BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_H23 (960 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor... 26 0.58 AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. 25 0.77 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 23 4.1 AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodo... 23 4.1 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 23 5.4 >U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor protein. Length = 129 Score = 25.8 bits (54), Expect = 0.58 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = +3 Query: 300 YNREIFNDDRGKLTGQAYGTRVLGPGGDSTNYGGRLELGEQ 422 Y + ++ D+ +TG AYG + PG S + G E G++ Sbjct: 60 YKQRVY--DKNGMTGDAYGGLNIRPGQPSRQHAG-FEFGKE 97 >AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. Length = 349 Score = 25.4 bits (53), Expect = 0.77 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +3 Query: 75 IQLKMNSNLFYIFATTLVCVNAEVYGPFDYAEDYSIRGQPS 197 I ++ LF +FA T C+N VYG F+ + +P+ Sbjct: 293 IDQRIQKGLF-LFACTNSCMNPIVYGAFNIRDRNKTSARPT 332 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 23.0 bits (47), Expect = 4.1 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +2 Query: 506 WIRXPLFCRWYGLEG 550 W+ PLFC+ Y + G Sbjct: 118 WVLGPLFCQIYAMLG 132 >AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodopsin protein. Length = 152 Score = 23.0 bits (47), Expect = 4.1 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +2 Query: 506 WIRXPLFCRWYGLEG 550 W+ PLFC+ Y + G Sbjct: 84 WVLGPLFCQIYAMLG 98 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 22.6 bits (46), Expect = 5.4 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 745 PPXPXPPXPP 774 PP P PP PP Sbjct: 338 PPKPAPPPPP 347 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 269,035 Number of Sequences: 438 Number of extensions: 8911 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 31565079 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -