BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_H24 (970 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) 95 6e-20 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 6e-20 SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 9e-14 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 73 3e-13 SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) 73 5e-13 SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 6e-12 SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) 68 1e-11 SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 8e-09 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 56 6e-08 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 49 5e-06 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 47 3e-05 SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 3e-05 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) 45 1e-04 SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) 45 1e-04 SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) 45 1e-04 SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) 45 1e-04 SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) 45 1e-04 SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) 45 1e-04 SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) 45 1e-04 SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 45 1e-04 SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) 45 1e-04 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 45 1e-04 SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) 45 1e-04 SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) 45 1e-04 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 45 1e-04 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) 45 1e-04 SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) 45 1e-04 SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) 45 1e-04 SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) 45 1e-04 SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) 45 1e-04 SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) 45 1e-04 SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) 45 1e-04 SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) 45 1e-04 SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) 45 1e-04 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) 45 1e-04 SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) 45 1e-04 SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) 45 1e-04 SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) 45 1e-04 SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) 45 1e-04 SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) 45 1e-04 SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) 45 1e-04 SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_18781| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) 45 1e-04 SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 45 1e-04 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) 45 1e-04 SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) 45 1e-04 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 45 1e-04 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 45 1e-04 SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) 45 1e-04 SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) 45 1e-04 SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) 45 1e-04 SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) 45 1e-04 SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) 45 1e-04 SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) 45 1e-04 SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 45 1e-04 SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) 45 1e-04 SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) 45 1e-04 SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 45 1e-04 SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) 45 1e-04 SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) 45 1e-04 SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) 45 1e-04 SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) 45 1e-04 SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_56405| Best HMM Match : Fels1 (HMM E-Value=6.5) 45 1e-04 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55772| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55573| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) 45 1e-04 SB_55103| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55047| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_54903| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_54851| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_54482| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 45 1e-04 SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_53836| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_53493| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_53207| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_52948| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_52761| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_52662| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) 45 1e-04 SB_52572| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_51972| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_51882| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_51647| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_51566| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_51213| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_50537| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_50527| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_50288| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_49986| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_49737| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_49720| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_48785| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_47297| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_46711| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_46514| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 45 1e-04 SB_46282| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_46221| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_45973| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_45953| Best HMM Match : LRR_1 (HMM E-Value=7.4e-15) 45 1e-04 SB_45744| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_45699| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_45621| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) 45 1e-04 SB_45253| Best HMM Match : ig (HMM E-Value=0.00016) 45 1e-04 SB_45037| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_44899| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) 45 1e-04 SB_44593| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_44336| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_44213| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_44147| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_44009| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7) 45 1e-04 SB_43776| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_43277| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_43062| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_43007| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_42249| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_42173| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_41969| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_41303| Best HMM Match : DUF485 (HMM E-Value=2) 45 1e-04 SB_40919| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40898| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40785| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40759| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40752| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.5) 45 1e-04 SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40596| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40501| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40404| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40215| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40094| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_39735| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_39642| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_39544| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_39336| Best HMM Match : Kinesin (HMM E-Value=0) 45 1e-04 SB_39320| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 45 1e-04 SB_39131| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_39083| Best HMM Match : PhaC_N (HMM E-Value=0.7) 45 1e-04 SB_39081| Best HMM Match : Pertussis_S2S3 (HMM E-Value=9.8) 45 1e-04 SB_38904| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_38654| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) 45 1e-04 SB_38317| Best HMM Match : bZIP_2 (HMM E-Value=5.1e-14) 45 1e-04 SB_38140| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_37833| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_37700| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_37689| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_37634| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_37586| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_37467| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_37442| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_37275| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_37081| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_36845| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_36843| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_36822| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_36672| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_36551| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_36497| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_36480| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_36092| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_36066| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_36015| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_35911| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_35809| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_35778| Best HMM Match : Dickkopf_N (HMM E-Value=2.4) 45 1e-04 SB_35695| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_35616| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_35502| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_35393| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_35230| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_35217| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_35048| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_34691| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 45 1e-04 SB_34399| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_34374| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_34227| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_34125| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) 45 1e-04 SB_33490| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_33325| Best HMM Match : ShTK (HMM E-Value=6.3e-10) 45 1e-04 SB_33281| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024) 45 1e-04 SB_32541| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_32443| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_32291| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_32217| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_32188| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_32162| Best HMM Match : Ras (HMM E-Value=4.7e-31) 45 1e-04 SB_32050| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_31853| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_31524| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_31275| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_31071| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_30889| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_30687| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_30453| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_30166| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_30004| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_29812| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_29620| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_29583| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_29441| Best HMM Match : MFS_1 (HMM E-Value=1.6e-12) 45 1e-04 SB_29433| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_29380| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_29161| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_29146| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_28829| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_28797| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_28439| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_28284| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_28002| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_27895| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 45 1e-04 SB_27625| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_27082| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_26894| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_26697| Best HMM Match : EGF (HMM E-Value=7.5e-34) 45 1e-04 SB_26278| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_26034| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_26029| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_25779| Best HMM Match : DUF485 (HMM E-Value=5.1) 45 1e-04 SB_25252| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_25111| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24900| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24899| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24625| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24558| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24302| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24239| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_23976| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_23972| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_23930| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_23315| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_23224| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_23079| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_22871| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_22743| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_22715| Best HMM Match : SAM_PNT (HMM E-Value=1.8) 45 1e-04 SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_22298| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_22087| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_21944| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_21601| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 45 1e-04 SB_21220| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_21197| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_21163| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_21132| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_21115| Best HMM Match : Swi3 (HMM E-Value=6.9) 45 1e-04 SB_20993| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_20955| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_20344| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_20082| Best HMM Match : DUF378 (HMM E-Value=4.1) 45 1e-04 SB_20043| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_19841| Best HMM Match : Myb_DNA-binding (HMM E-Value=1.1) 45 1e-04 SB_19497| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_19432| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_19022| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_18824| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_18805| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_18801| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_18630| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_18572| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_18544| Best HMM Match : 7tm_1 (HMM E-Value=0.00082) 45 1e-04 SB_18337| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_18037| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_17968| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_17922| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_17258| Best HMM Match : DUF791 (HMM E-Value=0.002) 45 1e-04 SB_17135| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_16840| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 45 1e-04 SB_16764| Best HMM Match : ACPS (HMM E-Value=4.4) 45 1e-04 SB_16696| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_16602| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_16512| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_16421| Best HMM Match : HD-ZIP_N (HMM E-Value=7.6) 45 1e-04 SB_16384| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.1) 45 1e-04 SB_16324| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_16112| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_16101| Best HMM Match : RVT_1 (HMM E-Value=0.00031) 45 1e-04 SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_15771| Best HMM Match : VQ (HMM E-Value=4.3) 45 1e-04 SB_15715| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_15545| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_15218| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_15175| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_15145| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_14983| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_14808| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_14442| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_14379| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_14356| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_14291| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_13637| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_13233| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_12576| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_12547| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_12526| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_12145| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_11965| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_11390| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_11105| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 >SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) Length = 203 Score = 95.5 bits (227), Expect = 6e-20 Identities = 43/44 (97%), Positives = 43/44 (97%) Frame = +1 Query: 331 CINESANARGXAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 462 CINESANARG AVCVLGALPLPRSLTRCARSFGCGERYQLTQRR Sbjct: 100 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 143 >SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 95.5 bits (227), Expect = 6e-20 Identities = 43/44 (97%), Positives = 43/44 (97%) Frame = +1 Query: 331 CINESANARGXAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 462 CINESANARG AVCVLGALPLPRSLTRCARSFGCGERYQLTQRR Sbjct: 464 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 507 >SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 74.9 bits (176), Expect = 9e-14 Identities = 32/43 (74%), Positives = 32/43 (74%) Frame = -3 Query: 614 GXXXXDXRXGGRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP 486 G D GGRSLWKNASN AFLRF AFCWPFAHM FPA SP Sbjct: 50 GYIELDLNSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 92 Score = 29.5 bits (63), Expect = 4.3 Identities = 17/44 (38%), Positives = 19/44 (43%) Frame = -1 Query: 586 GGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYPPDSVDNRITAF 455 GG + K + F F F PDSVDNRITAF Sbjct: 59 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 102 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 73.3 bits (172), Expect = 3e-13 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = +2 Query: 470 VIHRIRGIXQEXTCEQKASKRPGTVKRPRCWRFSIGSAP 586 +I+ +GI QE TCEQKASKRPGTVKRPRCWRFSIGSAP Sbjct: 82 LIYLNQGITQERTCEQKASKRPGTVKRPRCWRFSIGSAP 120 >SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 587 GGRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP 486 GGRSLWKNASN AFLRF AFCWPFAHM FPA SP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.61 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -1 Query: 601 GXXVXGGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYPPDSVDNRITAF 455 G V GG + K + F F F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 587 GGRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP 486 GGRSLWKNASN AFLRF AFCWPFAHM FPA SP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.61 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -1 Query: 601 GXXVXGGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYPPDSVDNRITAF 455 G V GG + K + F F F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 587 GGRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP 486 GGRSLWKNASN AFLRF AFCWPFAHM FPA SP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.61 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -1 Query: 601 GXXVXGGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYPPDSVDNRITAF 455 G V GG + K + F F F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 72.5 bits (170), Expect = 5e-13 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 587 GGRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP 486 GGRSLWKNASN AFLRF AFCWPFAHM FPA SP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.61 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -1 Query: 601 GXXVXGGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYPPDSVDNRITAF 455 G V GG + K + F F F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 587 GGRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP 486 GGRSLWKNASN AFLRF AFCWPFAHM FPA SP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.61 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -1 Query: 601 GXXVXGGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYPPDSVDNRITAF 455 G V GG + K + F F F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 587 GGRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP 486 GGRSLWKNASN AFLRF AFCWPFAHM FPA SP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.61 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -1 Query: 601 GXXVXGGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYPPDSVDNRITAF 455 G V GG + K + F F F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 587 GGRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP 486 GGRSLWKNASN AFLRF AFCWPFAHM FPA SP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.61 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -1 Query: 601 GXXVXGGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYPPDSVDNRITAF 455 G V GG + K + F F F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 587 GGRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP 486 GGRSLWKNASN AFLRF AFCWPFAHM FPA SP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.61 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -1 Query: 601 GXXVXGGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYPPDSVDNRITAF 455 G V GG + K + F F F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 587 GGRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP 486 GGRSLWKNASN AFLRF AFCWPFAHM FPA SP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.61 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -1 Query: 601 GXXVXGGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYPPDSVDNRITAF 455 G V GG + K + F F F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 587 GGRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP 486 GGRSLWKNASN AFLRF AFCWPFAHM FPA SP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.61 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -1 Query: 601 GXXVXGGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYPPDSVDNRITAF 455 G V GG + K + F F F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 587 GGRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP 486 GGRSLWKNASN AFLRF AFCWPFAHM FPA SP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.61 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -1 Query: 601 GXXVXGGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYPPDSVDNRITAF 455 G V GG + K + F F F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 587 GGRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP 486 GGRSLWKNASN AFLRF AFCWPFAHM FPA SP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.61 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -1 Query: 601 GXXVXGGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYPPDSVDNRITAF 455 G V GG + K + F F F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 587 GGRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP 486 GGRSLWKNASN AFLRF AFCWPFAHM FPA SP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.61 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -1 Query: 601 GXXVXGGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYPPDSVDNRITAF 455 G V GG + K + F F F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 587 GGRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP 486 GGRSLWKNASN AFLRF AFCWPFAHM FPA SP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.61 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -1 Query: 601 GXXVXGGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYPPDSVDNRITAF 455 G V GG + K + F F F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 587 GGRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP 486 GGRSLWKNASN AFLRF AFCWPFAHM FPA SP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.61 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -1 Query: 601 GXXVXGGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYPPDSVDNRITAF 455 G V GG + K + F F F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 72.5 bits (170), Expect = 5e-13 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 587 GGRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP 486 GGRSLWKNASN AFLRF AFCWPFAHM FPA SP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.61 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -1 Query: 601 GXXVXGGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYPPDSVDNRITAF 455 G V GG + K + F F F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 587 GGRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP 486 GGRSLWKNASN AFLRF AFCWPFAHM FPA SP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.61 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -1 Query: 601 GXXVXGGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYPPDSVDNRITAF 455 G V GG + K + F F F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 587 GGRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP 486 GGRSLWKNASN AFLRF AFCWPFAHM FPA SP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.61 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -1 Query: 601 GXXVXGGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYPPDSVDNRITAF 455 G V GG + K + F F F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 587 GGRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP 486 GGRSLWKNASN AFLRF AFCWPFAHM FPA SP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.61 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -1 Query: 601 GXXVXGGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYPPDSVDNRITAF 455 G V GG + K + F F F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 587 GGRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP 486 GGRSLWKNASN AFLRF AFCWPFAHM FPA SP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.61 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -1 Query: 601 GXXVXGGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYPPDSVDNRITAF 455 G V GG + K + F F F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 587 GGRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP 486 GGRSLWKNASN AFLRF AFCWPFAHM FPA SP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.61 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -1 Query: 601 GXXVXGGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYPPDSVDNRITAF 455 G V GG + K + F F F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 587 GGRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP 486 GGRSLWKNASN AFLRF AFCWPFAHM FPA SP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.61 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -1 Query: 601 GXXVXGGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYPPDSVDNRITAF 455 G V GG + K + F F F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 587 GGRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP 486 GGRSLWKNASN AFLRF AFCWPFAHM FPA SP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.61 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -1 Query: 601 GXXVXGGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYPPDSVDNRITAF 455 G V GG + K + F F F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 587 GGRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP 486 GGRSLWKNASN AFLRF AFCWPFAHM FPA SP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.61 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -1 Query: 601 GXXVXGGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYPPDSVDNRITAF 455 G V GG + K + F F F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 72.5 bits (170), Expect = 5e-13 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 587 GGRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP 486 GGRSLWKNASN AFLRF AFCWPFAHM FPA SP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.61 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -1 Query: 601 GXXVXGGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYPPDSVDNRITAF 455 G V GG + K + F F F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 587 GGRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP 486 GGRSLWKNASN AFLRF AFCWPFAHM FPA SP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.61 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -1 Query: 601 GXXVXGGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYPPDSVDNRITAF 455 G V GG + K + F F F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 72.5 bits (170), Expect = 5e-13 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 587 GGRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP 486 GGRSLWKNASN AFLRF AFCWPFAHM FPA SP Sbjct: 93 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 126 Score = 29.5 bits (63), Expect = 4.3 Identities = 17/44 (38%), Positives = 19/44 (43%) Frame = -1 Query: 586 GGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYPPDSVDNRITAF 455 GG + K + F F F PDSVDNRITAF Sbjct: 93 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 136 >SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 587 GGRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP 486 GGRSLWKNASN AFLRF AFCWPFAHM FPA SP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.61 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -1 Query: 601 GXXVXGGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYPPDSVDNRITAF 455 G V GG + K + F F F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 587 GGRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP 486 GGRSLWKNASN AFLRF AFCWPFAHM FPA SP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.61 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -1 Query: 601 GXXVXGGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYPPDSVDNRITAF 455 G V GG + K + F F F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) Length = 347 Score = 72.5 bits (170), Expect = 5e-13 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +2 Query: 485 RGIXQEXTCEQKASKRPGTVKRPRCWRFSIGSAP 586 +GI QE TCEQKASKRPGTVKRPRCWRFSIGSAP Sbjct: 116 QGITQERTCEQKASKRPGTVKRPRCWRFSIGSAP 149 >SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 587 GGRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP 486 GGRSLWKNASN AFLRF AFCWPFAHM FPA SP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.61 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -1 Query: 601 GXXVXGGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYPPDSVDNRITAF 455 G V GG + K + F F F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 587 GGRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP 486 GGRSLWKNASN AFLRF AFCWPFAHM FPA SP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.61 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -1 Query: 601 GXXVXGGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYPPDSVDNRITAF 455 G V GG + K + F F F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 587 GGRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP 486 GGRSLWKNASN AFLRF AFCWPFAHM FPA SP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.61 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -1 Query: 601 GXXVXGGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYPPDSVDNRITAF 455 G V GG + K + F F F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 587 GGRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP 486 GGRSLWKNASN AFLRF AFCWPFAHM FPA SP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.61 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -1 Query: 601 GXXVXGGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYPPDSVDNRITAF 455 G V GG + K + F F F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 587 GGRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP 486 GGRSLWKNASN AFLRF AFCWPFAHM FPA SP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.61 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -1 Query: 601 GXXVXGGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYPPDSVDNRITAF 455 G V GG + K + F F F PDSVDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 901 Score = 70.9 bits (166), Expect = 1e-12 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -1 Query: 586 GGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYP 488 GGGAYGKTPAT PFYGS PFAGLLLTC FLRYP Sbjct: 759 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP 791 Score = 55.2 bits (127), Expect = 8e-08 Identities = 31/45 (68%), Positives = 33/45 (73%) Frame = -2 Query: 552 GLFTVPGLLLAFCSHVXSCXIPLILWITVLPPLSELIPLAAAERP 418 G + GLLL CS + PLILWITVLPPLSELIPLAAAERP Sbjct: 774 GSWPFAGLLLT-CSFLR---YPLILWITVLPPLSELIPLAAAERP 814 >SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 70.9 bits (166), Expect = 1e-12 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -1 Query: 586 GGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYP 488 GGGAYGKTPAT PFYGS PFAGLLLTC FLRYP Sbjct: 1 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP 33 Score = 55.2 bits (127), Expect = 8e-08 Identities = 31/45 (68%), Positives = 33/45 (73%) Frame = -2 Query: 552 GLFTVPGLLLAFCSHVXSCXIPLILWITVLPPLSELIPLAAAERP 418 G + GLLL CS + PLILWITVLPPLSELIPLAAAERP Sbjct: 16 GSWPFAGLLLT-CSFLR---YPLILWITVLPPLSELIPLAAAERP 56 >SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 70.9 bits (166), Expect = 1e-12 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -1 Query: 586 GGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYP 488 GGGAYGKTPAT PFYGS PFAGLLLTC FLRYP Sbjct: 24 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP 56 Score = 55.6 bits (128), Expect = 6e-08 Identities = 36/61 (59%), Positives = 39/61 (63%), Gaps = 2/61 (3%) Frame = -2 Query: 594 SXGGA--EPMEKRQQRGLFTVPGLLLAFCSHVXSCXIPLILWITVLPPLSELIPLAAAER 421 S GGA + R G + GLLL CS + PLILWITVLPPLSELIPLAAAER Sbjct: 23 SGGGAYGKTPATRPFYGSWPFAGLLLT-CSFLR---YPLILWITVLPPLSELIPLAAAER 78 Query: 420 P 418 P Sbjct: 79 P 79 >SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 70.9 bits (166), Expect = 1e-12 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -1 Query: 586 GGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYP 488 GGGAYGKTPAT PFYGS PFAGLLLTC FLRYP Sbjct: 406 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP 438 Score = 56.4 bits (130), Expect = 3e-08 Identities = 36/63 (57%), Positives = 38/63 (60%) Frame = -2 Query: 606 FXGXSXGGAEPMEKRQQRGLFTVPGLLLAFCSHVXSCXIPLILWITVLPPLSELIPLAAA 427 F G G P R G + GLLL CS + PLILWITVLPPLSELIPLAAA Sbjct: 404 FEGGGAYGKTPAT-RPFYGSWPFAGLLLT-CSFLR---YPLILWITVLPPLSELIPLAAA 458 Query: 426 ERP 418 ERP Sbjct: 459 ERP 461 >SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 70.9 bits (166), Expect = 1e-12 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -1 Query: 586 GGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYP 488 GGGAYGKTPAT PFYGS PFAGLLLTC FLRYP Sbjct: 555 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP 587 Score = 55.2 bits (127), Expect = 8e-08 Identities = 31/45 (68%), Positives = 33/45 (73%) Frame = -2 Query: 552 GLFTVPGLLLAFCSHVXSCXIPLILWITVLPPLSELIPLAAAERP 418 G + GLLL CS + PLILWITVLPPLSELIPLAAAERP Sbjct: 570 GSWPFAGLLLT-CSFLR---YPLILWITVLPPLSELIPLAAAERP 610 >SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 70.9 bits (166), Expect = 1e-12 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -1 Query: 586 GGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYP 488 GGGAYGKTPAT PFYGS PFAGLLLTC FLRYP Sbjct: 23 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP 55 Score = 55.2 bits (127), Expect = 8e-08 Identities = 31/45 (68%), Positives = 33/45 (73%) Frame = -2 Query: 552 GLFTVPGLLLAFCSHVXSCXIPLILWITVLPPLSELIPLAAAERP 418 G + GLLL CS + PLILWITVLPPLSELIPLAAAERP Sbjct: 38 GSWPFAGLLLT-CSFLR---YPLILWITVLPPLSELIPLAAAERP 78 >SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 70.9 bits (166), Expect = 1e-12 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -1 Query: 586 GGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYP 488 GGGAYGKTPAT PFYGS PFAGLLLTC FLRYP Sbjct: 1 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP 33 Score = 55.2 bits (127), Expect = 8e-08 Identities = 31/45 (68%), Positives = 33/45 (73%) Frame = -2 Query: 552 GLFTVPGLLLAFCSHVXSCXIPLILWITVLPPLSELIPLAAAERP 418 G + GLLL CS + PLILWITVLPPLSELIPLAAAERP Sbjct: 16 GSWPFAGLLLT-CSFLR---YPLILWITVLPPLSELIPLAAAERP 56 >SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 68.9 bits (161), Expect = 6e-12 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -3 Query: 584 GRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP 486 GRSLWKNASN AFLRF AFCWPFAHM +PA SP Sbjct: 2 GRSLWKNASNAAFLRFLAFCWPFAHMFYPALSP 34 >SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) Length = 77 Score = 67.7 bits (158), Expect = 1e-11 Identities = 38/76 (50%), Positives = 46/76 (60%), Gaps = 3/76 (3%) Frame = -3 Query: 584 GRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP---*FCG*PYYRL*VS*YRSPQPNDRA 414 GRSLWKNASN AFLRF AFCWPF HM PA SP C + R ++ RS + ++R Sbjct: 2 GRSLWKNASNAAFLRFLAFCWPFDHMFSPALSPDSVDICITAFERDDIA--RSSRMHERR 59 Query: 413 QRVSERGSGRAPNTQT 366 + VSE R+ QT Sbjct: 60 ESVSEEAEERSIRKQT 75 >SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 64.1 bits (149), Expect = 2e-10 Identities = 28/34 (82%), Positives = 28/34 (82%) Frame = -3 Query: 587 GGRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP 486 GGRSLWKNASN AFLRF AF WPFAHM F A SP Sbjct: 17 GGRSLWKNASNAAFLRFLAFGWPFAHMFFRALSP 50 Score = 30.7 bits (66), Expect = 1.9 Identities = 18/49 (36%), Positives = 20/49 (40%) Frame = -1 Query: 601 GXXVXGGGAYGKTPATXPFYGSXPFAGLLLTCXFLRYPPDSVDNRITAF 455 G V GG + K + F F F PD VDNRITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFGWPFAHMFFRALSPDCVDNRITAF 60 >SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 58.4 bits (135), Expect = 8e-09 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = -3 Query: 584 GRSLWKNASNXAFLRFXAFCWPFAHMXFPAXSP 486 G KNASN AFLRF AFCWPFAHM FPA SP Sbjct: 18 GAEPMKNASNAAFLRFLAFCWPFAHMFFPALSP 50 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 55.6 bits (128), Expect = 6e-08 Identities = 26/69 (37%), Positives = 30/69 (43%) Frame = +2 Query: 737 LNRNTCXPXXPPSXNPXPLXPXPPPPXAXPXFAXXRPSXPTXXXXPXPPPXXPHXPPYPG 916 +N + P PP P P P PPPP + P +P P P PPP P PP P Sbjct: 361 INMSPPPPPPPPPPPPSPPPPPPPPPPSPP--PPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Query: 917 TXXPXXPPP 943 P PPP Sbjct: 419 APPPPPPPP 427 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/62 (40%), Positives = 26/62 (41%) Frame = +2 Query: 758 PXXPPSXNPXPLXPXPPPPXAXPXFAXXRPSXPTXXXXPXPPPXXPHXPPYPGTXXPXXP 937 P PP +P P P PPPP P P P P PPP P PP P P P Sbjct: 370 PPPPPPPSPPP-PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Query: 938 PP 943 PP Sbjct: 429 PP 430 Score = 53.2 bits (122), Expect = 3e-07 Identities = 27/70 (38%), Positives = 27/70 (38%) Frame = +2 Query: 758 PXXPPSXNPXPLXPXPPPPXAXPXFAXXRPSXPTXXXXPXPPPXXPHXPPYPGTXXPXXP 937 P PP P P P PPPP P P P P PPP P PP P P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPS----PPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 Query: 938 PPXTXHLXPP 967 PP PP Sbjct: 421 PPPPPPPPPP 430 Score = 52.8 bits (121), Expect = 4e-07 Identities = 26/67 (38%), Positives = 27/67 (40%) Frame = +2 Query: 767 PPSXNPXPLXPXPPPPXAXPXFAXXRPSXPTXXXXPXPPPXXPHXPPYPGTXXPXXPPPX 946 PP P P P PPPP P + P P P PPP P PP P P PPP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP-PPPPPPAPPPPP 424 Query: 947 TXHLXPP 967 PP Sbjct: 425 PPPPPPP 431 Score = 52.4 bits (120), Expect = 5e-07 Identities = 24/63 (38%), Positives = 26/63 (41%) Frame = +2 Query: 779 NPXPLXPXPPPPXAXPXFAXXRPSXPTXXXXPXPPPXXPHXPPYPGTXXPXXPPPXTXHL 958 +P P P PPPP + P P P P PPP P PP P P PPP Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Query: 959 XPP 967 PP Sbjct: 424 PPP 426 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/70 (35%), Positives = 25/70 (35%) Frame = +2 Query: 758 PXXPPSXNPXPLXPXPPPPXAXPXFAXXRPSXPTXXXXPXPPPXXPHXPPYPGTXXPXXP 937 P PPS P P P P PP P P P PPP P PP P P P Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Query: 938 PPXTXHLXPP 967 P PP Sbjct: 432 PALRLACAPP 441 Score = 49.2 bits (112), Expect = 5e-06 Identities = 26/71 (36%), Positives = 27/71 (38%) Frame = +2 Query: 728 PXPLNRNTCXPXXPPSXNPXPLXPXPPPPXAXPXFAXXRPSXPTXXXXPXPPPXXPHXPP 907 P P + P PPS P P P PPPP P P P P PPP P PP Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP--PP 430 Query: 908 YPGTXXPXXPP 940 P PP Sbjct: 431 PPALRLACAPP 441 Score = 47.6 bits (108), Expect = 2e-05 Identities = 26/79 (32%), Positives = 28/79 (35%) Frame = +2 Query: 728 PXPLNRNTCXPXXPPSXNPXPLXPXPPPPXAXPXFAXXRPSXPTXXXXPXPPPXXPHXPP 907 P P + P PP +P P P PPPP P P P P PPP P PP Sbjct: 371 PPPPPPSPPPPPPPPPPSPPP-PPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Query: 908 YPGTXXPXXPPPXTXHLXP 964 P PP P Sbjct: 430 PPPALRLACAPPRLRFTSP 448 Score = 45.6 bits (103), Expect = 6e-05 Identities = 21/59 (35%), Positives = 23/59 (38%) Frame = +2 Query: 791 LXPXPPPPXAXPXFAXXRPSXPTXXXXPXPPPXXPHXPPYPGTXXPXXPPPXTXHLXPP 967 + P PPPP P + P P P PP P PP P P PPP PP Sbjct: 363 MSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 45.2 bits (102), Expect = 8e-05 Identities = 23/65 (35%), Positives = 24/65 (36%) Frame = +1 Query: 613 PPXXXXXXPXPPPGXINHXXGPXPPWXPXPXGAPPXXPPXPX*PEHLXPXXSPFXKPVXP 792 PP P PPP P PP P P PP PP P P P +P P P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Query: 793 XPHXP 807 P P Sbjct: 428 PPPPP 432 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/59 (37%), Positives = 22/59 (37%) Frame = +1 Query: 637 PXPPPGXINHXXGPXPPWXPXPXGAPPXXPPXPX*PEHLXPXXSPFXKPVXPXPHXPXP 813 P PPP P PP P P PP PP P P P P P P P P P Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/69 (31%), Positives = 23/69 (33%) Frame = +1 Query: 577 LRPPXRXSXKXXPPXXXXXXPXPPPGXINHXXGPXPPWXPXPXGAPPXXPPXPX*PEHLX 756 + PP PP P PPP P PP P P PP PP P P Sbjct: 363 MSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Query: 757 PXXSPFXKP 783 P P P Sbjct: 423 PPPPPPPPP 431 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/59 (35%), Positives = 21/59 (35%) Frame = +1 Query: 637 PXPPPGXINHXXGPXPPWXPXPXGAPPXXPPXPX*PEHLXPXXSPFXKPVXPXPHXPXP 813 P PPP P PP P P PP P P P P P P P P P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/66 (33%), Positives = 22/66 (33%) Frame = +1 Query: 616 PXXXXXXPXPPPGXINHXXGPXPPWXPXPXGAPPXXPPXPX*PEHLXPXXSPFXKPVXPX 795 P P PPP P P P P PP PP P P P P P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Query: 796 PHXPXP 813 P P P Sbjct: 425 PPPPPP 430 Score = 40.3 bits (90), Expect = 0.002 Identities = 30/96 (31%), Positives = 31/96 (32%) Frame = +1 Query: 658 INHXXGPXPPWXPXPXGAPPXXPPXPX*PEHLXPXXSPFXKPVXPXPHXPXPVRXSXXRV 837 IN P PP P P PP PP P P P P P P P P P Sbjct: 361 INMSPPPPPPPPPPPPSPPPPPPPPP--PSPPPPPQPPPPPPPPPPPPPPPP-------- 410 Query: 838 LXXLXPNXXXXXXPPPXXXPXPPLSRYXXPXXSPPR 945 P PPP P PP +PPR Sbjct: 411 ----PPPPPPPPAPPPPPPPPPPPPPALRLACAPPR 442 Score = 37.9 bits (84), Expect = 0.012 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +1 Query: 583 PPXRXSXKXXPPXXXXXXPXPPPGXINHXXGPXPPWXPXPXGAPPXXPPXPX*P 744 PP PP P PPP P PP P P PP PP P P Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 37.1 bits (82), Expect = 0.021 Identities = 21/63 (33%), Positives = 22/63 (34%) Frame = +1 Query: 583 PPXRXSXKXXPPXXXXXXPXPPPGXINHXXGPXPPWXPXPXGAPPXXPPXPX*PEHLXPX 762 PP PP P PPP P PP P P PP PP P P L Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPP---PPPPPPPPPPPPPAPPPPPPPPPPPPPALRLA 437 Query: 763 XSP 771 +P Sbjct: 438 CAP 440 Score = 36.7 bits (81), Expect = 0.028 Identities = 21/63 (33%), Positives = 21/63 (33%) Frame = +1 Query: 583 PPXRXSXKXXPPXXXXXXPXPPPGXINHXXGPXPPWXPXPXGAPPXXPPXPX*PEHLXPX 762 PP PP P PPP P PP P P PP PP P P P Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPP-PPPPPPPPPPPPPAPPPPPPPPPP 429 Query: 763 XSP 771 P Sbjct: 430 PPP 432 Score = 35.1 bits (77), Expect = 0.086 Identities = 21/68 (30%), Positives = 21/68 (30%) Frame = +1 Query: 583 PPXRXSXKXXPPXXXXXXPXPPPGXINHXXGPXPPWXPXPXGAPPXXPPXPX*PEHLXPX 762 PP PP P PPP P PP P PP PP P P Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Query: 763 XSPFXKPV 786 F PV Sbjct: 442 RLRFTSPV 449 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 53.2 bits (122), Expect = 3e-07 Identities = 25/62 (40%), Positives = 25/62 (40%) Frame = +2 Query: 758 PXXPPSXNPXPLXPXPPPPXAXPXFAXXRPSXPTXXXXPXPPPXXPHXPPYPGTXXPXXP 937 P PP P P P PPPP P P P P PPP P PP P P P Sbjct: 165 PNPPPPNAPYPPPPYPPPPNP-PYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYP 223 Query: 938 PP 943 PP Sbjct: 224 PP 225 Score = 52.4 bits (120), Expect = 5e-07 Identities = 34/111 (30%), Positives = 41/111 (36%), Gaps = 3/111 (2%) Frame = +1 Query: 643 PPPGXINHXXGPXPPWXPXPXGAPPXXPPXPX*PEHLXPXXSPFXKPVXPXPHXPXPVRX 822 PP + P PP+ P P PP PP P P + P +P+ P P P+ P P Sbjct: 84 PPTNFSPNPPYPPPPYPPYP--PPPPYPPPPN-PPYPPPPNAPYPPPPNP-PYPPPPNAP 139 Query: 823 SXXRVLXXLXPNXXXXXXP---PPXXXPXPPLSRYXXPXXSPPRXXPLXPP 966 P P PP P PP + Y P PP P PP Sbjct: 140 YPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPP 190 Score = 52.4 bits (120), Expect = 5e-07 Identities = 37/128 (28%), Positives = 41/128 (32%) Frame = +1 Query: 583 PPXRXSXKXXPPXXXXXXPXPPPGXINHXXGPXPPWXPXPXGAPPXXPPXPX*PEHLXPX 762 PP P P PPP + P PP+ P P P P P P P Sbjct: 97 PPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPP----PP 152 Query: 763 XSPFXKPVXPXPHXPXPVRXSXXRVLXXLXPNXXXXXXPPPXXXPXPPLSRYXXPXXSPP 942 P+ P+ P P P P PN PPP P PP P PP Sbjct: 153 NPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPN---PPYPPPPNPPYPPPPNAPNP---PP 206 Query: 943 RXXPLXPP 966 P PP Sbjct: 207 PNPPYPPP 214 Score = 52.4 bits (120), Expect = 5e-07 Identities = 29/80 (36%), Positives = 31/80 (38%) Frame = +2 Query: 728 PXPLNRNTCXPXXPPSXNPXPLXPXPPPPXAXPXFAXXRPSXPTXXXXPXPPPXXPHXPP 907 P P + N P P P PL P PP P P P P P PPP P PP Sbjct: 139 PYPPSPNAPYPPPPNPPYPPPLYPPPPNPPP-PNAPYPPPPYPPPPNPPYPPPPNPPYPP 197 Query: 908 YPGTXXPXXPPPXTXHLXPP 967 P P PPP + PP Sbjct: 198 PPNA--PNPPPPNPPYPPPP 215 Score = 50.8 bits (116), Expect = 2e-06 Identities = 29/82 (35%), Positives = 30/82 (36%), Gaps = 1/82 (1%) Frame = +2 Query: 725 HPXPLNRNTCXPXXPPSXNPXPLXPXPPPPXAXPXFAXXRPSXPTXXXXPXPPPXXPHXP 904 HP P N + P PP P P P PPP P P P PPP P Sbjct: 83 HP-PTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYP 141 Query: 905 PYPGTXXPXXP-PPXTXHLXPP 967 P P P P PP L PP Sbjct: 142 PSPNAPYPPPPNPPYPPPLYPP 163 Score = 48.4 bits (110), Expect = 9e-06 Identities = 37/131 (28%), Positives = 42/131 (32%), Gaps = 2/131 (1%) Frame = +1 Query: 583 PPXRXSXKXX-PPXXXXXXPXPPP-GXINHXXGPXPPWXPXPXGAPPXXPPXPX*PEHLX 756 PP S PP P PPP + P PP P P PP PP P P Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYP---PPPNPPYPPPPNAPY 140 Query: 757 PXXSPFXKPVXPXPHXPXPVRXSXXRVLXXLXPNXXXXXXPPPXXXPXPPLSRYXXPXXS 936 P P P P P P+ P PPP PP + P + Sbjct: 141 PPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPN 200 Query: 937 PPRXXPLXPPW 969 P P PP+ Sbjct: 201 APNPPPPNPPY 211 Score = 48.4 bits (110), Expect = 9e-06 Identities = 30/85 (35%), Positives = 32/85 (37%), Gaps = 4/85 (4%) Frame = +2 Query: 725 HPXPLNRNTCXPXXPPSXNPXPLXPXPPPPXAXPXFAXXRPSXPTXXXXPXPPPXXPH-- 898 +P P N P PP P P P PP P A P P P P P P P+ Sbjct: 116 YPPPPNAPYPPPPNPPYP-PPPNAPYPPSPNA-PYPPPPNPPYPPPLYPPPPNPPPPNAP 173 Query: 899 --XPPYPGTXXPXXPPPXTXHLXPP 967 PPYP P PPP PP Sbjct: 174 YPPPPYPPPPNPPYPPPPNPPYPPP 198 Score = 48.0 bits (109), Expect = 1e-05 Identities = 33/109 (30%), Positives = 38/109 (34%) Frame = +1 Query: 637 PXPPPGXINHXXGPXPPWXPXPXGAPPXXPPXPX*PEHLXPXXSPFXKPVXPXPHXPXPV 816 P PP + P PP+ P P PP PP P P P P P P P+ P P Sbjct: 139 PYPPSPNAPYPPPPNPPYPP-PLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPP 197 Query: 817 RXSXXRVLXXLXPNXXXXXXPPPXXXPXPPLSRYXXPXXSPPRXXPLXP 963 + P PPP P PP Y P +P P P Sbjct: 198 PPNAPN------PPPPNPPYPPPPNAPNPP---YPPPPNAPNPPYPPPP 237 Score = 46.8 bits (106), Expect = 3e-05 Identities = 26/80 (32%), Positives = 27/80 (33%) Frame = +2 Query: 728 PXPLNRNTCXPXXPPSXNPXPLXPXPPPPXAXPXFAXXRPSXPTXXXXPXPPPXXPHXPP 907 P P N P P + P P P PPP P P P PPP P P Sbjct: 107 PYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPN 166 Query: 908 YPGTXXPXXPPPXTXHLXPP 967 P P PPP PP Sbjct: 167 PPPPNAPYPPPPYPPPPNPP 186 Score = 46.0 bits (104), Expect = 5e-05 Identities = 25/73 (34%), Positives = 26/73 (35%) Frame = +2 Query: 725 HPXPLNRNTCXPXXPPSXNPXPLXPXPPPPXAXPXFAXXRPSXPTXXXXPXPPPXXPHXP 904 +P P N P PP NP P PP P P P P P P P P Sbjct: 166 NPPPPNAPYPPPPYPPPPNPP--YPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYP 223 Query: 905 PYPGTXXPXXPPP 943 P P P PPP Sbjct: 224 PPPNAPNPPYPPP 236 Score = 44.0 bits (99), Expect = 2e-04 Identities = 24/67 (35%), Positives = 26/67 (38%) Frame = +1 Query: 613 PPXXXXXXPXPPPGXINHXXGPXPPWXPXPXGAPPXXPPXPX*PEHLXPXXSPFXKPVXP 792 PP P PPP + P PP P P PP PP P P P P P P Sbjct: 157 PPPLYPPPPNPPPPNAPYPPPPYPP-PPNPPYPPPPNPPYPPPPN--APNPPPPNPPYPP 213 Query: 793 XPHXPXP 813 P+ P P Sbjct: 214 PPNAPNP 220 Score = 42.7 bits (96), Expect = 4e-04 Identities = 22/72 (30%), Positives = 24/72 (33%) Frame = +2 Query: 752 CXPXXPPSXNPXPLXPXPPPPXAXPXFAXXRPSXPTXXXXPXPPPXXPHXPPYPGTXXPX 931 C P + +P P P PP P P P P P P P PPYP Sbjct: 80 CGGHPPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAP 139 Query: 932 XPPPXTXHLXPP 967 PP PP Sbjct: 140 YPPSPNAPYPPP 151 Score = 35.9 bits (79), Expect = 0.049 Identities = 22/67 (32%), Positives = 23/67 (34%) Frame = +1 Query: 613 PPXXXXXXPXPPPGXINHXXGPXPPWXPXPXGAPPXXPPXPX*PEHLXPXXSPFXKPVXP 792 PP P PP + P PP P P P PP P P P P P P Sbjct: 175 PPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPN--PPYPPPPNAPNPP 232 Query: 793 XPHXPXP 813 P P P Sbjct: 233 YPPPPNP 239 Score = 35.9 bits (79), Expect = 0.049 Identities = 18/59 (30%), Positives = 20/59 (33%) Frame = +1 Query: 583 PPXRXSXKXXPPXXXXXXPXPPPGXINHXXGPXPPWXPXPXGAPPXXPPXPX*PEHLXP 759 PP P P PPP + P PP+ P P P PP P P P Sbjct: 176 PPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYP 234 Score = 35.5 bits (78), Expect = 0.065 Identities = 25/81 (30%), Positives = 30/81 (37%), Gaps = 4/81 (4%) Frame = +1 Query: 583 PPXRXSXKXXPPXXXXXXPXPPPGXINHXXGPXPPWXP---XPXGAPPXXP-PXPX*PEH 750 PP PP P PP + P PP+ P P PP P P P P + Sbjct: 157 PPPLYPPPPNPPPPNAPYPPPP-----YPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPY 211 Query: 751 LXPXXSPFXKPVXPXPHXPXP 813 P +P P P P+ P P Sbjct: 212 PPPPNAP-NPPYPPPPNAPNP 231 Score = 34.3 bits (75), Expect = 0.15 Identities = 25/70 (35%), Positives = 27/70 (38%), Gaps = 2/70 (2%) Frame = +2 Query: 725 HPXPLNRNTCXPXXPPSXNPXPLXPXPPP--PXAXPXFAXXRPSXPTXXXXPXPPPXXPH 898 +P P N P PP P P P PPP P P P+ P P PPP Sbjct: 179 YPPPPNPPYPPPPNPPYP-PPPNAPNPPPPNPPYPPP-----PNAPN---PPYPPPPNAP 229 Query: 899 XPPYPGTXXP 928 PPYP P Sbjct: 230 NPPYPPPPNP 239 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/67 (40%), Positives = 28/67 (41%), Gaps = 3/67 (4%) Frame = +2 Query: 758 PXXPPSXNPXPLXPXPP---PPXAXPXFAXXRPSXPTXXXXPXPPPXXPHXPPYPGTXXP 928 P PP+ NP P P P PP P P PT P PPP PP P T P Sbjct: 346 PPPPPTNNP-PSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGP 404 Query: 929 XXPPPXT 949 PPP T Sbjct: 405 PPPPPPT 411 Score = 44.8 bits (101), Expect = 1e-04 Identities = 24/68 (35%), Positives = 25/68 (36%), Gaps = 1/68 (1%) Frame = +2 Query: 728 PXPLNRNTCXPXXPPSXNPXPLXPX-PPPPXAXPXFAXXRPSXPTXXXXPXPPPXXPHXP 904 P P N P P + P P P PPP P P PT P PPP P Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPP 406 Query: 905 PYPGTXXP 928 P P T P Sbjct: 407 PPPPTNGP 414 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/62 (38%), Positives = 24/62 (38%) Frame = +2 Query: 782 PXPLXPXPPPPXAXPXFAXXRPSXPTXXXXPXPPPXXPHXPPYPGTXXPXXPPPXTXHLX 961 P P P PP P P PT P PPP PP P T P PPP T Sbjct: 348 PPPTNNPPSPP--PPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 405 Query: 962 PP 967 PP Sbjct: 406 PP 407 Score = 38.7 bits (86), Expect = 0.007 Identities = 20/49 (40%), Positives = 21/49 (42%) Frame = +1 Query: 583 PPXRXSXKXXPPXXXXXXPXPPPGXINHXXGPXPPWXPXPXGAPPXXPP 729 PP + K PP P PPP N GP PP P P PP PP Sbjct: 366 PPPPPTNKPPPPPPPTNGPPPPPPPTN---GPPPP--PPPTNGPPPPPP 409 Score = 37.1 bits (82), Expect = 0.021 Identities = 22/67 (32%), Positives = 23/67 (34%) Frame = +1 Query: 613 PPXXXXXXPXPPPGXINHXXGPXPPWXPXPXGAPPXXPPXPX*PEHLXPXXSPFXKPVXP 792 PP P PPP N P P P P P PP P P + P P P Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPP---PTNG 403 Query: 793 XPHXPXP 813 P P P Sbjct: 404 PPPPPPP 410 Score = 35.5 bits (78), Expect = 0.065 Identities = 19/63 (30%), Positives = 21/63 (33%) Frame = +1 Query: 583 PPXRXSXKXXPPXXXXXXPXPPPGXINHXXGPXPPWXPXPXGAPPXXPPXPX*PEHLXPX 762 PP + PP P PPP P P P P P PP P P + P Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPP 406 Query: 763 XSP 771 P Sbjct: 407 PPP 409 Score = 34.3 bits (75), Expect = 0.15 Identities = 19/59 (32%), Positives = 21/59 (35%), Gaps = 1/59 (1%) Frame = +1 Query: 586 PXRXSXKXXPPXXXXXXPXPPPGXINHXXGPXPPWX-PXPXGAPPXXPPXPX*PEHLXP 759 P + PP P PPP N P PP P P P PP P P + P Sbjct: 357 PPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +1 Query: 583 PPXRXSXKXXPPXXXXXXPXPPPGXINHXXGPXPPWXPXPXGAPP 717 PP + PP P PPP N GP PP P P PP Sbjct: 376 PPPPPTNGPPPPPPPTNGPPPPPPPTN---GPPPP--PPPTNGPP 415 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 49.2 bits (112), Expect = 5e-06 Identities = 28/80 (35%), Positives = 30/80 (37%) Frame = +2 Query: 728 PXPLNRNTCXPXXPPSXNPXPLXPXPPPPXAXPXFAXXRPSXPTXXXXPXPPPXXPHXPP 907 P P+ T P PP P P PPPP P P+ P P PP P PP Sbjct: 141 PPPIAPATGGPPPPPPIAPATGGPPPPPPI-APAATVPAPAVPLAAASPPPPSGGP--PP 197 Query: 908 YPGTXXPXXPPPXTXHLXPP 967 P P PPP PP Sbjct: 198 PPPPPPPPPPPPILELAAPP 217 Score = 38.7 bits (86), Expect = 0.007 Identities = 23/75 (30%), Positives = 26/75 (34%), Gaps = 3/75 (4%) Frame = +2 Query: 728 PXPLNRNTCXPXXPP---SXNPXPLXPXPPPPXAXPXFAXXRPSXPTXXXXPXPPPXXPH 898 P P+ + P PP + P PPPP P P P PPP P Sbjct: 98 PTPMVAQSVAPTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPI 157 Query: 899 XPPYPGTXXPXXPPP 943 P T P PPP Sbjct: 158 AP---ATGGPPPPPP 169 Score = 37.1 bits (82), Expect = 0.021 Identities = 27/88 (30%), Positives = 27/88 (30%), Gaps = 8/88 (9%) Frame = +2 Query: 728 PXPLNRNTCXPXXPPSXNPXPLXPX----PPPPXAXPXFAXXRPSXPTXXXXPXPPPXXP 895 P P R P PS P P P PPPP P P P PPP P Sbjct: 110 PPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPP 169 Query: 896 HXP----PYPGTXXPXXPPPXTXHLXPP 967 P P P PP PP Sbjct: 170 IAPAATVPAPAVPLAAASPPPPSGGPPP 197 Score = 36.7 bits (81), Expect = 0.028 Identities = 29/110 (26%), Positives = 31/110 (28%) Frame = +1 Query: 637 PXPPPGXINHXXGPXPPWXPXPXGAPPXXPPXPX*PEHLXPXXSPFXKPVXPXPHXPXPV 816 P PP P PP P PP P P P P P P P P+ Sbjct: 111 PPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPI 170 Query: 817 RXSXXRVLXXLXPNXXXXXXPPPXXXPXPPLSRYXXPXXSPPRXXPLXPP 966 + V P PPP P PP P P PP Sbjct: 171 APA-ATVPAPAVP-LAAASPPPPSGGPPPPPPPPPPPPPPPILELAAPPP 218 Score = 36.3 bits (80), Expect = 0.037 Identities = 27/97 (27%), Positives = 29/97 (29%) Frame = +1 Query: 616 PXXXXXXPXPPPGXINHXXGPXPPWXPXPXGAPPXXPPXPX*PEHLXPXXSPFXKPVXPX 795 P P PP P PP P G P PP P P P P P+ P Sbjct: 120 PSQAPSPPPPPTSPATRAPPPPPPIAPATGGPP---PPPPIAPATGGPPPPP---PIAPA 173 Query: 796 PHXPXPVRXSXXRVLXXLXPNXXXXXXPPPXXXPXPP 906 P P P+ PPP P PP Sbjct: 174 ATVPAPA--VPLAAASPPPPSGGPPPPPPPPPPPPPP 208 Score = 32.7 bits (71), Expect = 0.46 Identities = 17/58 (29%), Positives = 18/58 (31%) Frame = +2 Query: 770 PSXNPXPLXPXPPPPXAXPXFAXXRPSXPTXXXXPXPPPXXPHXPPYPGTXXPXXPPP 943 P P + P P A P P P P P P P T P PPP Sbjct: 86 PPLVPAGVEAPTPTPMVAQSVAPTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPP 143 Score = 32.7 bits (71), Expect = 0.46 Identities = 21/68 (30%), Positives = 23/68 (33%), Gaps = 4/68 (5%) Frame = +2 Query: 728 PXPLNRNTCXPXXPPSXNPXPLXPXPPPPXAX----PXFAXXRPSXPTXXXXPXPPPXXP 895 P P+ T P PP P P P P A P P P P PP Sbjct: 154 PPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILEL 213 Query: 896 HXPPYPGT 919 PP PG+ Sbjct: 214 AAPPPPGS 221 Score = 31.5 bits (68), Expect = 1.1 Identities = 25/86 (29%), Positives = 26/86 (30%), Gaps = 10/86 (11%) Frame = +1 Query: 586 PXRXSXKXXPPXXXXXXPXPPPGXINHXXG---PXPPWXPXPXGAPPXXP-------PXP 735 P + PP PPP I G P PP P G PP P P P Sbjct: 120 PSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAP 179 Query: 736 X*PEHLXPXXSPFXKPVXPXPHXPXP 813 P P P P P P P Sbjct: 180 AVPLAAASPPPPSGGPPPPPPPPPPP 205 Score = 31.1 bits (67), Expect = 1.4 Identities = 24/79 (30%), Positives = 25/79 (31%), Gaps = 2/79 (2%) Frame = +1 Query: 583 PPXRXSXKXXPPXXXXXXPXPPPGXINHXXGPXPPWXPXP-XGAPPXXPPXPX*PEHLXP 759 P S P P PPP GP PP P G PP PP P P P Sbjct: 120 PSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPP--PPPPIAPAATVP 177 Query: 760 XXS-PFXKPVXPXPHXPXP 813 + P P P P Sbjct: 178 APAVPLAAASPPPPSGGPP 196 Score = 28.7 bits (61), Expect = 7.5 Identities = 20/76 (26%), Positives = 21/76 (27%) Frame = +1 Query: 586 PXRXSXKXXPPXXXXXXPXPPPGXINHXXGPXPPWXPXPXGAPPXXPPXPX*PEHLXPXX 765 P + PP PPP I G PP P A P P P Sbjct: 133 PATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPS 192 Query: 766 SPFXKPVXPXPHXPXP 813 P P P P P Sbjct: 193 GGPPPPPPPPPPPPPP 208 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 48.4 bits (110), Expect = 9e-06 Identities = 27/69 (39%), Positives = 28/69 (40%) Frame = +2 Query: 758 PXXPPSXNPXPLXPXPPPPXAXPXFAXXRPSXPTXXXXPXPPPXXPHXPPYPGTXXPXXP 937 P PP P PPPP A P A P+ P P PPP P PP P P P Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPA-APPPPAAP--PAAPPPPPPLPAPPPPPAQPAP-QP 105 Query: 938 PPXTXHLXP 964 PP H P Sbjct: 106 PPAPPHFLP 114 Score = 39.1 bits (87), Expect = 0.005 Identities = 22/64 (34%), Positives = 24/64 (37%), Gaps = 3/64 (4%) Frame = +2 Query: 728 PXPLNRNTCXPXXPPSXNPXPLXPXPP--PPXAXPXFAXX-RPSXPTXXXXPXPPPXXPH 898 P P + P PP P P PP PP A P P P P PPP PH Sbjct: 52 PPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPPH 111 Query: 899 XPPY 910 P+ Sbjct: 112 FLPF 115 Score = 31.9 bits (69), Expect = 0.80 Identities = 20/59 (33%), Positives = 20/59 (33%) Frame = +1 Query: 637 PXPPPGXINHXXGPXPPWXPXPXGAPPXXPPXPX*PEHLXPXXSPFXKPVXPXPHXPXP 813 P PPP P P P A P PP P P P P P P P P P Sbjct: 51 PPPPPSP-----PAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAP-PPPPAQPAP 103 Score = 31.5 bits (68), Expect = 1.1 Identities = 19/55 (34%), Positives = 21/55 (38%) Frame = +2 Query: 803 PPPPXAXPXFAXXRPSXPTXXXXPXPPPXXPHXPPYPGTXXPXXPPPXTXHLXPP 967 PPPP + P A P+ P PP P PP P PPP PP Sbjct: 51 PPPPPSPPAAA---PAAPP------PPAAAPAAPPPPAAPPAAPPPPPPLPAPPP 96 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 4/59 (6%) Frame = +1 Query: 637 PXPPPGXINHXXGPXP---PWXPXPXGAPPXXPP-XPX*PEHLXPXXSPFXKPVXPXPH 801 P P P P P P P P APP PP P P P P +P PH Sbjct: 53 PPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPPH 111 Score = 30.3 bits (65), Expect = 2.5 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 824 PXFAXXRPSXPTXXXXPXPPPXXPHXPPYPGTXXPXXPPPXTXHLXPP 967 P F P P P PP P PP P PPP PP Sbjct: 43 PHFISSSPPPPP----PSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPP 86 Score = 29.9 bits (64), Expect = 3.2 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = +1 Query: 583 PPXRXSXKXXPPXXXXXXPXPPPGXINHXXGPXPPWXPXPXGAPPXXPPXPX*PEHLXP 759 PP PP P PP P P P P A P P P P H P Sbjct: 57 PPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPA-PPHFLP 114 Score = 29.5 bits (63), Expect = 4.3 Identities = 19/64 (29%), Positives = 20/64 (31%) Frame = +1 Query: 583 PPXRXSXKXXPPXXXXXXPXPPPGXINHXXGPXPPWXPXPXGAPPXXPPXPX*PEHLXPX 762 PP + P P PP P PP P P PP P P P P Sbjct: 54 PPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPP-PPLPAPPPPPAQPAPQ-PPPAPPH 111 Query: 763 XSPF 774 PF Sbjct: 112 FLPF 115 Score = 28.7 bits (61), Expect = 7.5 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +1 Query: 676 PXPPWXPXPXGAPPXXPPXPX*PEHLXPXXSPFXKPVXPXPHXPXP 813 P PP P AP PP P P +P P P P P P Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAP---PAAPPPPPPLP 92 Score = 28.7 bits (61), Expect = 7.5 Identities = 17/57 (29%), Positives = 18/57 (31%) Frame = +1 Query: 637 PXPPPGXINHXXGPXPPWXPXPXGAPPXXPPXPX*PEHLXPXXSPFXKPVXPXPHXP 807 P PP P PP PP PP P P +P P P P P Sbjct: 52 PPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAA--PPPPPPLPAPPPPPAQPAPQPP 106 Score = 28.7 bits (61), Expect = 7.5 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 1/58 (1%) Frame = +1 Query: 613 PPXXXXXXPXPPPGXINHXXGPX-PPWXPXPXGAPPXXPPXPX*PEHLXPXXSPFXKP 783 PP P PP P PP P P P PP P P P P P Sbjct: 57 PPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPPHFLP 114 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 48.4 bits (110), Expect = 9e-06 Identities = 32/88 (36%), Positives = 33/88 (37%), Gaps = 6/88 (6%) Frame = +2 Query: 725 HPXPLNRNTCXPXXPPSXNPXPLXPXP--PPPXAXPXFAXXRPSXPTXXXXPX-PPPXXP 895 HP P PP P P P P P P P A P P PPP P Sbjct: 508 HPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAP 567 Query: 896 HXP-PYPGTXXPXXPPPXTXH--LXPPG 970 H P PG P PPP T H + PPG Sbjct: 568 HPRVPPPGAPHPRVPPPGTPHPRVPPPG 595 Score = 48.4 bits (110), Expect = 9e-06 Identities = 32/88 (36%), Positives = 33/88 (37%), Gaps = 6/88 (6%) Frame = +2 Query: 725 HPXPLNRNTCXPXXPPSXNPXPLXPXP--PPPXAXPXFAXXRPSXPTXXXXPX-PPPXXP 895 HP P PP P P P P P P P A P P PPP P Sbjct: 518 HPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAP 577 Query: 896 HXP-PYPGTXXPXXPPPXTXH--LXPPG 970 H P PGT P PPP H + PPG Sbjct: 578 HPRVPPPGTPHPRVPPPGAPHPKVPPPG 605 Score = 46.0 bits (104), Expect = 5e-05 Identities = 29/77 (37%), Positives = 30/77 (38%), Gaps = 6/77 (7%) Frame = +2 Query: 758 PXXPPSXNPXPLXPXP--PPPXAXPXFAXXRPSXPTXXXXPX-PPPXXPHXP-PYPGTXX 925 P PP P P P P P P P A P P PPP PH P PG Sbjct: 449 PRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPH 508 Query: 926 PXXPPPXTXH--LXPPG 970 P PPP H + PPG Sbjct: 509 PRVPPPGAPHPRVPPPG 525 Score = 41.1 bits (92), Expect = 0.001 Identities = 28/88 (31%), Positives = 31/88 (35%), Gaps = 6/88 (6%) Frame = +2 Query: 725 HPXPLNRNTCXPXXPPSXNPXPLXPXP--PPPXAXPXFAXXRPSXPTXXXXPX-PPPXXP 895 HP P PP P P P P P P P P P PPP P Sbjct: 548 HPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPPGAP 607 Query: 896 HXP-PYPGTXXPXXPPPXTXH--LXPPG 970 + PY G P PPP + + PPG Sbjct: 608 YQRLPYSGAYHPRLPPPGPPYQRVPPPG 635 Score = 40.7 bits (91), Expect = 0.002 Identities = 29/86 (33%), Positives = 32/86 (37%), Gaps = 5/86 (5%) Frame = +2 Query: 728 PXPLNRNTCXPXXPPSXNPXPLXPXP--PPPXAXPXFAXXRPSXPTXXXXPXPPPXXPH- 898 P ++ P P P P P P PPP A R P PPP PH Sbjct: 414 PGASHQRVRPPGAPHPRVPPPGAPHPRFPPPGA----PHPRVPPPGAPHPRVPPPGAPHP 469 Query: 899 XPPYPGTXXPXXPPPXTXH--LXPPG 970 P PG P PPP H + PPG Sbjct: 470 RVPPPGAPHPRVPPPGAPHPRVPPPG 495 Score = 40.7 bits (91), Expect = 0.002 Identities = 29/76 (38%), Positives = 30/76 (39%), Gaps = 5/76 (6%) Frame = +2 Query: 758 PXXPPSXNPXPLXPXP--PPPXAXPXFAXXRPSXPTXXXXPXPPPXXPH-XPPYPGTXXP 928 P P P P P P PPP A P P P PPP PH P PG P Sbjct: 474 PGAPHPRVPPPGAPHPRVPPPGA-PHQRVPPPGAP---HPRVPPPGAPHPRVPPPGAPHP 529 Query: 929 XXPPPXTXH--LXPPG 970 PPP H + PPG Sbjct: 530 RVPPPGAPHPRVPPPG 545 Score = 40.7 bits (91), Expect = 0.002 Identities = 28/76 (36%), Positives = 29/76 (38%), Gaps = 5/76 (6%) Frame = +2 Query: 758 PXXPPSXNPXPLXPXP--PPPXAXPXFAXXRPSXPTXXXXPXPPPXXPH-XPPYPGTXXP 928 P P P P P P PPP A R P PPP PH P PG P Sbjct: 494 PGAPHQRVPPPGAPHPRVPPPGA----PHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHP 549 Query: 929 XXPPPXTXH--LXPPG 970 PPP H + PPG Sbjct: 550 RVPPPGASHPRVPPPG 565 Score = 40.3 bits (90), Expect = 0.002 Identities = 28/76 (36%), Positives = 29/76 (38%), Gaps = 5/76 (6%) Frame = +2 Query: 758 PXXPPSXNPXPLXPXP--PPPXAXPXFAXXRPSXPTXXXXPXPPPXXPH-XPPYPGTXXP 928 P P P P P P PPP A R P PPP PH P PG P Sbjct: 434 PGAPHPRFPPPGAPHPRVPPPGA----PHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHP 489 Query: 929 XXPPPXTXH--LXPPG 970 PPP H + PPG Sbjct: 490 RVPPPGAPHQRVPPPG 505 Score = 40.3 bits (90), Expect = 0.002 Identities = 28/76 (36%), Positives = 29/76 (38%), Gaps = 5/76 (6%) Frame = +2 Query: 758 PXXPPSXNPXPLXPXP--PPPXAXPXFAXXRPSXPTXXXXPXPPPXXPH-XPPYPGTXXP 928 P P P P P P PPP A R P PPP PH P PG P Sbjct: 464 PGAPHPRVPPPGAPHPRVPPPGA----PHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHP 519 Query: 929 XXPPPXTXH--LXPPG 970 PPP H + PPG Sbjct: 520 RVPPPGAPHPRVPPPG 535 Score = 40.3 bits (90), Expect = 0.002 Identities = 28/76 (36%), Positives = 29/76 (38%), Gaps = 5/76 (6%) Frame = +2 Query: 758 PXXPPSXNPXPLXPXP--PPPXAXPXFAXXRPSXPTXXXXPXPPPXXPH-XPPYPGTXXP 928 P P P P P P PPP A R P PPP PH P PG P Sbjct: 504 PGAPHPRVPPPGAPHPRVPPPGA----PHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHP 559 Query: 929 XXPPPXTXH--LXPPG 970 PPP H + PPG Sbjct: 560 RVPPPGAPHPRVPPPG 575 Score = 39.1 bits (87), Expect = 0.005 Identities = 26/68 (38%), Positives = 28/68 (41%), Gaps = 5/68 (7%) Frame = +2 Query: 782 PXPLXPXP--PPPXAXPXFAXXRPSXPTXXXXPXPPPXXPHXP-PYPGTXXPXXPPPXTX 952 P P P P PPP A + R P PPP PH P PG P PPP Sbjct: 402 PPPGAPHPRVPPPGA----SHQRVRPPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAP 457 Query: 953 H--LXPPG 970 H + PPG Sbjct: 458 HPRVPPPG 465 Score = 37.9 bits (84), Expect = 0.012 Identities = 39/137 (28%), Positives = 42/137 (30%), Gaps = 5/137 (3%) Frame = +1 Query: 571 HRLRPPXRXSXKXXPPXXXXXXPXPPPGXINHXXGPXPPWXPXPXGAPPXXP----PXPX 738 H PP PP PPPG H P PP P P PP P P P Sbjct: 468 HPRVPPPGAPHPRVPPPGAPHPRVPPPGA-PHQRVP-PPGAPHPRVPPPGAPHPRVPPPG 525 Query: 739 *PE-HLXPXXSPFXKPVXPXPHXPXPVRXSXXRVLXXLXPNXXXXXXPPPXXXPXPPLSR 915 P + P +P P P P P P + P PP P P R Sbjct: 526 APHPRVPPPGAPH--PRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHP---R 580 Query: 916 YXXPXXSPPRXXPLXPP 966 P PR P P Sbjct: 581 VPPPGTPHPRVPPPGAP 597 Score = 37.1 bits (82), Expect = 0.021 Identities = 25/85 (29%), Positives = 29/85 (34%), Gaps = 7/85 (8%) Frame = +2 Query: 737 LNRNTCXPXXPPSXNPXPLXPXP---PPPXAXPXFAXXRPSX--PTXXXXPXPPPXXPHX 901 ++ T PP P P P PPP P P P P P Sbjct: 291 MSYQTAPGYPPPQYMPHPRMRPPTRIPPPGMGPPPRIPPPPIRAPVDVYPPRAPQGASQT 350 Query: 902 PPYPGTXXPXXPPPXTXH--LXPPG 970 PPYPG+ PPP + PPG Sbjct: 351 PPYPGSHYSRVPPPDGPYTRALPPG 375 Score = 37.1 bits (82), Expect = 0.021 Identities = 36/137 (26%), Positives = 43/137 (31%), Gaps = 4/137 (2%) Frame = +1 Query: 568 FHRLRPPXRXSXKXXPPXXXXXXPXPPPGXINHXXGPXP----PWXPXPXGAPPXXPPXP 735 + R+ PP + PP PPPG H P P P P P P PP Sbjct: 358 YSRVPPPDGPYTRALPPGEPYAR-MPPPGA-THPRVPSPGASHPRVPPPGAPHPRVPPPG 415 Query: 736 X*PEHLXPXXSPFXKPVXPXPHXPXPVRXSXXRVLXXLXPNXXXXXXPPPXXXPXPPLSR 915 + + P +P P P P P P + P PP P P R Sbjct: 416 ASHQRVRPPGAPH--PRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHP---R 470 Query: 916 YXXPXXSPPRXXPLXPP 966 P PR P P Sbjct: 471 VPPPGAPHPRVPPPGAP 487 Score = 35.5 bits (78), Expect = 0.065 Identities = 38/131 (29%), Positives = 42/131 (32%) Frame = +1 Query: 574 RLRPPXRXSXKXXPPXXXXXXPXPPPGXINHXXGPXPPWXPXPXGAPPXXPPXPX*PEHL 753 R+ PP + PP PPPG H P PP P P PP P P P Sbjct: 410 RVPPPGASHQRVRPPGAPHPR-VPPPGA-PHPRFP-PPGAPHPR-VPPPGAPHPRVP--- 462 Query: 754 XPXXSPFXKPVXPXPHXPXPVRXSXXRVLXXLXPNXXXXXXPPPXXXPXPPLSRYXXPXX 933 P +P P P P P P + P PP P P R P Sbjct: 463 -PPGAPH--PRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHP---RVPPPGA 516 Query: 934 SPPRXXPLXPP 966 PR P P Sbjct: 517 PHPRVPPPGAP 527 Score = 35.5 bits (78), Expect = 0.065 Identities = 26/85 (30%), Positives = 29/85 (34%), Gaps = 4/85 (4%) Frame = +2 Query: 725 HPXPLNRNTCXPXXPPSXNPXPLXPXP--PPPXAXPXFAXXRPSXPTXXXXP-XPPPXXP 895 HP P PP P P P P P P P A + + P PPP P Sbjct: 568 HPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPPGAPYQRLPYSGAYHPRLPPPGPP 627 Query: 896 H-XPPYPGTXXPXXPPPXTXHLXPP 967 + P PG P P T H P Sbjct: 628 YQRVPPPGAPIQRVPLPETHHQRVP 652 Score = 35.1 bits (77), Expect = 0.086 Identities = 40/137 (29%), Positives = 43/137 (31%), Gaps = 5/137 (3%) Frame = +1 Query: 571 HRLRPPXRXSXKXXPPXXXXXXPXPPPGXINHXXGPXPPWXPXPXGAPPXXP----PXPX 738 H PP PP PPPG H P PP P P PP P P P Sbjct: 448 HPRVPPPGAPHPRVPPPGAPHPRVPPPGA-PHPRVP-PPGAPHPRVPPPGAPHQRVPPPG 505 Query: 739 *PE-HLXPXXSPFXKPVXPXPHXPXPVRXSXXRVLXXLXPNXXXXXXPPPXXXPXPPLSR 915 P + P +P P P P P P + P PP P P R Sbjct: 506 APHPRVPPPGAPH--PRVPPPGAPHP----------RVPPPGAPHPRVPPPGAPHP---R 550 Query: 916 YXXPXXSPPRXXPLXPP 966 P S PR P P Sbjct: 551 VPPPGASHPRVPPPGAP 567 Score = 34.3 bits (75), Expect = 0.15 Identities = 28/88 (31%), Positives = 28/88 (31%), Gaps = 6/88 (6%) Frame = +2 Query: 725 HPXPLNRNTCXPXXPPSXNPXPLXPXP--PPPXAXPXFAXXRPSXPTXXXXP-XPPPXXP 895 HP P PP P P P P P P A P P PPP P Sbjct: 538 HPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAP 597 Query: 896 HXP-PYPGTXXPXXPPPXTXH--LXPPG 970 H P PG P H L PPG Sbjct: 598 HPKVPPPGAPYQRLPYSGAYHPRLPPPG 625 Score = 33.9 bits (74), Expect = 0.20 Identities = 35/124 (28%), Positives = 39/124 (31%), Gaps = 5/124 (4%) Frame = +1 Query: 571 HRLRPPXRXSXKXXPPXXXXXXPXPPPGXINHXXGPXPPWXPXPXGAPPXXP----PXPX 738 H PP PP PPPG +H P PP P P PP P P P Sbjct: 528 HPRVPPPGAPHPRVPPPGAPHPRVPPPGA-SHPRVP-PPGAPHPRVPPPGAPHPRVPPPG 585 Query: 739 *PE-HLXPXXSPFXKPVXPXPHXPXPVRXSXXRVLXXLXPNXXXXXXPPPXXXPXPPLSR 915 P + P +P P P P P L P PP P P+ R Sbjct: 586 TPHPRVPPPGAPH--PKVPPPGAPYQRLPYSGAYHPRLPPPGPPYQRVPP---PGAPIQR 640 Query: 916 YXXP 927 P Sbjct: 641 VPLP 644 Score = 33.5 bits (73), Expect = 0.26 Identities = 33/132 (25%), Positives = 36/132 (27%), Gaps = 4/132 (3%) Frame = +1 Query: 583 PPXRXSXKXXPPXXXXXXPXPPPGXINHXXGPXPPWXPXPXGAPPXXP----PXPX*PEH 750 PP R PP PP +H PP P PP P P P Sbjct: 330 PPIRAPVDVYPPRAPQGASQTPPYPGSHYSRVPPPDGPYTRALPPGEPYARMPPPGATHP 389 Query: 751 LXPXXSPFXKPVXPXPHXPXPVRXSXXRVLXXLXPNXXXXXXPPPXXXPXPPLSRYXXPX 930 P P P P P P + P PP P P R+ P Sbjct: 390 RVPSPGA-SHPRVPPPGAPHPRVPPPGASHQRVRPPGAPHPRVPPPGAPHP---RFPPPG 445 Query: 931 XSPPRXXPLXPP 966 PR P P Sbjct: 446 APHPRVPPPGAP 457 Score = 31.9 bits (69), Expect = 0.80 Identities = 33/115 (28%), Positives = 36/115 (31%), Gaps = 7/115 (6%) Frame = +1 Query: 643 PPPGXINHXXGPXPPWXPXP-XGAPPXXPPXP-X*PEHLXPXXSP---FXKPVXPXPHXP 807 PPP + H P P P G PP PP P P + P +P P P H Sbjct: 300 PPPQYMPHPRMRPPTRIPPPGMGPPPRIPPPPIRAPVDVYPPRAPQGASQTPPYPGSHYS 359 Query: 808 XPVRXSXXRVLXXLXPNXXXXXXPPP-XXXPXPPLSRYXXPXXSPP-RXXPLXPP 966 V L P PPP P P P PP P PP Sbjct: 360 R-VPPPDGPYTRALPPGEPYARMPPPGATHPRVPSPGASHPRVPPPGAPHPRVPP 413 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 46.8 bits (106), Expect = 3e-05 Identities = 31/99 (31%), Positives = 35/99 (35%), Gaps = 2/99 (2%) Frame = +1 Query: 676 PXPPWXPXPXGAP-PXXPPXPX*PEHLXPXXSPFXKPVXPXPHXPXPVRXSXXRVLXXLX 852 P PP P P P P PP P PE P SP P PH P P + + + Sbjct: 186 PTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIP-PAPPNPSKAIATPN 244 Query: 853 PNXXXXXXPPPXXXP-XPPLSRYXXPXXSPPRXXPLXPP 966 P PP P PP S +PP PP Sbjct: 245 PPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPP 283 Score = 37.9 bits (84), Expect = 0.012 Identities = 23/72 (31%), Positives = 24/72 (33%), Gaps = 1/72 (1%) Frame = +2 Query: 728 PXPLNRNTCXPXXPPSXNPXPLXPXPPPPXAXPXFAXXRPSXPTXXXXPXPPPXXPHXPP 907 P P T P P P PL P PP P A P+ P P P PP Sbjct: 204 PTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIPP 263 Query: 908 -YPGTXXPXXPP 940 P P PP Sbjct: 264 ASPNPSIPPAPP 275 Score = 36.3 bits (80), Expect = 0.037 Identities = 20/58 (34%), Positives = 23/58 (39%), Gaps = 6/58 (10%) Frame = +2 Query: 758 PXXPPSXNPXPLXPXPPPPXAXPX-FAXXRPSXPTXXXXPXPP-----PXXPHXPPYP 913 P PP+ + P P PP P + P A P P P P P PH PP P Sbjct: 176 PPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAP 233 Score = 35.1 bits (77), Expect = 0.086 Identities = 21/70 (30%), Positives = 24/70 (34%) Frame = +2 Query: 758 PXXPPSXNPXPLXPXPPPPXAXPXFAXXRPSXPTXXXXPXPPPXXPHXPPYPGTXXPXXP 937 P PP+ + PP P P A P PT P PP P+ P P P Sbjct: 294 PYIPPAPPNLFIPSAPPNPHIPP--APPNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIP 351 Query: 938 PPXTXHLXPP 967 P PP Sbjct: 352 PAPPNLFIPP 361 Score = 33.5 bits (73), Expect = 0.26 Identities = 29/110 (26%), Positives = 33/110 (30%) Frame = +1 Query: 637 PXPPPGXINHXXGPXPPWXPXPXGAPPXXPPXPX*PEHLXPXXSPFXKPVXPXPHXPXPV 816 P PP N P P P P P P P +P P P P P P Sbjct: 227 PHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIP---PASPNPSIPPAPPNPSIPAPP 283 Query: 817 RXSXXRVLXXLXPNXXXXXXPPPXXXPXPPLSRYXXPXXSPPRXXPLXPP 966 S + PN PP P P + + P P P PP Sbjct: 284 NPS----IPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNP-YIPTAPP 328 Score = 33.5 bits (73), Expect = 0.26 Identities = 24/79 (30%), Positives = 29/79 (36%) Frame = +2 Query: 728 PXPLNRNTCXPXXPPSXNPXPLXPXPPPPXAXPXFAXXRPSXPTXXXXPXPPPXXPHXPP 907 P P T P P+ P P P P A P + P P+ P PP P+ PP Sbjct: 243 PNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPNPS---IPLAPP-NPYIPP 298 Query: 908 YPGTXXPXXPPPXTXHLXP 964 P PP H+ P Sbjct: 299 APPNLFIPSAPP-NPHIPP 316 Score = 32.3 bits (70), Expect = 0.61 Identities = 26/91 (28%), Positives = 29/91 (31%), Gaps = 1/91 (1%) Frame = +1 Query: 637 PXPPPGXINHXXGPXPPWXPXPXGAPPXXPPXPX*PEHLXPXXSPFXKPVXPXPHXPXPV 816 P PP N P PP P P P P P + F P PH P P Sbjct: 259 PFIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIP-PA 317 Query: 817 RXSXXRVLXXLXPNXXXXXXPP-PXXXPXPP 906 + + PN PP P P PP Sbjct: 318 PPNP--YIPTAPPNPSIPPAPPNPSIPPAPP 346 Score = 31.5 bits (68), Expect = 1.1 Identities = 19/54 (35%), Positives = 22/54 (40%) Frame = +2 Query: 758 PXXPPSXNPXPLXPXPPPPXAXPXFAXXRPSXPTXXXXPXPPPXXPHXPPYPGT 919 P PP+ P P P PP + P A PS P P PP P+ P T Sbjct: 312 PHIPPAP-PNPYIPTAPPNPSIPP-APPNPSIPPAPPNPSIPPAPPNLFIPPAT 363 Score = 31.1 bits (67), Expect = 1.4 Identities = 29/126 (23%), Positives = 34/126 (26%) Frame = +1 Query: 586 PXRXSXKXXPPXXXXXXPXPPPGXINHXXGPXPPWXPXPXGAPPXXPPXPX*PEHLXPXX 765 P + PP P P P P P P PP P P L P Sbjct: 236 PSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPNPSIP--LAPP- 292 Query: 766 SPFXKPVXPXPHXPXPVRXSXXRVLXXLXPNXXXXXXPPPXXXPXPPLSRYXXPXXSPPR 945 +P+ P P P + PN PP P P + P P Sbjct: 293 NPYIPPAPPNLFIPSAPPNPH---IPPAPPNPYIPTAPPNPSIPPAPPNPSIPPAPPNPS 349 Query: 946 XXPLXP 963 P P Sbjct: 350 IPPAPP 355 Score = 29.5 bits (63), Expect = 4.3 Identities = 21/64 (32%), Positives = 23/64 (35%), Gaps = 3/64 (4%) Frame = +2 Query: 782 PXPLXPXPPPPXAXPXFAXXRPSXPTXXXXP--XPPPXXPHXPPYPGTXXPXXPP-PXTX 952 P P PP P P P P P P P P P PG+ P PP P Sbjct: 172 PETKPPKPPAPSTIP--TPPTPPAPPSPPIPTAPPTPPMPETPLPPGS--PHIPPAPLHP 227 Query: 953 HLXP 964 H+ P Sbjct: 228 HIPP 231 >SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 46.8 bits (106), Expect = 3e-05 Identities = 21/31 (67%), Positives = 23/31 (74%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLTQR 459 +C G +PLPRSLTR ARSF CGER LT R Sbjct: 74 ICDTGYIPLPRSLTRYARSFDCGERKWLTNR 104 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 22 AALMNRPTRGERRFAYW 38 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 45.6 bits (103), Expect = 6e-05 Identities = 25/67 (37%), Positives = 26/67 (38%) Frame = +2 Query: 767 PPSXNPXPLXPXPPPPXAXPXFAXXRPSXPTXXXXPXPPPXXPHXPPYPGTXXPXXPPPX 946 PP P P PPPP A +P P P PPP PP PG P PPP Sbjct: 921 PPPPPPGGNAPLPPPPPGGS--APSQPPPPGGNAPPPPPPPGGSAPP-PGGGAPPLPPPP 977 Query: 947 TXHLXPP 967 PP Sbjct: 978 GGSAPPP 984 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 5/67 (7%) Frame = +2 Query: 758 PXXPPSXNPXPLXPXPP---PPXAXPXFAXXRPSXPTXXXXPXPPPXX--PHXPPYPGTX 922 P PP PL P PP P P P P PPP P PP PG Sbjct: 921 PPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGS 980 Query: 923 XPXXPPP 943 P PPP Sbjct: 981 APPPPPP 987 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/57 (36%), Positives = 22/57 (38%), Gaps = 3/57 (5%) Frame = +1 Query: 583 PPXRXSXKXXPPXXXXXXPXPPP---GXINHXXGPXPPWXPXPXGAPPXXPPXPX*P 744 PP S PP P PPP G G PP P P G+ P PP P P Sbjct: 935 PPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPP 991 Score = 37.9 bits (84), Expect = 0.012 Identities = 20/58 (34%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Frame = +2 Query: 809 PPXAXPXFAXXRPSXPTXXXXPXPPPXX----PHXPPYPGTXXPXXPPPXTXHLXPPG 970 P + P + P P P PPP P PP PG P PPP PPG Sbjct: 910 PSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPG 967 Score = 37.1 bits (82), Expect = 0.021 Identities = 25/80 (31%), Positives = 26/80 (32%), Gaps = 3/80 (3%) Frame = +1 Query: 583 PPXRXSXKXXPPXXXXXXPXPPPGXINHXXGPXPPWXPXPXGAPP---XXPPXPX*PEHL 753 P S PP P PPPG N P PP P PP PP P P Sbjct: 904 PGGSESPSASPPGGSVPPPPPPPGG-NAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGS 962 Query: 754 XPXXSPFXKPVXPXPHXPXP 813 P P+ P P P Sbjct: 963 APPPGGGAPPLPPPPGGSAP 982 Score = 37.1 bits (82), Expect = 0.021 Identities = 20/62 (32%), Positives = 22/62 (35%) Frame = +2 Query: 728 PXPLNRNTCXPXXPPSXNPXPLXPXPPPPXAXPXFAXXRPSXPTXXXXPXPPPXXPHXPP 907 P P + PP N P P PPP + P P P PPP P PP Sbjct: 934 PPPPGGSAPSQPPPPGGNAPP--PPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPP 991 Query: 908 YP 913 P Sbjct: 992 PP 993 Score = 36.7 bits (81), Expect = 0.028 Identities = 26/76 (34%), Positives = 27/76 (35%), Gaps = 4/76 (5%) Frame = +2 Query: 728 PXPLNRNTCXPXXPPSXNPXPLXPXPP----PPXAXPXFAXXRPSXPTXXXXPXPPPXXP 895 P P N P PP + P P PP PP P P P P PPP Sbjct: 923 PPPPGGNAPLPPPPPGGSA-PSQPPPPGGNAPPPPPPPGGSAPP--PGGGAPPLPPPPGG 979 Query: 896 HXPPYPGTXXPXXPPP 943 PP P P PPP Sbjct: 980 SAPP-PPPPPPPPPPP 994 Score = 35.1 bits (77), Expect = 0.086 Identities = 20/58 (34%), Positives = 22/58 (37%) Frame = +2 Query: 770 PSXNPXPLXPXPPPPXAXPXFAXXRPSXPTXXXXPXPPPXXPHXPPYPGTXXPXXPPP 943 PS +P P PPPP A P P PPP + PP P PPP Sbjct: 910 PSASP-PGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPP 966 Score = 33.5 bits (73), Expect = 0.26 Identities = 25/81 (30%), Positives = 28/81 (34%), Gaps = 2/81 (2%) Frame = +1 Query: 583 PPXRXSXKXXPPXXXXXXPXPPPGXINHXXGPXPPW--XPXPXGAPPXXPPXPX*PEHLX 756 PP + PP PPP N P PP P P G P PP P Sbjct: 925 PPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPG------ 978 Query: 757 PXXSPFXKPVXPXPHXPXPVR 819 +P P P P P P+R Sbjct: 979 -GSAP--PPPPPPPPPPPPMR 996 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 45.2 bits (102), Expect = 8e-05 Identities = 29/87 (33%), Positives = 30/87 (34%), Gaps = 9/87 (10%) Frame = +2 Query: 734 PLNRNTCXPXXPPSXNPXPLXPXPPP--PXAXPXFAXXRPSXPT-------XXXXPXPPP 886 P T P P P PL P PPP P P RP+ PT PPP Sbjct: 895 PTTPTTPKPTTPAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPP 954 Query: 887 XXPHXPPYPGTXXPXXPPPXTXHLXPP 967 PP P T P P P PP Sbjct: 955 TSALPPPIPATQVPPPPLPPLPPPPPP 981 Score = 36.7 bits (81), Expect = 0.028 Identities = 24/73 (32%), Positives = 26/73 (35%), Gaps = 2/73 (2%) Frame = +2 Query: 728 PXPLNRNTCXPXXP--PSXNPXPLXPXPPPPXAXPXFAXXRPSXPTXXXXPXPPPXXPHX 901 P P T P P P+ P PPPP + A P T P PP P Sbjct: 924 PPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTS----ALPPPIPATQVPPPPLPPLPPPP 979 Query: 902 PPYPGTXXPXXPP 940 PP T P PP Sbjct: 980 PPVQTTTAPTLPP 992 Score = 35.5 bits (78), Expect = 0.065 Identities = 27/81 (33%), Positives = 29/81 (35%), Gaps = 6/81 (7%) Frame = +2 Query: 743 RNTCXPXXPPSXNPXPLXPXPPPPXAXPXFAXXRPSXPTXXXXPXPPPXXPHXPPYPGTX 922 + T P P+ P P P PPPP P P P P PPP P P T Sbjct: 889 KTTTAPPTTPT-TPKPTTPAPPPPL--PLAPEPPPPLP-----PPPPPIQTTRPTVPTTP 940 Query: 923 XP------XXPPPXTXHLXPP 967 PPP T L PP Sbjct: 941 TTQASTTRPTPPPPTSALPPP 961 >SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.3 bits (80), Expect = 0.037 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +2 Query: 257 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTXGXRRFAYW 379 +++LT L RF V +ALMNRPT G RRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) Length = 217 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 172 ICDTGYIPLPRSLTRYARSFDCGERKWLT 200 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 120 AALMNRPTRGERRFAYW 136 >SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.3 bits (80), Expect = 0.037 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +2 Query: 257 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTXGXRRFAYW 379 +++LT L RF V +ALMNRPT G RRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) Length = 341 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 296 ICDTGYIPLPRSLTRYARSFDCGERKWLT 324 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 244 AALMNRPTRGERRFAYW 260 >SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 134 ICDTGYIPLPRSLTRYARSFDCGERKWLT 162 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 82 AALMNRPTRGERRFAYW 98 >SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 121 ICDTGYIPLPRSLTRYARSFDCGERKWLT 149 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 69 AALMNRPTRGERRFAYW 85 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 146 ICDTGYIPLPRSLTRYARSFDCGERKWLT 174 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 94 AALMNRPTRGERRFAYW 110 >SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.3 bits (80), Expect = 0.037 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +2 Query: 257 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTXGXRRFAYW 379 +++LT L RF V +ALMNRPT G RRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) Length = 148 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 103 ICDTGYIPLPRSLTRYARSFDCGERKWLT 131 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 51 AALMNRPTRGERRFAYW 67 >SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 133 ICDTGYIPLPRSLTRYARSFDCGERKWLT 161 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 81 AALMNRPTRGERRFAYW 97 >SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) Length = 653 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 251 ICDTGYIPLPRSLTRYARSFDCGERKWLT 279 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 199 AALMNRPTRGERRFAYW 215 >SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGERKWLT 121 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 41 AALMNRPTRGERRFAYW 57 >SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 92 ICDTGYIPLPRSLTRYARSFDCGERKWLT 120 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 40 AALMNRPTRGERRFAYW 56 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 393 ICDTGYIPLPRSLTRYARSFDCGERKWLT 421 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 341 AALMNRPTRGERRFAYW 357 Score = 33.5 bits (73), Expect = 0.26 Identities = 18/50 (36%), Positives = 20/50 (40%), Gaps = 2/50 (4%) Frame = +2 Query: 797 PXPPPPXAXPXFAXXRPSXPT--XXXXPXPPPXXPHXPPYPGTXXPXXPP 940 P PPPP P P+ P+ P PPP P P P P PP Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKP--TKPSLPP 824 Score = 29.1 bits (62), Expect = 5.7 Identities = 16/53 (30%), Positives = 19/53 (35%) Frame = +2 Query: 728 PXPLNRNTCXPXXPPSXNPXPLXPXPPPPXAXPXFAXXRPSXPTXXXXPXPPP 886 P P P PP+ P P PP P +P+ PT P PP Sbjct: 779 PPPPPTKPATPRVPPNIPSRPPGARPTPPPPPP----GKPTKPTKPSLPPVPP 827 >SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.3 bits (80), Expect = 0.037 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +2 Query: 257 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTXGXRRFAYW 379 +++LT L RF V +ALMNRPT G RRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) Length = 293 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 248 ICDTGYIPLPRSLTRYARSFDCGERKWLT 276 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 196 AALMNRPTRGERRFAYW 212 >SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 148 ICDTGYIPLPRSLTRYARSFDCGERKWLT 176 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 96 AALMNRPTRGERRFAYW 112 >SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 134 ICDTGYIPLPRSLTRYARSFDCGERKWLT 162 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 82 AALMNRPTRGERRFAYW 98 >SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 940 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 611 ICDTGYIPLPRSLTRYARSFDCGERKWLT 639 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 559 AALMNRPTRGERRFAYW 575 >SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) Length = 491 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 367 ICDTGYIPLPRSLTRYARSFDCGERKWLT 395 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 315 AALMNRPTRGERRFAYW 331 >SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.3 bits (80), Expect = 0.037 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +2 Query: 257 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTXGXRRFAYW 379 +++LT L RF V +ALMNRPT G RRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) Length = 255 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 210 ICDTGYIPLPRSLTRYARSFDCGERKWLT 238 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 158 AALMNRPTRGERRFAYW 174 >SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 168 ICDTGYIPLPRSLTRYARSFDCGERKWLT 196 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 116 AALMNRPTRGERRFAYW 132 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGERKWLT 160 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 80 AALMNRPTRGERRFAYW 96 Score = 35.9 bits (79), Expect = 0.049 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 854 PTXXXXPXPPPXXPHXPPYPGTXXPXXPPPXTXHL 958 P P PPP P PP P P PPP HL Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTPLHL 499 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 758 PXXPPSXNPXPLXPXPPPPXAXPXFAXXRPSXP 856 P PP P P P PPPP P F P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 33.1 bits (72), Expect = 0.35 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 637 PXPPPGXINHXXGPXPPWXPXPXGAPPXXPPXPX*PEHL 753 P PPP P PP P P PP PP P P HL Sbjct: 464 PPPPPPP---PPPPPPPPPPPPPPPPPFPPPPPPTPLHL 499 Score = 33.1 bits (72), Expect = 0.35 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +2 Query: 797 PXPPPPXAXPXFAXXRPSXPTXXXXPXPPPXXPHXPPYP 913 P PPPP P P P P PPP P PP P Sbjct: 464 PPPPPPPPPP------PPPPPPPPPPPPPPFPPPPPPTP 496 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 872 PXPPPXXPHXPPYPGTXXPXXPPP 943 P PPP P PP P P PPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 878 PPPXXPHXPPYPGTXXPXXPPPXTXHLXPP 967 PPP P PP P P PPP PP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 878 PPPXXPHXPPYPGTXXPXXPPPXTXHLXPP 967 PPP P PP P P PPP PP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 797 PXPPPPXAXPXFAXXRPSXPTXXXXPXPPPXXPH 898 P PPPP P P P P PPP H Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTPLH 498 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 673 GPXPPWXPXPXGAPPXXPPXPX*PEHLXPXXSPFXKPVXPXP 798 G PP P P PP PP P P PF P P P Sbjct: 461 GQAPPPPPPPPPPPPPPPPPP------PPPPPPFPPPPPPTP 496 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 767 PPSXNPXPLXPXPPPPXAXPXFAXXRPSXPT 859 PP P P P PPPP P P PT Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPPT 495 >SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 94 ICDTGYIPLPRSLTRYARSFDCGERKWLT 122 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 42 AALMNRPTRGERRFAYW 58 >SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) Length = 178 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 133 ICDTGYIPLPRSLTRYARSFDCGERKWLT 161 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 81 AALMNRPTRGERRFAYW 97 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 179 ICDTGYIPLPRSLTRYARSFDCGERKWLT 207 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 127 AALMNRPTRGERRFAYW 143 >SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 102 ICDTGYIPLPRSLTRYARSFDCGERKWLT 130 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 50 AALMNRPTRGERRFAYW 66 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 137 ICDTGYIPLPRSLTRYARSFDCGERKWLT 165 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 85 AALMNRPTRGERRFAYW 101 >SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.3 bits (80), Expect = 0.037 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +2 Query: 257 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTXGXRRFAYW 379 +++LT L RF V +ALMNRPT G RRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 153 ICDTGYIPLPRSLTRYARSFDCGERKWLT 181 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 101 AALMNRPTRGERRFAYW 117 >SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.3 bits (80), Expect = 0.037 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +2 Query: 257 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTXGXRRFAYW 379 +++LT L RF V +ALMNRPT G RRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.3 bits (80), Expect = 0.037 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +2 Query: 257 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTXGXRRFAYW 379 +++LT L RF V +ALMNRPT G RRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) Length = 346 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.3 bits (80), Expect = 0.037 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +2 Query: 257 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTXGXRRFAYW 379 +++LT L RF V +ALMNRPT G RRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 63 ICDTGYIPLPRSLTRYARSFDCGERKWLT 91 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 11 AALMNRPTRGERRFAYW 27 >SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGERKWLT 141 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 61 AALMNRPTRGERRFAYW 77 >SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2496 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 600 ICDTGYIPLPRSLTRYARSFDCGERKWLT 628 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 548 AALMNRPTRGERRFAYW 564 >SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGERKWLT 141 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 61 AALMNRPTRGERRFAYW 77 >SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) Length = 216 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 171 ICDTGYIPLPRSLTRYARSFDCGERKWLT 199 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 119 AALMNRPTRGERRFAYW 135 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 96 ICDTGYIPLPRSLTRYARSFDCGERKWLT 124 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 44 AALMNRPTRGERRFAYW 60 >SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.3 bits (80), Expect = 0.037 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +2 Query: 257 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTXGXRRFAYW 379 +++LT L RF V +ALMNRPT G RRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 117 ICDTGYIPLPRSLTRYARSFDCGERKWLT 145 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 65 AALMNRPTRGERRFAYW 81 >SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) Length = 184 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 139 ICDTGYIPLPRSLTRYARSFDCGERKWLT 167 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 87 AALMNRPTRGERRFAYW 103 >SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 116 ICDTGYIPLPRSLTRYARSFDCGERKWLT 144 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 64 AALMNRPTRGERRFAYW 80 >SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) Length = 150 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 105 ICDTGYIPLPRSLTRYARSFDCGERKWLT 133 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 53 AALMNRPTRGERRFAYW 69 >SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGERKWLT 160 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 80 AALMNRPTRGERRFAYW 96 >SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 130 ICDTGYIPLPRSLTRYARSFDCGERKWLT 158 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 78 AALMNRPTRGERRFAYW 94 >SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 99 ICDTGYIPLPRSLTRYARSFDCGERKWLT 127 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 47 AALMNRPTRGERRFAYW 63 >SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 282 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 237 ICDTGYIPLPRSLTRYARSFDCGERKWLT 265 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 185 AALMNRPTRGERRFAYW 201 >SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) Length = 673 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 628 ICDTGYIPLPRSLTRYARSFDCGERKWLT 656 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 576 AALMNRPTRGERRFAYW 592 >SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) Length = 841 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 350 ICDTGYIPLPRSLTRYARSFDCGERKWLT 378 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 298 AALMNRPTRGERRFAYW 314 >SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) Length = 168 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 123 ICDTGYIPLPRSLTRYARSFDCGERKWLT 151 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 71 AALMNRPTRGERRFAYW 87 >SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) Length = 895 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 854 ICDTGYIPLPRSLTRYARSFDCGERKWLT 882 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 802 AALMNRPTRGERRFAYW 818 >SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) Length = 284 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 239 ICDTGYIPLPRSLTRYARSFDCGERKWLT 267 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 187 AALMNRPTRGERRFAYW 203 >SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 138 ICDTGYIPLPRSLTRYARSFDCGERKWLT 166 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 86 AALMNRPTRGERRFAYW 102 >SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 584 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 539 ICDTGYIPLPRSLTRYARSFDCGERKWLT 567 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 487 AALMNRPTRGERRFAYW 503 >SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.3 bits (80), Expect = 0.037 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +2 Query: 257 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTXGXRRFAYW 379 +++LT L RF V +ALMNRPT G RRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 84 ICDTGYIPLPRSLTRYARSFDCGERKWLT 112 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 32 AALMNRPTRGERRFAYW 48 >SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) Length = 1029 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 984 ICDTGYIPLPRSLTRYARSFDCGERKWLT 1012 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 932 AALMNRPTRGERRFAYW 948 >SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) Length = 155 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 110 ICDTGYIPLPRSLTRYARSFDCGERKWLT 138 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 58 AALMNRPTRGERRFAYW 74 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 152 ICDTGYIPLPRSLTRYARSFDCGERKWLT 180 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 100 AALMNRPTRGERRFAYW 116 >SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) Length = 704 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 489 ICDTGYIPLPRSLTRYARSFDCGERKWLT 517 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 437 AALMNRPTRGERRFAYW 453 >SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.3 bits (80), Expect = 0.037 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +2 Query: 257 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTXGXRRFAYW 379 +++LT L RF V +ALMNRPT G RRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGERKWLT 121 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 41 AALMNRPTRGERRFAYW 57 >SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) Length = 167 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 122 ICDTGYIPLPRSLTRYARSFDCGERKWLT 150 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 70 AALMNRPTRGERRFAYW 86 >SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) Length = 453 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 285 ICDTGYIPLPRSLTRYARSFDCGERKWLT 313 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 233 AALMNRPTRGERRFAYW 249 >SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) Length = 149 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 104 ICDTGYIPLPRSLTRYARSFDCGERKWLT 132 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 52 AALMNRPTRGERRFAYW 68 >SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.3 bits (80), Expect = 0.037 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +2 Query: 257 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTXGXRRFAYW 379 +++LT L RF V +ALMNRPT G RRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.3 bits (80), Expect = 0.037 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +2 Query: 257 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTXGXRRFAYW 379 +++LT L RF V +ALMNRPT G RRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 74 ICDTGYIPLPRSLTRYARSFDCGERKWLT 102 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 22 AALMNRPTRGERRFAYW 38 >SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 239 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 194 ICDTGYIPLPRSLTRYARSFDCGERKWLT 222 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 142 AALMNRPTRGERRFAYW 158 >SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 279 ICDTGYIPLPRSLTRYARSFDCGERKWLT 307 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 227 AALMNRPTRGERRFAYW 243 >SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) Length = 150 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 105 ICDTGYIPLPRSLTRYARSFDCGERKWLT 133 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 53 AALMNRPTRGERRFAYW 69 >SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) Length = 198 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 153 ICDTGYIPLPRSLTRYARSFDCGERKWLT 181 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 101 AALMNRPTRGERRFAYW 117 >SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGERKWLT 141 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 61 AALMNRPTRGERRFAYW 77 >SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) Length = 200 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 155 ICDTGYIPLPRSLTRYARSFDCGERKWLT 183 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 103 AALMNRPTRGERRFAYW 119 >SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 123 ICDTGYIPLPRSLTRYARSFDCGERKWLT 151 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 71 AALMNRPTRGERRFAYW 87 >SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.3 bits (80), Expect = 0.037 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +2 Query: 257 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTXGXRRFAYW 379 +++LT L RF V +ALMNRPT G RRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_18781| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 125 ICDTGYIPLPRSLTRYARSFDCGERKWLT 153 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNR T G RRFA W Sbjct: 73 AALMNRATRGERRFADW 89 >SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.3 bits (80), Expect = 0.037 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +2 Query: 257 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTXGXRRFAYW 379 +++LT L RF V +ALMNRPT G RRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 92 ICDTGYIPLPRSLTRYARSFDCGERKWLT 120 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 40 AALMNRPTRGERRFAYW 56 >SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) Length = 177 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGERKWLT 160 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 80 AALMNRPTRGERRFAYW 96 >SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGERKWLT 129 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 49 AALMNRPTRGERRFAYW 65 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 995 ICDTGYIPLPRSLTRYARSFDCGERKWLT 1023 Score = 37.5 bits (83), Expect = 0.016 Identities = 23/71 (32%), Positives = 24/71 (33%) Frame = +2 Query: 758 PXXPPSXNPXPLXPXPPPPXAXPXFAXXRPSXPTXXXXPXPPPXXPHXPPYPGTXXPXXP 937 P PP P P P P P P P P P P P YPG P P Sbjct: 1660 PAPPPPPPPAPGPPGPDGPMGLP--GPQGPDGPKGPPGPPGLPGPQGIPGYPGA--PAGP 1715 Query: 938 PPXTXHLXPPG 970 P + PPG Sbjct: 1716 PGRDGPMGPPG 1726 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 943 AALMNRPTRGERRFAYW 959 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/57 (28%), Positives = 18/57 (31%) Frame = +2 Query: 770 PSXNPXPLXPXPPPPXAXPXFAXXRPSXPTXXXXPXPPPXXPHXPPYPGTXXPXXPP 940 P P P P PP P+ P P PP +PG P PP Sbjct: 1793 PKGMPGPPGPPGPPGAIGWKGNPGNPAGPPGLDGPPGPPGPQGPKGWPGVPGPPGPP 1849 Score = 28.7 bits (61), Expect = 7.5 Identities = 19/59 (32%), Positives = 20/59 (33%), Gaps = 3/59 (5%) Frame = +1 Query: 568 FHRLRPPXRXSXKXXPPXXXXXXPXPPPGXINHXXGPX-PPWXPXPXGAP--PXXPPXP 735 FH PP PP P P + GP PP P P G P P P P Sbjct: 1657 FHYPAPPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPGYPGAPAGP 1715 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 142 ICDTGYIPLPRSLTRYARSFDCGERKWLT 170 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 90 AALMNRPTRGERRFAYW 106 >SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) Length = 520 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 475 ICDTGYIPLPRSLTRYARSFDCGERKWLT 503 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 423 AALMNRPTRGERRFAYW 439 >SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) Length = 202 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 157 ICDTGYIPLPRSLTRYARSFDCGERKWLT 185 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 105 AALMNRPTRGERRFAYW 121 >SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) Length = 568 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 523 ICDTGYIPLPRSLTRYARSFDCGERKWLT 551 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 471 AALMNRPTRGERRFAYW 487 >SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 130 ICDTGYIPLPRSLTRYARSFDCGERKWLT 158 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 78 AALMNRPTRGERRFAYW 94 >SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) Length = 631 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 521 ICDTGYIPLPRSLTRYARSFDCGERKWLT 549 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 469 AALMNRPTRGERRFAYW 485 Score = 29.5 bits (63), Expect = 4.3 Identities = 18/58 (31%), Positives = 19/58 (32%), Gaps = 1/58 (1%) Frame = +2 Query: 797 PXPPPPXAXPXFAXXRPSXPTXXXXPXPPPXXP-HXPPYPGTXXPXXPPPXTXHLXPP 967 P PP P P P T P P P P P + P P P T PP Sbjct: 143 PSPPNPTEAPEPETVPPQPETVPPQPETVPPQPGSEEPEPVSQAPEPPKPKTSAPEPP 200 Score = 28.3 bits (60), Expect = 9.9 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +1 Query: 676 PXPPWXPXPXGAPPXXPPXPX*PEHLXP-XXSPFXKPVXPXPHXPXP 813 P P P P PP P PE + P S +PV P P P Sbjct: 146 PNPTEAPEPETVPPQPETVPPQPETVPPQPGSEEPEPVSQAPEPPKP 192 >SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 143 ICDTGYIPLPRSLTRYARSFDCGERKWLT 171 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 91 AALMNRPTRGERRFAYW 107 >SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGERKWLT 129 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 49 AALMNRPTRGERRFAYW 65 >SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGERKWLT 129 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 49 AALMNRPTRGERRFAYW 65 >SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) Length = 190 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 145 ICDTGYIPLPRSLTRYARSFDCGERKWLT 173 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 93 AALMNRPTRGERRFAYW 109 >SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) Length = 197 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 152 ICDTGYIPLPRSLTRYARSFDCGERKWLT 180 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 100 AALMNRPTRGERRFAYW 116 >SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) Length = 336 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 291 ICDTGYIPLPRSLTRYARSFDCGERKWLT 319 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 239 AALMNRPTRGERRFAYW 255 >SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 171 ICDTGYIPLPRSLTRYARSFDCGERKWLT 199 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 119 AALMNRPTRGERRFAYW 135 >SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 1206 ICDTGYIPLPRSLTRYARSFDCGERKWLT 1234 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 1154 AALMNRPTRGERRFAYW 1170 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 102 ICDTGYIPLPRSLTRYARSFDCGERKWLT 130 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 50 AALMNRPTRGERRFAYW 66 >SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 122 ICDTGYIPLPRSLTRYARSFDCGERKWLT 150 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 70 AALMNRPTRGERRFAYW 86 >SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 107 ICDTGYIPLPRSLTRYARSFDCGERKWLT 135 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 55 AALMNRPTRGERRFAYW 71 >SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) Length = 502 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 100 ICDTGYIPLPRSLTRYARSFDCGERKWLT 128 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 48 AALMNRPTRGERRFAYW 64 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 130 ICDTGYIPLPRSLTRYARSFDCGERKWLT 158 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 78 AALMNRPTRGERRFAYW 94 >SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 121 ICDTGYIPLPRSLTRYARSFDCGERKWLT 149 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 69 AALMNRPTRGERRFAYW 85 >SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 98 ICDTGYIPLPRSLTRYARSFDCGERKWLT 126 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 46 AALMNRPTRGERRFAYW 62 >SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2670 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 1476 ICDTGYIPLPRSLTRYARSFDCGERKWLT 1504 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 1424 AALMNRPTRGERRFAYW 1440 >SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) Length = 674 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 629 ICDTGYIPLPRSLTRYARSFDCGERKWLT 657 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 577 AALMNRPTRGERRFAYW 593 >SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 89 ICDTGYIPLPRSLTRYARSFDCGERKWLT 117 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 37 AALMNRPTRGERRFAYW 53 >SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 326 ICDTGYIPLPRSLTRYARSFDCGERKWLT 354 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 274 AALMNRPTRGERRFAYW 290 >SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 174 ICDTGYIPLPRSLTRYARSFDCGERKWLT 202 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 122 AALMNRPTRGERRFAYW 138 >SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2102 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 538 ICDTGYIPLPRSLTRYARSFDCGERKWLT 566 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 486 AALMNRPTRGERRFAYW 502 >SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) Length = 348 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.3 bits (80), Expect = 0.037 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +2 Query: 257 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTXGXRRFAYW 379 +++LT L RF V +ALMNRPT G RRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 91 ICDTGYIPLPRSLTRYARSFDCGERKWLT 119 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 39 AALMNRPTRGERRFAYW 55 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 160 ICDTGYIPLPRSLTRYARSFDCGERKWLT 188 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 108 AALMNRPTRGERRFAYW 124 >SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) Length = 189 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 144 ICDTGYIPLPRSLTRYARSFDCGERKWLT 172 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 92 AALMNRPTRGERRFAYW 108 >SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) Length = 142 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 144 ICDTGYIPLPRSLTRYARSFDCGERKWLT 172 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 92 AALMNRPTRGERRFAYW 108 >SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) Length = 227 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 182 ICDTGYIPLPRSLTRYARSFDCGERKWLT 210 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 130 AALMNRPTRGERRFAYW 146 >SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) Length = 157 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 112 ICDTGYIPLPRSLTRYARSFDCGERKWLT 140 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 60 AALMNRPTRGERRFAYW 76 >SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.3 bits (80), Expect = 0.037 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +2 Query: 257 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTXGXRRFAYW 379 +++LT L RF V +ALMNRPT G RRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 154 ICDTGYIPLPRSLTRYARSFDCGERKWLT 182 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 102 AALMNRPTRGERRFAYW 118 >SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGERKWLT 121 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 41 AALMNRPTRGERRFAYW 57 >SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 119 ICDTGYIPLPRSLTRYARSFDCGERKWLT 147 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 67 AALMNRPTRGERRFAYW 83 >SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) Length = 160 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 115 ICDTGYIPLPRSLTRYARSFDCGERKWLT 143 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 63 AALMNRPTRGERRFAYW 79 >SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) Length = 590 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 545 ICDTGYIPLPRSLTRYARSFDCGERKWLT 573 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 493 AALMNRPTRGERRFAYW 509 >SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) Length = 521 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 440 ICDTGYIPLPRSLTRYARSFDCGERKWLT 468 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 388 AALMNRPTRGERRFAYW 404 >SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.3 bits (80), Expect = 0.037 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +2 Query: 257 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTXGXRRFAYW 379 +++LT L RF V +ALMNRPT G RRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGERKWLT 121 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 41 AALMNRPTRGERRFAYW 57 >SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.3 bits (80), Expect = 0.037 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +2 Query: 257 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTXGXRRFAYW 379 +++LT L RF V +ALMNRPT G RRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 227 ICDTGYIPLPRSLTRYARSFDCGERKWLT 255 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 175 AALMNRPTRGERRFAYW 191 >SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 112 ICDTGYIPLPRSLTRYARSFDCGERKWLT 140 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 60 AALMNRPTRGERRFAYW 76 >SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_56405| Best HMM Match : Fels1 (HMM E-Value=6.5) Length = 119 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 74 ICDTGYIPLPRSLTRYARSFDCGERKWLT 102 >SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 95 ICDTGYIPLPRSLTRYARSFDCGERKWLT 123 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 43 AALMNRPTRGERRFAYW 59 >SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_55772| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_55573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) Length = 458 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_55103| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_55047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_54903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_54851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 94 ICDTGYIPLPRSLTRYARSFDCGERKWLT 122 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 42 AALMNRPTRGERRFAYW 58 >SB_54482| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 141 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 637 ICDTGYIPLPRSLTRYARSFDCGERKWLT 665 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 585 AALMNRPTRGERRFAYW 601 >SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 91 ICDTGYIPLPRSLTRYARSFDCGERKWLT 119 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 39 AALMNRPTRGERRFAYW 55 >SB_53836| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.3 bits (80), Expect = 0.037 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +2 Query: 257 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTXGXRRFAYW 379 +++LT L RF V +ALMNRPT G RRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_53493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_53207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_52948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_52761| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_52662| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) Length = 180 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 135 ICDTGYIPLPRSLTRYARSFDCGERKWLT 163 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 83 AALMNRPTRGERRFAYW 99 >SB_52572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1263 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 367 VCVLGALPLPRSLTRCARSFGCGERYQLT 453 +C G +PLPRSLTR ARSF CGER LT Sbjct: 446 ICDTGYIPLPRSLTRYARSFDCGERKWLT 474 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 329 SALMNRPTXGXRRFAYW 379 +ALMNRPT G RRFAYW Sbjct: 394 AALMNRPTRGERRFAYW 410 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,639,945 Number of Sequences: 59808 Number of extensions: 427634 Number of successful extensions: 7018 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 1904 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4494 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2860128240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -