPPPPLPRLPPPLLPPPE----EPPREPPPPPPPPEEPP 114 Score = 30.3 bits (65), Expect = 2.9 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 2/58 (3%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXP-PPXXXFFSXPXAL-PPXKXPXXSPPXGGGGXXSXKNPP 1193 P P P PP P P PP F P L PP P PP + PP Sbjct: 47 PSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPP 104 Score = 29.5 bits (63), Expect = 5.1 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +3 Query: 1029 PPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPP 1154 PP P PP PPP P PP + P PP Sbjct: 64 PPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPP 105 Score = 29.1 bits (62), Expect = 6.7 Identities = 25/87 (28%), Positives = 26/87 (29%), Gaps = 2/87 (2%) Frame = +3 Query: 834 LXXFSPXPRGXXPPXEGGXHRAPPX--AXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXF 1007 L SP P PP R PP A P + PPP P Sbjct: 36 LLPLSPPPS--PPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLL 93 Query: 1008 XXGGXRPPPXXPXXXXPPXPPXGXPPP 1088 PP P PP PP PPP Sbjct: 94 P-----PPEEPPREPPPPPPPPEEPPP 115 >At1g76930.2 68414.m08956 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 256 Score = 32.3 bits (70), Expect = 0.72 Identities = 24/88 (27%), Positives = 27/88 (30%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFL 1205 PPP P P P PPP ++S P P P S PPV Sbjct: 62 PPP--PVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSP--PPVYKS 117 Query: 1206 PXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 P P P PP + P P Sbjct: 118 PPPPVKHYSPPPVYKSPPPPVKHYSPPP 145 >At1g76930.1 68414.m08955 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 293 Score = 32.3 bits (70), Expect = 0.72 Identities = 24/88 (27%), Positives = 27/88 (30%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFL 1205 PPP P P P PPP ++S P P P S PPV Sbjct: 62 PPP--PVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSP--PPVYKS 117 Query: 1206 PXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 P P P PP + P P Sbjct: 118 PPPPVKHYSPPPVYKSPPPPVKHYSPPP 145 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 32.3 bits (70), Expect = 0.72 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = -1 Query: 1148 GXXGXFXRGXXXGXGKKXXXGGGXPXGGXGGGXXXXXXGGG 1026 G G + G G G GGG GG GGG GGG Sbjct: 60 GGSGSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGG 100 Score = 31.9 bits (69), Expect = 0.96 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 1154 GGGXXGXFXRGXXXGXGKKXXXGGGXPXGGXGGGXXXXXXGGG 1026 GGG G G G G G G GG GGG GGG Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGG 112 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 32.3 bits (70), Expect = 0.72 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = -1 Query: 1157 PGGGXXGXFXRGXXXGXGKKXXXGGGXPXGGXGGGXXXXXXGGGAXPPXXKXXPXXXXXX 978 PGGG G G G GG GG GGG GGG Sbjct: 121 PGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGGGGGIGGGVIIGG 180 Query: 977 XGGXXGG 957 GG GG Sbjct: 181 GGGGCGG 187 Score = 31.1 bits (67), Expect = 1.7 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 1154 GGGXXGXFXRGXXXGXGKKXXXGGGXPXGGXGGGXXXXXXGGG 1026 GGG G G G G GGG GG GGG GGG Sbjct: 153 GGGGPGYGSGGGGIGGG--GGIGGGVIIGGGGGGCGGSCSGGG 193 Score = 30.3 bits (65), Expect = 2.9 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 1148 GXXGXFXRGXXXGXGKKXXXGGGXPXGGXGGGXXXXXXGGGA 1023 G G G G G GG P GG GG GGGA Sbjct: 97 GFKGELTAGGYGGGGPGYGGGGYGPGGGGGGVVIGGGFGGGA 138 >At1g26240.1 68414.m03201 proline-rich extensin-like family protein similar to hydroxyproline-rich glycoprotein precursor gi|727264|gb|AAA87902; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 478 Score = 32.3 bits (70), Expect = 0.72 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 62 PPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPP 104 Score = 32.3 bits (70), Expect = 0.72 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 82 PPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPP 124 Score = 31.9 bits (69), Expect = 0.96 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 102 PPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPP 144 Score = 31.9 bits (69), Expect = 0.96 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 122 PPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPP 164 Score = 31.9 bits (69), Expect = 0.96 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 142 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 184 Score = 31.9 bits (69), Expect = 0.96 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 162 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 204 Score = 31.9 bits (69), Expect = 0.96 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 182 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 224 Score = 31.9 bits (69), Expect = 0.96 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 202 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 244 Score = 31.9 bits (69), Expect = 0.96 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 222 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 264 Score = 31.9 bits (69), Expect = 0.96 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 242 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 284 Score = 31.9 bits (69), Expect = 0.96 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 262 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 304 Score = 31.9 bits (69), Expect = 0.96 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 282 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 324 Score = 31.9 bits (69), Expect = 0.96 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 302 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPP 344 Score = 31.9 bits (69), Expect = 0.96 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 342 PPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPP 384 Score = 31.9 bits (69), Expect = 0.96 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 382 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 424 Score = 31.9 bits (69), Expect = 0.96 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 402 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 444 Score = 31.9 bits (69), Expect = 0.96 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 422 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPSPPPYVYKSPPPPP 464 Score = 31.5 bits (68), Expect = 1.3 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPP--XGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 +PPP PP PP PPP + P P PPP Sbjct: 359 SPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 404 Score = 31.1 bits (67), Expect = 1.7 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 132 PPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 174 Score = 31.1 bits (67), Expect = 1.7 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 152 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 194 Score = 31.1 bits (67), Expect = 1.7 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 172 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 214 Score = 31.1 bits (67), Expect = 1.7 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 192 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 234 Score = 31.1 bits (67), Expect = 1.7 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 212 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 254 Score = 31.1 bits (67), Expect = 1.7 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 232 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 274 Score = 31.1 bits (67), Expect = 1.7 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 252 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 294 Score = 31.1 bits (67), Expect = 1.7 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 272 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 314 Score = 31.1 bits (67), Expect = 1.7 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 292 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 334 Score = 31.1 bits (67), Expect = 1.7 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 332 PPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPP 374 Score = 31.1 bits (67), Expect = 1.7 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 372 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 414 Score = 31.1 bits (67), Expect = 1.7 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 392 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 434 Score = 31.1 bits (67), Expect = 1.7 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 412 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPSPPP 454 Score = 30.7 bits (66), Expect = 2.2 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 52 PPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPP 94 Score = 30.7 bits (66), Expect = 2.2 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 72 PPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPP 114 Score = 30.7 bits (66), Expect = 2.2 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 92 PPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPP 134 Score = 30.7 bits (66), Expect = 2.2 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 112 PPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPP 154 Score = 30.7 bits (66), Expect = 2.2 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P PPP Sbjct: 312 PPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPP 354 Score = 30.7 bits (66), Expect = 2.2 Identities = 15/44 (34%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = +1 Query: 1027 PPPXXXXXXPPPXP-PXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP P PPP + P P PPP Sbjct: 351 PPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 394 Score = 30.3 bits (65), Expect = 2.9 Identities = 18/59 (30%), Positives = 21/59 (35%), Gaps = 2/59 (3%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPX--GXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPV 1196 PPP PP PP PPP + P + PP PP S PP+ Sbjct: 420 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP-SPPPYVYKSPPPPPSYSYSYSSPPPPI 477 Score = 29.9 bits (64), Expect = 3.9 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 2/61 (3%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPX--GXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVX 1199 PPP PP PP PPP +S P PP SPP S PP Sbjct: 90 PPPPPYVYSSPPPPPYIYKSPPPPPYVYSSP---PPPPYVYKSPPPPPYVYNSPPPPPYV 146 Query: 1200 F 1202 + Sbjct: 147 Y 147 Score = 29.9 bits (64), Expect = 3.9 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 2/61 (3%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPX--GXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVX 1199 PPP PP PP PPP +S P PP SPP S PP Sbjct: 130 PPPPPYVYNSPPPPPYVYKSPPPPPYVYSSP---PPPPYVYKSPPPPPYVYSSPPPPPYV 186 Query: 1200 F 1202 + Sbjct: 187 Y 187 Score = 29.9 bits (64), Expect = 3.9 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 2/61 (3%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPX--GXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVX 1199 PPP PP PP PPP +S P PP SPP S PP Sbjct: 150 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP---PPPPYVYKSPPPPPYVYSSPPPPPYV 206 Query: 1200 F 1202 + Sbjct: 207 Y 207 Score = 29.9 bits (64), Expect = 3.9 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 2/61 (3%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPX--GXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVX 1199 PPP PP PP PPP +S P PP SPP S PP Sbjct: 170 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP---PPPPYVYKSPPPPPYVYSSPPPPPYV 226 Query: 1200 F 1202 + Sbjct: 227 Y 227 Score = 29.9 bits (64), Expect = 3.9 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 2/61 (3%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPX--GXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVX 1199 PPP PP PP PPP +S P PP SPP S PP Sbjct: 190 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP---PPPPYVYKSPPPPPYVYSSPPPPPYV 246 Query: 1200 F 1202 + Sbjct: 247 Y 247 Score = 29.9 bits (64), Expect = 3.9 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 2/61 (3%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPX--GXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVX 1199 PPP PP PP PPP +S P PP SPP S PP Sbjct: 210 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP---PPPPYVYKSPPPPPYVYSSPPPPPYV 266 Query: 1200 F 1202 + Sbjct: 267 Y 267 Score = 29.9 bits (64), Expect = 3.9 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 2/61 (3%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPX--GXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVX 1199 PPP PP PP PPP +S P PP SPP S PP Sbjct: 230 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP---PPPPYVYKSPPPPPYVYSSPPPPPYV 286 Query: 1200 F 1202 + Sbjct: 287 Y 287 Score = 29.9 bits (64), Expect = 3.9 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 2/61 (3%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPX--GXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVX 1199 PPP PP PP PPP +S P PP SPP S PP Sbjct: 250 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP---PPPPYVYKSPPPPPYVYSSPPPPPYV 306 Query: 1200 F 1202 + Sbjct: 307 Y 307 Score = 29.9 bits (64), Expect = 3.9 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 2/61 (3%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPX--GXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVX 1199 PPP PP PP PPP +S P PP SPP S PP Sbjct: 270 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP---PPPPYVYKSPPPPPYVYSSPPPPPYV 326 Query: 1200 F 1202 + Sbjct: 327 Y 327 Score = 29.9 bits (64), Expect = 3.9 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 2/61 (3%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPX--GXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVX 1199 PPP PP PP PPP +S P PP SPP S PP Sbjct: 290 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP---PPPPYVYKSPPPPPYVYNSPPPPPYV 346 Query: 1200 F 1202 + Sbjct: 347 Y 347 Score = 29.9 bits (64), Expect = 3.9 Identities = 19/61 (31%), Positives = 21/61 (34%), Gaps = 2/61 (3%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPX--GXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVX 1199 PPP PP PP PPP + P PP SPP S PP Sbjct: 320 PPPPPYVYKSPPPPPYVYNSPPPPPYVYKSP---PPPPYVYSSPPPSPYVYKSPPPPPYV 376 Query: 1200 F 1202 + Sbjct: 377 Y 377 Score = 29.9 bits (64), Expect = 3.9 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 2/61 (3%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPX--GXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVX 1199 PPP PP PP PPP +S P PP SPP S PP Sbjct: 330 PPPPPYVYNSPPPPPYVYKSPPPPPYVYSSP---PPSPYVYKSPPPPPYVYSSPPPPPYV 386 Query: 1200 F 1202 + Sbjct: 387 Y 387 Score = 29.9 bits (64), Expect = 3.9 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 2/61 (3%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPX--GXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVX 1199 PPP PP PP PPP +S P PP SPP S PP Sbjct: 370 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP---PPPPYVYKSPPPPPYVYSSPPPPPYV 426 Query: 1200 F 1202 + Sbjct: 427 Y 427 Score = 29.9 bits (64), Expect = 3.9 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 2/61 (3%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPX--GXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVX 1199 PPP PP PP PPP +S P PP SPP S PP Sbjct: 390 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP---PPPPYVYKSPPPPPYVYSSPPPPPYV 446 Query: 1200 F 1202 + Sbjct: 447 Y 447 Score = 29.9 bits (64), Expect = 3.9 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPX--GXPPPXXXFFSXPXALPPXKXPXXSPP 1154 PPP PP PP PPP +S P PP SPP Sbjct: 410 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP-PPYVYKSPSPP 453 Score = 29.5 bits (63), Expect = 5.1 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 2/61 (3%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPX--GXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVX 1199 PPP PP PP PPP +S P PP SPP S PP Sbjct: 50 PPPPPYVYSSPPPPPYIYKSPPPPPYVYSSP---PPPPYIYKSPPPPPYVYSSPPPPPYI 106 Query: 1200 F 1202 + Sbjct: 107 Y 107 Score = 29.5 bits (63), Expect = 5.1 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 2/61 (3%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPX--GXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVX 1199 PPP PP PP PPP +S P PP SPP S PP Sbjct: 70 PPPPPYVYSSPPPPPYIYKSPPPPPYVYSSP---PPPPYIYKSPPPPPYVYSSPPPPPYV 126 Query: 1200 F 1202 + Sbjct: 127 Y 127 Score = 29.1 bits (62), Expect = 6.7 Identities = 14/43 (32%), Positives = 15/43 (34%), Gaps = 1/43 (2%) Frame = +1 Query: 1030 PPXXXXXXPPPXP-PXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PP PPP P PPP + P P PPP Sbjct: 42 PPTHIYSSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPP 84 Score = 29.1 bits (62), Expect = 6.7 Identities = 19/61 (31%), Positives = 21/61 (34%), Gaps = 2/61 (3%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPX--GXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVX 1199 PPP PP PP PPP + P PP SPP S PP Sbjct: 120 PPPPPYVYKSPPPPPYVYNSPPPPPYVYKSP---PPPPYVYSSPPPPPYVYKSPPPPPYV 176 Query: 1200 F 1202 + Sbjct: 177 Y 177 Score = 28.7 bits (61), Expect = 8.9 Identities = 19/61 (31%), Positives = 22/61 (36%), Gaps = 2/61 (3%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPX--GXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVX 1199 PPP PP PP PPP ++ P PP SPP S PP Sbjct: 110 PPPPPYVYSSPPPPPYVYKSPPPPPYVYNSP---PPPPYVYKSPPPPPYVYSSPPPPPYV 166 Query: 1200 F 1202 + Sbjct: 167 Y 167 Score = 28.7 bits (61), Expect = 8.9 Identities = 13/43 (30%), Positives = 14/43 (32%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP PPP + P P P P Sbjct: 322 PPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSP 364 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 32.3 bits (70), Expect = 0.72 Identities = 14/42 (33%), Positives = 16/42 (38%) Frame = +1 Query: 1030 PPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PP PP P PPP P P P+ + PPP Sbjct: 25 PPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPP 66 Score = 31.1 bits (67), Expect = 1.7 Identities = 16/56 (28%), Positives = 17/56 (30%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPPGXGGGXXXSKTXP 1194 P P PP PP P P P P P P P +KT P Sbjct: 91 PAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPPKPENKTIP 146 Score = 30.7 bits (66), Expect = 2.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 APPP PP P P P P P P P P P Sbjct: 80 APPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAP 123 Score = 29.1 bits (62), Expect = 6.7 Identities = 23/89 (25%), Positives = 25/89 (28%) Frame = +3 Query: 1023 RPPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXF 1202 +PPP P PP P P P PP P +PP PV Sbjct: 41 KPPPAPSPSPCPSPPPKPQPKPVPPPACPP--TPPKPQPKPAPPPEPKPAPPPAPKPVPC 98 Query: 1203 LPXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 A P P PP P P Sbjct: 99 PSPPKPPAPTPKPVPPHGPPPKPAPAPTP 127 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 31.9 bits (69), Expect = 0.96 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPXGXPPP 1089 +PPP PPP PP PPP Sbjct: 372 SPPPLQTPPPPPPPPPLAPPPP 393 Score = 29.5 bits (63), Expect = 5.1 Identities = 18/56 (32%), Positives = 20/56 (35%) Frame = +2 Query: 1124 PXXXPPXXPPXGXGGGGLXQKPXRXFPPXGGGGXXPPPXGGGWXXPPPAXXAPPPP 1291 P P PP + Q+ PP PPP PPP APPPP Sbjct: 342 PKFSQPPPPPNRAAFQAITQEKSPVPPPRRS----PPPLQTPPPPPPPPPLAPPPP 393 >At4g38770.1 68417.m05490 proline-rich family protein (PRP4) similar to proline-rich protein [Arabidopsis thaliana] gi|6782442|gb|AAF28388; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 448 Score = 31.9 bits (69), Expect = 0.96 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PP P PPP + P P P PP Sbjct: 238 PPPIPKKPCPPKPPKIEHPPPVPVYKPPPKIEKPPPVPVYKPP 280 >At3g08530.1 68416.m00990 clathrin heavy chain, putative similar to Swiss-Prot:Q00610 clathrin heavy chain 1 (CLH-17) [Homo sapiens] Length = 1703 Score = 31.9 bits (69), Expect = 0.96 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 1211 GGGGXXPPPXGGGWXXPPPAXXAPPPPXXG 1300 GGGG PPP GG PP PP G Sbjct: 1673 GGGGYGPPPQMGGMPGMPPMPPYGMPPMGG 1702 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 31.9 bits (69), Expect = 0.96 Identities = 24/90 (26%), Positives = 27/90 (30%), Gaps = 2/90 (2%) Frame = +3 Query: 1026 PPPXX--PXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVX 1199 PPP P PP PP PPP + P + P SPP + P Sbjct: 58 PPPVTTAPPPANPP-PPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPL 116 Query: 1200 FLPXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 P A P P PP P Sbjct: 117 ASPPAQVPAPAPTTKPDSPSPSPSSSPPLP 146 Score = 28.7 bits (61), Expect = 8.9 Identities = 23/86 (26%), Positives = 25/86 (29%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFL 1205 PP P P PP PP P + PP PP + PPV Sbjct: 26 PPTATPAPPTPTTPPPAATPP-------PVSAPP-PVTTSPPPVTTAPPPANPPPPVSSP 77 Query: 1206 PXGGXGAXXPXPGXGGXXPPXRXXPP 1283 P P P PP PP Sbjct: 78 PPASPPPATPPP-VASPPPPVASPPP 102 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 31.9 bits (69), Expect = 0.96 Identities = 24/90 (26%), Positives = 27/90 (30%), Gaps = 2/90 (2%) Frame = +3 Query: 1026 PPPXX--PXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVX 1199 PPP P PP PP PPP + P + P SPP + P Sbjct: 58 PPPVTTAPPPANPP-PPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPL 116 Query: 1200 FLPXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 P A P P PP P Sbjct: 117 ASPPAQVPAPAPTTKPDSPSPSPSSSPPLP 146 Score = 28.7 bits (61), Expect = 8.9 Identities = 23/86 (26%), Positives = 25/86 (29%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFL 1205 PP P P PP PP P + PP PP + PPV Sbjct: 26 PPTATPAPPTPTTPPPAATPP-------PVSAPP-PVTTSPPPVTTAPPPANPPPPVSSP 77 Query: 1206 PXGGXGAXXPXPGXGGXXPPXRXXPP 1283 P P P PP PP Sbjct: 78 PPASPPPATPPP-VASPPPPVASPPP 102 >At1g02710.1 68414.m00222 glycine-rich protein Length = 96 Score = 31.9 bits (69), Expect = 0.96 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = -1 Query: 1154 GGGXXGXFXRGXXXGXGKKXXXGGGXPXGGXGGGXXXXXXGGG 1026 GG G G G G+K GGG GG GGG GGG Sbjct: 46 GGEGGGGEGGGGEGGGGQKISKGGGG--GGSGGGQRSSSGGGG 86 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 31.5 bits (68), Expect = 1.3 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +1 Query: 958 PPXXPPXXXXXXFGXFXLXGGXAPPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKX 1137 PP PP G PPP PPP PP PP R Sbjct: 99 PPPPPPLSAITTTGHHHHRRSPPPPP------PPPPPPPTITPPVTTTTAGHHHHRRSPP 152 Query: 1138 PXXPPP 1155 P PPP Sbjct: 153 PPPPPP 158 >At4g03120.1 68417.m00425 proline-rich family protein similar to U1 small nuclear ribonucleoprotein C; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 207 Score = 31.5 bits (68), Expect = 1.3 Identities = 26/83 (31%), Positives = 27/83 (32%) Frame = +3 Query: 1017 GXRPPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPV 1196 G PPP P PP P PPP P + P P GGG P Sbjct: 108 GYMPPPGVPQMMAPPGAP--LPPPPQNGILRPPGMAPI------PGQGGG--------PP 151 Query: 1197 XFLPXGGXGAXXPXPGXGGXXPP 1265 P G G P P G PP Sbjct: 152 GMAPIPGQGG-GPPPNYNGLPPP 173 Score = 31.5 bits (68), Expect = 1.3 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +2 Query: 1136 PPXXPPXGXGGGGLXQKPXRXFPPXGGGGXXPPPXGGGWXXPPPAXXAPPPPXXG 1300 PP P GGG P G G PPP G PPP P P G Sbjct: 137 PPGMAPIPGQGGG-----PPGMAPIPGQGGGPPPNYNGLPPPPPYHTNPAAPPSG 186 Score = 29.9 bits (64), Expect = 3.9 Identities = 23/79 (29%), Positives = 24/79 (30%) Frame = +1 Query: 1054 PPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPPGXGGGXXXSKTXPXFSSXGGGXXXXX 1233 PPP P PP P P P PG GGG P GGG Sbjct: 111 PPPGVPQMMAPPGAPLPPPPQNGILRPPGMAPIPGQGGGPPGMAPIP---GQGGG---PP 164 Query: 1234 PXRGXVGXAPPXGXXPPXP 1290 P + PP P P Sbjct: 165 PNYNGLPPPPPYHTNPAAP 183 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 31.5 bits (68), Expect = 1.3 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = +3 Query: 948 PRPPPXXPXXXXXXXXWXXFXXGGXRPPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPP 1127 PRPPP W PPP P PP PP PP F P PP Sbjct: 79 PRPPPPPLSPGSETTTWTTTTTSSVLPPPPPP----PPPPP---PPSSTWDFWDPFIPPP 131 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 31.5 bits (68), Expect = 1.3 Identities = 24/88 (27%), Positives = 24/88 (27%), Gaps = 2/88 (2%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXP--PPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVX 1199 PP P PP P P PP P PP K P P K PPV Sbjct: 653 PPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQ 712 Query: 1200 FLPXGGXGAXXPXPGXGGXXPPXRXXPP 1283 P P P PP Sbjct: 713 VPPTPTYSPPIKPPPVQVPPTPTTPSPP 740 Score = 30.3 bits (65), Expect = 2.9 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXP--PPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVX 1199 PP P PP P P PP P PP K P P K PPV Sbjct: 619 PPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQ 678 Query: 1200 FLP 1208 P Sbjct: 679 LPP 681 Score = 29.9 bits (64), Expect = 3.9 Identities = 18/49 (36%), Positives = 20/49 (40%), Gaps = 5/49 (10%) Frame = +3 Query: 1023 RPPPXXPXXXXPPXPPXGXPP---PXXXFFSXPXALPPXK--XPXXSPP 1154 +PPP PP PP P +S P LPP K P SPP Sbjct: 387 KPPPIQKPPTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTPIYSPP 435 Score = 29.5 bits (63), Expect = 5.1 Identities = 19/59 (32%), Positives = 20/59 (33%), Gaps = 2/59 (3%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXP--PPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPV 1196 PP P PP P P PP P PP K P P K+PPV Sbjct: 249 PPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSPPV 307 Score = 29.1 bits (62), Expect = 6.7 Identities = 24/80 (30%), Positives = 24/80 (30%), Gaps = 10/80 (12%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXP--PPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVX 1199 PP P PP P P PP P PP K P P K PPV Sbjct: 670 PPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKPPPVQ 729 Query: 1200 FLPX--------GGXGAXXP 1235 P GG G P Sbjct: 730 VPPTPTTPSPPQGGYGTPPP 749 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 31.1 bits (67), Expect = 1.7 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = +3 Query: 1023 RPPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPP 1154 +PP P P PP PP P PP K P +PP Sbjct: 140 KPPTTPPVQSPPVQPPTYKPPTSP--VKPPTTTPPVKPPTTTPP 181 >At4g32640.1 68417.m04646 sec23/sec24 transport protein-related Length = 1069 Score = 31.1 bits (67), Expect = 1.7 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = +3 Query: 1023 RPPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXF 1202 RPPP P P PP G P S P S P G PP Sbjct: 45 RPPPMMPGSGPRPPPPFGQSPQPFPQQSPSYGAPQRGPSPMSRPGPPAGMARPGGPPPVS 104 Query: 1203 LPXG 1214 P G Sbjct: 105 QPAG 108 >At4g30460.1 68417.m04325 glycine-rich protein Length = 162 Score = 31.1 bits (67), Expect = 1.7 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -1 Query: 1124 GXXXGXGKKXXXGGGXPXGGXGGGXXXXXXGGGA 1023 G G G+ GGG GG GGG GGG+ Sbjct: 108 GGRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGS 141 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 31.1 bits (67), Expect = 1.7 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPPGXG 1164 PPP PPP PP G PP P P P P G G Sbjct: 233 PPPPPHQAQPPPPPPSGLFPP-----PPPPMANNGFRPMPPAGGFG 273 Score = 30.7 bits (66), Expect = 2.2 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 5/64 (7%) Frame = +2 Query: 1124 PXXXPPXXPPXGXGGGGLXQKPXRXFPPXGGGGXXPPPXGGGWXXPPPAXXA-----PPP 1288 P P P G GL P PP PPP G PPP A P P Sbjct: 212 PTKPEPNKPQSAVGANGLPPPP----PPPPHQAQPPPPPPSGLFPPPPPPMANNGFRPMP 267 Query: 1289 PXXG 1300 P G Sbjct: 268 PAGG 271 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 31.1 bits (67), Expect = 1.7 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = -1 Query: 1151 GGXXGXFXRGXXXGX-GKKXXXGGGXPXGGXGGGXXXXXXGGG 1026 GG G RG G G GGG GG GGG GGG Sbjct: 116 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 158 Score = 30.7 bits (66), Expect = 2.2 Identities = 20/65 (30%), Positives = 23/65 (35%) Frame = -1 Query: 1151 GGXXGXFXRGXXXGXGKKXXXGGGXPXGGXGGGXXXXXXGGGAXPPXXKXXPXXXXXXXG 972 GG G G G G + GGG G GGG GGG+ + G Sbjct: 90 GGGGGHRGGGSYGGGGGRREGGGGY--SGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEG 147 Query: 971 GXXGG 957 G GG Sbjct: 148 GGYGG 152 Score = 28.7 bits (61), Expect = 8.9 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = -2 Query: 1153 GGXXXGXXXGGXAXGXEKXXXXGGGXPXGGXGGXXLXGXXGG 1028 G G GG + G GGG GG GG G GG Sbjct: 88 GSGGGGGHRGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGG 129 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 31.1 bits (67), Expect = 1.7 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = -1 Query: 1151 GGXXGXFXRGXXXGX-GKKXXXGGGXPXGGXGGGXXXXXXGGG 1026 GG G RG G G GGG GG GGG GGG Sbjct: 133 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 175 Score = 29.9 bits (64), Expect = 3.9 Identities = 20/65 (30%), Positives = 22/65 (33%) Frame = -1 Query: 1151 GGXXGXFXRGXXXGXGKKXXXGGGXPXGGXGGGXXXXXXGGGAXPPXXKXXPXXXXXXXG 972 GG G G G G GGG G GGG GGG+ + G Sbjct: 106 GGGGGYSGGGGSYGGGGGRREGGGG-YSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEG 164 Query: 971 GXXGG 957 G GG Sbjct: 165 GGYGG 169 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 31.1 bits (67), Expect = 1.7 Identities = 14/42 (33%), Positives = 16/42 (38%) Frame = +3 Query: 1029 PPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPP 1154 P P P PP PPP + +LPP P PP Sbjct: 32 PSLIPTRFFLPHPPPPPPPPPPPLYFSYFSLPPPPPPPHLPP 73 Score = 30.3 bits (65), Expect = 2.9 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 1056 PPXPPXGXPPPXXXFFSXPXALPPXKXPXXS 1148 PP PP PP +FS P PP P S Sbjct: 45 PPPPPPPPPPLYFSYFSLPPPPPPPHLPPTS 75 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 31.1 bits (67), Expect = 1.7 Identities = 26/109 (23%), Positives = 27/109 (24%) Frame = +3 Query: 822 SXGGLXXFSPXPRGXXPPXEGGXHRAPPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWX 1001 S L S P P APP + P P PP P Sbjct: 23 SSSSLSPSSSSPSLSPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPPSSSPLSSLS 82 Query: 1002 XFXXGGXRPPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXS 1148 PP P P PPP S P PP P S Sbjct: 83 PSL--SPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPPSSSPLSS 129 >At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein similar to SP|Q15459 Splicing factor 3 subunit 1 (Spliceosome associated protein 114) {Homo sapiens}; contains Pfam profiles PF00240: Ubiquitin family, PF01805: Surp module Length = 785 Score = 31.1 bits (67), Expect = 1.7 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +2 Query: 1184 KPXRXFPPXGGGGXXPPPXGGGWXXPPPAXXAPPPP 1291 +P PP G PPP G PPP PP P Sbjct: 639 RPYGQLPPSAMGMMQPPPMPGMAPPPPPEEAPPPLP 674 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 30.7 bits (66), Expect = 2.2 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP P PP F P P PPP Sbjct: 348 PPPGMLRFPPPPPPLDMHPPHPGMFVGHLIPRPPYGPPPGPPP 390 Score = 29.9 bits (64), Expect = 3.9 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +3 Query: 1059 PXPPXGXPPPXXXFFSXPXALPPXKXPXXS--PPXGGGG 1169 P PP G PPP F P PP + P S PP G G Sbjct: 219 PPPPPG-PPPKEQDFVRPPLPPPPQLPQSSQPPPPGLSG 256 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 30.7 bits (66), Expect = 2.2 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPPGXGG 1167 P P P P P PP P P P K P P GG Sbjct: 86 PKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTPAPKPKPAPKPAPGG 132 Score = 30.7 bits (66), Expect = 2.2 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPPG 1158 AP P P P PP P P P P P+ K P PG Sbjct: 91 APTPPNPKPTPAPTPPKPKPAPA----PAPTPAPKPKPAPKPAPG 131 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 30.7 bits (66), Expect = 2.2 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = -2 Query: 1153 GGXXXGXXXGGXAXGXEKXXXX-GGGXPXGGXGGXXLXGXXGGGRXPP 1013 GG G GG A G GGG GG GG G G GR P Sbjct: 373 GGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGGRGGYGGGGSGRYHP 420 Score = 29.1 bits (62), Expect = 6.7 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = -1 Query: 1154 GGGXXGXFXRGXXXGXGKKXXXGGGXPXGGXGGG 1053 GGG G + G G G GGG GG GGG Sbjct: 381 GGGGAGGYGAG-GGGNGGGSFYGGGGGRGGYGGG 413 >At5g08230.1 68418.m00965 PWWP domain-containing protein putative transcription factor (HUA2) - Arabidopsis thaliana, EMBL:AF116556 Length = 1445 Score = 30.7 bits (66), Expect = 2.2 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 1018 GXAPPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 G P P PPP PP PPP P P PPP Sbjct: 1124 GSPPLPHESPPSPPPQPPSSPPPPSSP--PQLAPAPPPSDHCLPPP 1167 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 30.7 bits (66), Expect = 2.2 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXP--RXKXPXXPPP 1155 PPP P PP PP P P P R + P PPP Sbjct: 17 PPPPPLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPP 61 >At5g04170.1 68418.m00405 calcium-binding EF hand family protein low similarity to peflin [Homo sapiens] GI:6015440; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 354 Score = 30.7 bits (66), Expect = 2.2 Identities = 17/47 (36%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -3 Query: 1263 GGXXHPP---PXGGGXXPPPPXGGKXRXGF*XXPPPPXPXGGXXGGF 1132 G PP P GGG PPP G + P P P G GG+ Sbjct: 84 GDYNKPPKEKPYGGGYGAPPPSGSSDYGSYGAGPRPSQP-SGHGGGY 129 Score = 29.5 bits (63), Expect = 5.1 Identities = 17/52 (32%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = -3 Query: 1281 GAXXAGGGXXHPPPXGGGXXPPPPXGGKXRXGF*XXPPPPXP--XGGXXGGF 1132 G+ AG P GGG PP G + PP P GG GG+ Sbjct: 111 GSYGAGPRPSQPSGHGGGYGATPPHGVSDYGSYGGAPPRPASSGHGGGYGGY 162 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 30.7 bits (66), Expect = 2.2 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 1154 GGGXXGXFXRGXXXGXGKKXXXGGGXPXGGXGGGXXXXXXGG 1029 GGG G G G G GGG G GGG GG Sbjct: 90 GGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGG 131 Score = 29.1 bits (62), Expect = 6.7 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 4/47 (8%) Frame = -1 Query: 1154 GGGXXGXFXR----GXXXGXGKKXXXGGGXPXGGXGGGXXXXXXGGG 1026 GGG G R G G G + GGG GG GG GGG Sbjct: 119 GGGGGGYERRSGGYGSGGGGGGRGYGGGGRREGGGYGGGDGGSYGGG 165 >At4g13390.1 68417.m02092 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 429 Score = 30.7 bits (66), Expect = 2.2 Identities = 28/123 (22%), Positives = 37/123 (30%), Gaps = 2/123 (1%) Frame = +3 Query: 843 FSPXPRGXX--PPXEGGXHRAPPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFXXG 1016 +SP P+ PP PP + P PPP + Sbjct: 165 YSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVEYKSP-PPPYVYSFPPPPPYYSPSPKV 223 Query: 1017 GXRPPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPV 1196 G + PP PP PP P P + S P P PP K+PP Sbjct: 224 GYKSPPAPYVYSSPPPPPYYSPSPKVNYKSPPPPYVYSSPP--PPPYSPSPKVEFKSPPP 281 Query: 1197 XFL 1205 ++ Sbjct: 282 PYI 284 >At3g13225.1 68416.m01660 WW domain-containing protein contains Pfam profile PF00397: WW domain Length = 863 Score = 30.7 bits (66), Expect = 2.2 Identities = 12/23 (52%), Positives = 13/23 (56%), Gaps = 2/23 (8%) Frame = +2 Query: 1229 PPPXGGGWXXPPP--AXXAPPPP 1291 PPP G W PPP + PPPP Sbjct: 508 PPPPGEEWIPPPPSESEDVPPPP 530 >At3g11130.1 68416.m01349 clathrin heavy chain, putative similar to Swiss-Prot:Q00610 clathrin heavy chain 1 (CLH-17) [Homo sapiens] Length = 1705 Score = 30.7 bits (66), Expect = 2.2 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +2 Query: 1187 PXRXFPPXGGGGXXPPPXGGGWXXPPPAXXAPPPPXXG 1300 P P GGGG PPP GG P PP P G Sbjct: 1664 PAPPMPGMGGGGYGPPPQMGGM---PGMSGMPPMPPYG 1698 >At3g07540.1 68416.m00900 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 841 Score = 30.7 bits (66), Expect = 2.2 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 1054 PPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PP PPP F P P P P Sbjct: 61 PPPSPPQPLPPPAPTFATFPANISALVLPRSPKP 94 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 30.7 bits (66), Expect = 2.2 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 +PPP P PP PP P P P PPP Sbjct: 112 SPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPP 155 Score = 29.1 bits (62), Expect = 6.7 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +2 Query: 1136 PPXXPPXGXGGGGLXQKPXRXFPPXGGGGXXPPPXGGGWXXPPPAXXAPPP 1288 PP PP P PP P P PPPA +PPP Sbjct: 96 PPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPAS-----PPPAPASPPP 141 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 30.7 bits (66), Expect = 2.2 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPP 1154 PPP P P PP P + P PP P SPP Sbjct: 502 PPPPPPEYEPSPPPPSSEMSPSVRAYPPP---PPLSPPPPSPP 541 Score = 30.7 bits (66), Expect = 2.2 Identities = 30/106 (28%), Positives = 33/106 (31%), Gaps = 18/106 (16%) Frame = +3 Query: 1026 PPPXX--PXXXXPPXPPX------GXPPPXXXFFSXPXALPPXKXPXXSPPXGGGG---- 1169 PPP P PP PP PPP ++S PP P PP Sbjct: 635 PPPVYYPPVTASPPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSP 694 Query: 1170 ------XXSXKNPPVXFLPXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 S PPV +LP P P PP PP P Sbjct: 695 VYYPPVTQSPPPPPVYYLPV----TQSPPPPSPVYYPPVAKSPPPP 736 Score = 29.9 bits (64), Expect = 3.9 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +1 Query: 1024 APPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 +PPP PPP P PPP P P PPP Sbjct: 539 SPPPPYIYSSPPPPSP-SPPPPYIYSSPPPVVNCPPTTQSPPPP 581 Score = 29.5 bits (63), Expect = 5.1 Identities = 25/104 (24%), Positives = 29/104 (27%), Gaps = 1/104 (0%) Frame = +3 Query: 846 SPXPRGXXPPXEGGXHRAPPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFXXGGXR 1025 SP R PP +P P P PPP + Sbjct: 479 SPSFRATPPPPSS--KMSPSVKAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPP 536 Query: 1026 PP-PXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPP 1154 PP P P P PP PPP + S P + PP Sbjct: 537 PPSPPPPYIYSSPPPPSPSPPPPYIYSSPPPVVNCPPTTQSPPP 580 Score = 29.1 bits (62), Expect = 6.7 Identities = 17/58 (29%), Positives = 20/58 (34%), Gaps = 2/58 (3%) Frame = +2 Query: 1124 PXXXPPXXPPXGXGGGGLXQKPXRXFPPXGGGGXXPP--PXGGGWXXPPPAXXAPPPP 1291 P PP P R +PP PP P + PPP +PPPP Sbjct: 502 PPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPP 559 Score = 28.7 bits (61), Expect = 8.9 Identities = 24/89 (26%), Positives = 24/89 (26%), Gaps = 3/89 (3%) Frame = +1 Query: 1033 PXXXXXXPPPXPP---XGXPPPXXXFFPXPXXXPRXKXPXXPPPGXGGGXXXSKTXPXFS 1203 P PPP PP PPP P P PPP S P Sbjct: 495 PSVKAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSP 554 Query: 1204 SXGGGXXXXXPXRGXVGXAPPXGXXPPXP 1290 S P V PP PP P Sbjct: 555 SPPPPYIYSSPP--PVVNCPPTTQSPPPP 581 >At5g19090.2 68418.m02270 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 465 Score = 30.3 bits (65), Expect = 2.9 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = -1 Query: 1127 RGXXXGXGKKXXXGGGXPXGGXGGGXXXXXXGGGAXPP 1014 +G G G G GG GGG GGG PP Sbjct: 104 KGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGGPP 141 >At3g49840.1 68416.m05449 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 606 Score = 30.3 bits (65), Expect = 2.9 Identities = 26/84 (30%), Positives = 30/84 (35%), Gaps = 3/84 (3%) Frame = +3 Query: 846 SPXPRGXXPPXEGGXHRAPPXAXGPXQGRXXGXXPR---PPPXXPXXXXXXXXWXXFXXG 1016 +P P+G PP EG PP P G P+ PP P + Sbjct: 494 APPPQGY-PPKEG----YPPAGYPPPAGYPPPQYPQAGYPPAGYPPPQQGYGQ--GYPAQ 546 Query: 1017 GXRPPPXXPXXXXPPXPPXGXPPP 1088 G PPP P P P G PPP Sbjct: 547 GY-PPPQYPQGHPPQYPYQGPPPP 569 >At2g29210.1 68415.m03550 splicing factor PWI domain-containing protein contains Pfam profile PF01480: PWI domain Length = 878 Score = 30.3 bits (65), Expect = 2.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 1202 PPXGGGGXXPPPXGGGWXXPPPAXXAPPPP 1291 PP PPP G PPPA P PP Sbjct: 454 PPVAQRLPSPPPRRAGLPSPPPAQRLPSPP 483 >At2g16630.1 68415.m01909 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 359 Score = 30.3 bits (65), Expect = 2.9 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSP 1151 PPP P P P P P LPP K P SP Sbjct: 158 PPPQVPVMPPPQVPVKPHPKVPVISPDPPATLPPPKVPVISP 199 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 30.3 bits (65), Expect = 2.9 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +1 Query: 1033 PXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 P PP PP PPP P P K PPP Sbjct: 86 PCLQNIPPPSPPPPSPPPPSQACPPPPLPPSPPKKSYCPPP 126 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 29.9 bits (64), Expect = 3.9 Identities = 13/43 (30%), Positives = 15/43 (34%) Frame = +1 Query: 1030 PPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPPG 1158 PP PPP PP + P P + PPPG Sbjct: 45 PPISPPPPPPPPPPQSHAAAYKRYSPPPPPSKYGRVYPPPPPG 87 >At4g28300.2 68417.m04053 hydroxyproline-rich glycoprotein family protein Length = 438 Score = 29.9 bits (64), Expect = 3.9 Identities = 18/54 (33%), Positives = 21/54 (38%), Gaps = 4/54 (7%) Frame = +3 Query: 822 SXGGLXXFSPXPRGXXPPXE---GGXHRAPPXAXGPXQG-RXXGXXPRPPPXXP 971 S GG +SP P G PP E P + P Q + G PPP P Sbjct: 249 SSGGYPTYSPAPPGNQPPVESLPSSMQMQSPYSGPPQQSMQAYGYGAAPPPQAP 302 >At4g28300.1 68417.m04052 hydroxyproline-rich glycoprotein family protein Length = 496 Score = 29.9 bits (64), Expect = 3.9 Identities = 18/54 (33%), Positives = 21/54 (38%), Gaps = 4/54 (7%) Frame = +3 Query: 822 SXGGLXXFSPXPRGXXPPXE---GGXHRAPPXAXGPXQG-RXXGXXPRPPPXXP 971 S GG +SP P G PP E P + P Q + G PPP P Sbjct: 307 SSGGYPTYSPAPPGNQPPVESLPSSMQMQSPYSGPPQQSMQAYGYGAAPPPQAP 360 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 29.9 bits (64), Expect = 3.9 Identities = 16/55 (29%), Positives = 17/55 (30%) Frame = +3 Query: 1029 PPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPP 1193 P P P P PPP +LPP PP S NPP Sbjct: 118 PHPTPKKSPSPPPTPSLPPPAPKKSPSTPSLPPPTPKKSPPPPPSHHSSSPSNPP 172 Score = 29.5 bits (63), Expect = 5.1 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXX-FFPXPXXXPRXKXPXXPP 1152 PPP PPP P PP F P P P+ K P PP Sbjct: 91 PPPAPKKSPPPPTPKKSPSPPSLTPFVPHP--TPK-KSPSPPP 130 Score = 29.5 bits (63), Expect = 5.1 Identities = 13/42 (30%), Positives = 13/42 (30%) Frame = +1 Query: 1030 PPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PP P P P PP P P P PPP Sbjct: 110 PPSLTPFVPHPTPKKSPSPPPTPSLPPPAPKKSPSTPSLPPP 151 >At2g18470.1 68415.m02151 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 633 Score = 29.9 bits (64), Expect = 3.9 Identities = 22/82 (26%), Positives = 22/82 (26%) Frame = +1 Query: 1054 PPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPPGXGGGXXXSKTXPXFSSXGGGXXXXX 1233 P P PP PP P P P P S P S GGG Sbjct: 31 PAPSPPSPTPPQGDSSSSPPPDSTSPPAPQAPNPPNS-----SNNSPSPPSQGGGGERGN 85 Query: 1234 PXRGXVGXAPPXGXXPPXPXXR 1299 PP PP P R Sbjct: 86 GGNNGGNDTPPSRGSPPSPPSR 107 Score = 28.7 bits (61), Expect = 8.9 Identities = 21/88 (23%), Positives = 22/88 (25%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFL 1205 P P PP PP + PP P S N P Sbjct: 17 PSPPSNTNSTTSSPPAPSPPSPTPPQGDSSSSPPPDSTSPPAPQAPNPPNSSNNSPSPPS 76 Query: 1206 PXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 GG G PP R PP P Sbjct: 77 QGGGGERGNGGNNGGNDTPPSRGSPPSP 104 Score = 28.7 bits (61), Expect = 8.9 Identities = 23/77 (29%), Positives = 26/77 (33%), Gaps = 1/77 (1%) Frame = -2 Query: 1075 PXGGXGGXXLXGXXGGGRXPPXXKXXQXXXXXXXXGXXGGGRGXXPXXRPWXGPXAXGGA 896 P G GG G GG P + G GG R P GG+ Sbjct: 75 PSQGGGGERGNGGNNGGNDTPPSRGSPPSPPSRSNGDNGGSRSSPPGD--------TGGS 126 Query: 895 R-XHPPSXGGXXPLGXG 848 R +PPS GG G G Sbjct: 127 RSDNPPSSGGSSGGGGG 143 >At1g22610.1 68414.m02823 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 1029 Score = 29.9 bits (64), Expect = 3.9 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -3 Query: 1281 GAXXAGGGXXHPPPXGGGXXPPPPXGGKXRXGF*XXPPPP 1162 GA GGG P PPPP + R F P PP Sbjct: 201 GAHAGGGGGAPPMSQAKQAYPPPPNQPEFRSDFMRAPGPP 240 >At1g12810.1 68414.m01488 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 129 Score = 29.9 bits (64), Expect = 3.9 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPPGXGG 1167 PPP PPP P PPP +P P P PP GG Sbjct: 12 PPPGYQSHYPPPGYPSAPPPPG---YPSP---PSHHEGYPPPQPYGG 52 Score = 28.7 bits (61), Expect = 8.9 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +2 Query: 1187 PXRXFPPXGGGGXXPPPXGGGWXXPPPAXXAPPPPXXG 1300 P +PP G PPP G PPP +PP G Sbjct: 7 PPESYPPPGYQSHYPPP-GYPSAPPPPGYPSPPSHHEG 43 Score = 28.7 bits (61), Expect = 8.9 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 1263 GGXXHPPPXGGGXXPPPPXGGKXRXGF*XXPPPPXPXGG 1147 G H PP G PPPP G PPP P GG Sbjct: 15 GYQSHYPPPGYPSAPPPP-GYPSPPSHHEGYPPPQPYGG 52 >At1g11850.2 68414.m01364 expressed protein Length = 108 Score = 29.9 bits (64), Expect = 3.9 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 1154 GGGXXGXFXRGXXXGXGKKXXXGGGXPXGGXGGGXXXXXXGGG 1026 GG G G G G GGG GG GGG GGG Sbjct: 55 GGAGLGGLGIGAGIGAGAGLGLGGGG--GGLGGGGGGLLGGGG 95 >At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 554 Score = 29.9 bits (64), Expect = 3.9 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -3 Query: 1248 PPPXGGGXXPPPPXGGKXRXGF*XXPPPPXPXGGXXG 1138 PPP PPPP G PPPP G G Sbjct: 252 PPPGTAALPPPPPLPMAAGKGVAAPPPPPPGARGGLG 288 Score = 29.5 bits (63), Expect = 5.1 Identities = 21/67 (31%), Positives = 21/67 (31%), Gaps = 14/67 (20%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGX---------PPPXXXFFPXPXXXPRXKX-----PXXPPPGXG 1164 PPP PPP P PPP P P P P PPPG Sbjct: 225 PPPGRAALPPPPPLPMAVRKGVAAPPLPPPGTAALPPPPPLPMAAGKGVAAPPPPPPGAR 284 Query: 1165 GGXXXSK 1185 GG K Sbjct: 285 GGLGAKK 291 Score = 28.7 bits (61), Expect = 8.9 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 1270 RXGGXXPPXPGXGXXAPXPPXGRKXTGGFLXEXXPPPPXG 1151 R G PP P G A PP G PPPP G Sbjct: 243 RKGVAAPPLPPPGTAALPPPPPLPMAAGKGVAAPPPPPPG 282 >At4g08380.1 68417.m01384 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 437 Score = 29.5 bits (63), Expect = 5.1 Identities = 28/117 (23%), Positives = 33/117 (28%) Frame = +3 Query: 846 SPXPRGXXPPXEGGXHRAPPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFXXGGXR 1025 SP P PP +++PP PPP + Sbjct: 328 SPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYS----PPPSPYVYKSPPYVYSSPPPYTYS 383 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPV 1196 PPP PP P PPP P P P SPP S PP+ Sbjct: 384 PPPYA-YSPPPPCPDVYKPPPYVYSSPPPYVYNP---PPSSPPPSPSYSYSSPPPPI 436 Score = 29.5 bits (63), Expect = 5.1 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 1030 PPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PP PPP P PPP P P P PPP Sbjct: 384 PPPYAYSPPPPCPDVYKPPPYVYSSPPPYVY--NPPPSSPPP 423 >At3g50140.1 68416.m05481 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 508 Score = 29.5 bits (63), Expect = 5.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFP 1107 PPP PP PP PPP F P Sbjct: 14 PPPPRLLVLPPLPPPPPPPPPQLPFGP 40 >At4g23470.2 68417.m03383 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 199 Score = 29.1 bits (62), Expect = 6.7 Identities = 16/47 (34%), Positives = 19/47 (40%) Frame = +2 Query: 1148 PPXGXGGGGLXQKPXRXFPPXGGGGXXPPPXGGGWXXPPPAXXAPPP 1288 P G G Q P + +PP G PPP + PP PPP Sbjct: 152 PQQGYPPSGYPQHPPQGYPP-SGYPQNPPP--SAYSQYPPGAYPPPP 195 >At4g23470.1 68417.m03382 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 255 Score = 29.1 bits (62), Expect = 6.7 Identities = 16/47 (34%), Positives = 19/47 (40%) Frame = +2 Query: 1148 PPXGXGGGGLXQKPXRXFPPXGGGGXXPPPXGGGWXXPPPAXXAPPP 1288 P G G Q P + +PP G PPP + PP PPP Sbjct: 208 PQQGYPPSGYPQHPPQGYPP-SGYPQNPPP--SAYSQYPPGAYPPPP 251 >At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containing protein similar to Hsc70-interacting protein (Hip) from {Homo sapiens} SP|P50502, {Rattus norvegicus} SP|P50503; contains Pfam profile PF00515: tetratricopeptide repeat (TPR) domain Length = 441 Score = 29.1 bits (62), Expect = 6.7 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 1151 GGXXGXFXRGXXXGXGKKXXXGGGXPXGGXGGGXXXXXXGGG 1026 GG G F G G G GGG P G GGG GGG Sbjct: 328 GGMPGGFPGGM--GGGMPAGMGGGMP--GMGGGMPAGMGGGG 365 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 29.1 bits (62), Expect = 6.7 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = -3 Query: 1269 AGGGXXHPPPXGGGXXP--PPPXGGKXRXGF*XXPPPP 1162 + GG +PPP GG P PPP F PPP Sbjct: 97 SSGGYYYPPPKSGGNYPYTPPPNPIVPYFPFYYYNPPP 134 >At3g57670.1 68416.m06425 zinc finger (C2H2 type) protein (WIP2) identical to WIP2 protein [Arabidopsis thaliana] gi|18027012|gb|AAL55722; contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 383 Score = 29.1 bits (62), Expect = 6.7 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 1054 PPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 P P PP PP FFP R P PPP Sbjct: 30 PHPLPPV-TPPSSFFFFPQSGDLRRPPPPPTPPP 62 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 29.1 bits (62), Expect = 6.7 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 1229 PPPXGGGWXXPPPAXXAPPPPXXG 1300 PPP G W PP PPPP G Sbjct: 268 PPPPPGSWQPSPP---PPPPPVSG 288 >At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 633 Score = 29.1 bits (62), Expect = 6.7 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = -1 Query: 1154 GGGXXGXFXRGXXXGXGKKXXXGGGXPX-GGXGGGXXXXXXGG-GAXPP 1014 G G G G G G GGG GG GGG GG G PP Sbjct: 581 GSGRGGYGGGGGGYGGGGGYGGGGGYGGGGGYGGGYGGASSGGYGGEPP 629 Score = 28.7 bits (61), Expect = 8.9 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = -1 Query: 1151 GGXXGX--FXRGXXXGXGKKXXXGGGXPXGGXGGGXXXXXXGGG 1026 GG G F R G G+ GGG GG GG GGG Sbjct: 566 GGRFGGRDFRREGSFGSGRGGYGGGGGGYGGGGGYGGGGGYGGG 609 >At1g27750.1 68414.m03391 ubiquitin system component Cue domain-containing protein very low similarity to ASC-1 complex subunit P100 [Homo sapiens] GI:12061187; contains Pfam profile PF02845: CUE domain Length = 1973 Score = 29.1 bits (62), Expect = 6.7 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +3 Query: 1029 PPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPP 1154 PP P P PP PPP + P LP P PP Sbjct: 861 PPLQPQSQPPEPPPEMMPPPPQ---ALPPPLPHSHPPLVPPP 899 Score = 28.7 bits (61), Expect = 8.9 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 1029 PPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSP 1151 PP P PP PP PPP P PP P SP Sbjct: 869 PPEPPPEMMPP-PPQALPPPLPHSHP-PLVPPPPFSPLLSP 907 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 29.1 bits (62), Expect = 6.7 Identities = 35/152 (23%), Positives = 42/152 (27%), Gaps = 4/152 (2%) Frame = +3 Query: 846 SPXPRGXXPPXEGGXHRAPPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFXXGGXR 1025 SP P PP PP P PPP + + Sbjct: 374 SPKPTYKSPPPPYVYSSPPPPYYSPSP---KPVYKSPPPPYIYNSPPPPYYSPSPKPSYK 430 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPX-GGGGXXSXKNPPVXF 1202 PP P P PP P P + S P PP PP K+PP + Sbjct: 431 SPPP-PYVYSSPPPPYYSPSPKLTYKSSP---PPYVYSSPPPPYYSPSPKVVYKSPPPPY 486 Query: 1203 L---PXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 + P + P P PP P P Sbjct: 487 VYSSPPPPYYSPSPKPSYKSPPPPYVYNSPPP 518 Score = 28.7 bits (61), Expect = 8.9 Identities = 24/93 (25%), Positives = 30/93 (32%), Gaps = 4/93 (4%) Frame = +3 Query: 1023 RPPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPP-XGGGGXXSXKNPPVX 1199 + PP PP PP P P + S P PP PP K+PP Sbjct: 556 KSPPTPYVYHSPPPPPYYSPSPKPAYKSSP---PPYVYSSPPPPYYSPAPKPVYKSPPPP 612 Query: 1200 FL---PXGGXGAXXPXPGXGGXXPPXRXXPPXP 1289 ++ P + P P PP P P Sbjct: 613 YVYNSPPPPYYSPSPKPTYKSPPPPYVYSSPPP 645 Score = 28.7 bits (61), Expect = 8.9 Identities = 28/121 (23%), Positives = 34/121 (28%), Gaps = 1/121 (0%) Frame = +3 Query: 846 SPXPRGXXPPXEGGXHRAPPXAXGPXQGRXXGXXPRPPPXXPXXXXXXXXWXXFXXGGXR 1025 SP P PP PP P PPP + + Sbjct: 676 SPKPTYKSPPPPYVYSSPPPPYYSPAP---KPTYKSPPPPYVYSSPPPPYYSPSPKPTYK 732 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPP-XGGGGXXSXKNPPVXF 1202 PP PP PP P P + S P PP PP K+PP + Sbjct: 733 SPPPPYVYSSPPPPPYYSPSPKVEYKSPP---PPYVYSSPPPPYYSPSPKVEYKSPPPPY 789 Query: 1203 L 1205 + Sbjct: 790 V 790 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 29.1 bits (62), Expect = 6.7 Identities = 20/61 (32%), Positives = 21/61 (34%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPPXGGGGXXSXKNPPVXFL 1205 PPP P PP PP PPP + P PP K PP PP Sbjct: 59 PPPPSPPPPSPP-PPACPPPP-----ALPPP-PPKKVSSYCPPPPPANFLYITGPPGNLY 111 Query: 1206 P 1208 P Sbjct: 112 P 112 Score = 28.7 bits (61), Expect = 8.9 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = +1 Query: 1033 PXXXXXXPPPXPPXGXPPPXXXFFP--XPXXXPRXKXPXXPPP 1155 P PPP PP PPP P P P+ PPP Sbjct: 53 PSCIQNPPPPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPP 95 >At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein similar to human splicing factor GB:CAA59494 GI:899298 from [Homo sapiens]; contains Pfam profile PF01805: Surp module Length = 735 Score = 29.1 bits (62), Expect = 6.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 1232 PPXGGGWXXPPPAXXAPPPPXXG 1300 PP G PPP PPPP G Sbjct: 632 PPLSMGMMQPPPMAEMPPPPPPG 654 Score = 28.7 bits (61), Expect = 8.9 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = +2 Query: 1136 PPXXPPXGXGGGGLXQKPXRXFPPXGGGGXXPPPXGGGWXXPPPAXXAPPPP 1291 PP PP +P PP G PPP PPP PP P Sbjct: 612 PP--PPGSQFSHMQVPQPYGQLPPLSMGMMQPPPMAEMPPPPPPGEAPPPLP 661 >At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 175 Score = 28.7 bits (61), Expect = 8.9 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +1 Query: 1027 PPPXXXXXXPPPXPPXGXPPPXXXFFPXPXXXPRXKXPXXPP 1152 PPP PPP PP PP P P + P PP Sbjct: 65 PPPPSPQYSPPP-PPSQSSPPRSRCPPVPTTGCCNQPPGPPP 105 >At5g10270.1 68418.m01192 cyclin-dependent kinase, putative / CDK, putative similar to cyclin dependent kinase C [Lycopersicon esculentum] gi|15215944|emb|CAC51391 Length = 505 Score = 28.7 bits (61), Expect = 8.9 Identities = 25/84 (29%), Positives = 27/84 (32%), Gaps = 6/84 (7%) Frame = +3 Query: 1032 PXXPXXXXPPXPPXGXPPPXXXFFSXPXALP-PXKXPXXSPPXGG-----GGXXSXKNPP 1193 P P PP P G P F+ P P P + P GG GG S PP Sbjct: 396 PNHPTNNAPPQVPAG---PSHNFYGKPRGPPGPNRYPPSGNQSGGYNQSRGGYSSGSYPP 452 Query: 1194 VXFLPXGGXGAXXPXPGXGGXXPP 1265 G P G G PP Sbjct: 453 QGRGAPYVAGPRGPSGGPYGVGPP 476 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 28.7 bits (61), Expect = 8.9 Identities = 26/99 (26%), Positives = 28/99 (28%), Gaps = 1/99 (1%) Frame = -2 Query: 1162 PPXGGXXXGXXXGGXAXGXEKXXXXGGGXPXGGXGGXXLXGXXGGGR-XPPXXKXXQXXX 986 P G G G G + G G GG GG G GGGR K + Sbjct: 81 PVQGNSGGGSSGGRGGFGGGRGGGRGSGGGYGG-GGGGYGGRGGGGRGGSDCYKCGEPGH 139 Query: 985 XXXXXGXXGGGRGXXPXXRPWXGPXAXGGARXHPPSXGG 869 GGG G G GG GG Sbjct: 140 MARDCSEGGGGYGGGGGGYGGGGGYGGGGGGYGGGGRGG 178 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 28.7 bits (61), Expect = 8.9 Identities = 14/47 (29%), Positives = 15/47 (31%) Frame = +3 Query: 1014 GGXRPPPXXPXXXXPPXPPXGXPPPXXXFFSXPXALPPXKXPXXSPP 1154 G PPP PP PP P + P P SPP Sbjct: 46 GSSVPPPVMSPMPMMTPPPMPMTPPPMPMTPPPMPMAPPPMPMASPP 92 >At4g08370.1 68417.m01382 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 350 Score = 28.7 bits (61), Expect = 8.9 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = +3 Query: 1026 PPPXXPXXXXPPXPPX--GXPPPXXXFFSXPXALPPXKXPXXSPP 1154 PPP PP PP PPP +S P PP SPP Sbjct: 76 PPPPPYIYNSPPRPPYVYKSPPPPPFVYSSP---PPPTYIYNSPP 117 >At3g07100.1 68416.m00845 protein transport protein Sec24, putative similar to protein transport protein Sec24A (SEC24-related protein) [Homo sapiens] SWISS-PROT:O95486 Length = 1038 Score = 28.7 bits (61), Expect = 8.9 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Frame = +1 Query: 1018 GXAPPPXXXXXXPPP--XPPXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 G PPP P P PP G P FP P P PPP Sbjct: 86 GSRPPPPSSNSFPSPAYGPPGGAP---FQRFPSPPFPTTQNPPQGPPP 130 >At2g05440.2 68415.m00575 glycine-rich protein Length = 154 Score = 28.7 bits (61), Expect = 8.9 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 1154 GGGXXGXFXRGXXXGXGKKXXXGGGXPXGGXGGGXXXXXXGGG 1026 GGG G G G G GGG GG GG GGG Sbjct: 85 GGGHYGG-GGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGG 126 Score = 28.7 bits (61), Expect = 8.9 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 1154 GGGXXGXFXRGXXXGXGKKXXXGGGXPXGGXGGGXXXXXXGGG 1026 GGG G G G GGG GG GG GGG Sbjct: 92 GGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGG 134 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 28.7 bits (61), Expect = 8.9 Identities = 15/50 (30%), Positives = 18/50 (36%), Gaps = 7/50 (14%) Frame = +1 Query: 1027 PPPXXXXXXPPPXP-------PXGXPPPXXXFFPXPXXXPRXKXPXXPPP 1155 PPP PPP P P PPP ++ P+ PPP Sbjct: 25 PPPSLPPPVPPPPPSHQPYSYPPPPPPPPHAYYQQGPHYPQFNQLQAPPP 74 >At1g76500.1 68414.m08901 DNA-binding family protein contains Pfam domain, PF02178: AT hook motif Length = 302 Score = 28.7 bits (61), Expect = 8.9 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 1211 GGGGXXPPPXGGGWXXPPPAXXAPPPPXXG 1300 GG G GGG PPPA + PP G Sbjct: 237 GGEGGEVGEGGGGEGGPPPATSSSPPSGAG 266 >At1g23050.1 68414.m02880 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 161 Score = 28.7 bits (61), Expect = 8.9 Identities = 19/56 (33%), Positives = 20/56 (35%), Gaps = 4/56 (7%) Frame = +2 Query: 1136 PPXXPPXGXG----GGGLXQKPXRXFPPXGGGGXXPPPXGGGWXXPPPAXXAPPPP 1291 PP PP G G L P PP G P P GG + PPPP Sbjct: 54 PPPYPPPGVNYPTPAGNLPNYP----PPVGNIPNYPSPPYGGGDSSGSSFYGPPPP 105 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,689,618 Number of Sequences: 28952 Number of extensions: 468320 Number of successful extensions: 11258 Number of sequences better than 10.0: 153 Number of HSP's better than 10.0 without gapping: 971 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5700 length of database: 12,070,560 effective HSP length: 83 effective length of database: 9,667,544 effective search space used: 3402975488 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -