BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_H19 (943 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 200 1e-51 SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) 159 4e-39 SB_35724| Best HMM Match : No HMM Matches (HMM E-Value=.) 153 3e-37 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 124 1e-28 SB_25122| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 8e-13 SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_34414| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_7309| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_1903| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 61 1e-09 SB_38053| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_30985| Best HMM Match : DUF1450 (HMM E-Value=1.5) 51 1e-06 SB_51245| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_54507| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_58426| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_57366| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_56245| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_55566| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_55077| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_53790| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_52894| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_48533| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_47211| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_46066| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_45109| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_43715| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_42865| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_41269| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_40020| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_38531| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_35148| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_31008| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_29391| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_27738| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_24808| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_23019| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_21707| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_19542| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_19098| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_19031| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_17805| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_15695| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_12040| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_9760| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_5267| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_3766| Best HMM Match : Moricin (HMM E-Value=5.1) 50 4e-06 SB_1707| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_1382| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_1275| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_25376| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 3e-05 SB_52929| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_12752| Best HMM Match : Borrelia_orfA (HMM E-Value=0.15) 45 1e-04 SB_10421| Best HMM Match : Guanylate_cyc (HMM E-Value=0) 45 1e-04 SB_8415| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_58224| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55737| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_54286| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_54219| Best HMM Match : Toxin_8 (HMM E-Value=8.1) 44 1e-04 SB_41217| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_38325| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_17471| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_16089| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_9623| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_59708| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_59685| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_59589| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_59479| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_58142| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_57899| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_57889| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_57793| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_57693| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_57320| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55905| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55790| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55716| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55631| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55333| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55090| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_54702| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_54683| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_54384| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_53884| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_53624| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_53241| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_52402| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_51349| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_51271| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_50626| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_49587| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_49375| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_49357| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_49260| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_49181| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_48829| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_48601| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_48323| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_48037| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_47484| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_47382| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_47359| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_47312| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46998| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46785| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46606| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46553| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46274| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46222| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46158| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45670| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45556| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45238| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_44797| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_44462| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_43465| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_42828| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_42781| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_42533| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_42195| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_41845| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_40938| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_39214| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_38586| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_38311| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37725| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37267| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37229| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_36145| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_35184| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_34961| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_34855| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_34644| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_34569| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_33632| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_33419| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_33059| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_32948| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_32667| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_32556| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_31680| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_31259| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_30530| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_30465| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_30185| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_29900| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_29015| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_28377| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_28369| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_28136| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_27976| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_27792| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_27734| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_26258| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_26165| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_25748| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_25006| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_24933| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_24744| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_24530| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_23602| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_23082| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_23076| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_22933| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_22408| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_22371| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21708| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21671| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21133| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21107| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_20737| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_20572| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_19574| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_19433| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_18666| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_17812| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_17809| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_17259| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_17176| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_16930| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_16732| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_16453| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_15769| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_15576| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_15019| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_14967| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_14861| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_14376| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_14280| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_14068| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_12970| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_12483| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_12400| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_11534| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_11286| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_11221| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_10946| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_10173| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_9717| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_9609| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_9186| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_9181| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8946| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8892| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8840| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8665| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8650| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8602| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8412| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8098| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_7942| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_7762| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_7701| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_6381| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_5634| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_5583| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_5352| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_4816| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_4803| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_4739| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_4616| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_4498| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_4379| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_3983| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_3821| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_3004| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_2988| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_2927| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_2917| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_2901| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_2472| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_2187| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_2000| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1929| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1735| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1566| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1545| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1521| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1469| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1412| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1338| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1265| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_756| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_338| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_305| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_300| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_251| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_33| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_49591| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_1435| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_55059| Best HMM Match : Orn_Arg_deC_N (HMM E-Value=0) 42 0.001 SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 40 0.004 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 39 0.005 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_41802| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_34775| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_32513| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_32393| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_29655| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_26089| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_24699| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_24687| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_15282| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_6708| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_2276| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 39 0.005 SB_59347| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 39 0.005 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 39 0.005 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_29950| Best HMM Match : A2M_comp (HMM E-Value=7.1) 38 0.009 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_2327| Best HMM Match : HTH_1 (HMM E-Value=6.1e-11) 38 0.016 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 37 0.021 SB_55951| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_55453| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_51471| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_46397| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_27300| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_21455| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_20356| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_16282| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_6959| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_6102| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) 37 0.027 SB_5610| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_2852| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_2781| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_45889| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_45032| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) 37 0.027 SB_43474| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_42098| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_39127| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_25846| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_23237| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_21710| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 36 0.047 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 36 0.047 SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.063 SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 33 0.33 SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.44 SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.44 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.59 SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.59 SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.77 SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.77 SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.77 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 31 1.8 SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) 30 3.1 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 29 4.1 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 29 5.5 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 29 5.5 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 29 5.5 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 200 bits (488), Expect = 1e-51 Identities = 89/100 (89%), Positives = 90/100 (90%) Frame = +3 Query: 63 KKARCWRFSIGSAPLTSITKIDAQVRGGXTRQXYKXTXRFPLEAPSCALLFRPCRLPDTC 242 K+ RCWRFSIGSAPLTSITKIDAQVRGG TRQ YK T RFPLEAPSCALLFRPCRLPDTC Sbjct: 107 KRPRCWRFSIGSAPLTSITKIDAQVRGGETRQDYKDTRRFPLEAPSCALLFRPCRLPDTC 166 Query: 243 PPFSLREAWRFLIAHAVGXSVRCXSFAPSWAVCXNPPXQP 362 PPFSLREAWRFLIAHAVG SVRC SFAPSWAVC NPP P Sbjct: 167 PPFSLREAWRFLIAHAVGISVRCRSFAPSWAVCTNPPFSP 206 Score = 44.8 bits (101), Expect = 1e-04 Identities = 30/61 (49%), Positives = 32/61 (52%), Gaps = 2/61 (3%) Frame = +1 Query: 232 RIPVRLSPFGKRGAFS*LTL*VSQFGVG-RSLQAGLCART-PRFSPTAAPYPVTIVLSPT 405 R+P PF R A+ L V RS T P FSPTAAPYPVTIVLSPT Sbjct: 161 RLPDTCPPFSLREAWRFLIAHAVGISVRCRSFAPSWAVCTNPPFSPTAAPYPVTIVLSPT 220 Query: 406 R 408 R Sbjct: 221 R 221 >SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) Length = 347 Score = 159 bits (385), Expect = 4e-39 Identities = 73/89 (82%), Positives = 75/89 (84%) Frame = +3 Query: 63 KKARCWRFSIGSAPLTSITKIDAQVRGGXTRQXYKXTXRFPLEAPSCALLFRPCRLPDTC 242 K+ RCWRFSIGSAPLTSITKIDAQVRGG TRQ YK T RFPLEAPSCALLFRPCRLPDTC Sbjct: 136 KRPRCWRFSIGSAPLTSITKIDAQVRGGETRQDYKDTRRFPLEAPSCALLFRPCRLPDTC 195 Query: 243 PPFSLREAWRFLIAHAVGXSVRCXSFAPS 329 PPFSLREAWRFLIAHAV +F S Sbjct: 196 PPFSLREAWRFLIAHAVAIRTAKKTFQGS 224 >SB_35724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 153 bits (370), Expect = 3e-37 Identities = 68/75 (90%), Positives = 68/75 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAAXXGNRISRARYVGGATEFLKWWPNYGYTRR 527 PP QPDRCALSGNYRLES PV HDLSPLAA GNRISRARYVGGATEFLKWWPNYGYTRR Sbjct: 12 PPVQPDRCALSGNYRLESNPVRHDLSPLAAATGNRISRARYVGGATEFLKWWPNYGYTRR 71 Query: 528 TVXGXCALLKPVTFG 572 TV G CALLKPVTFG Sbjct: 72 TVFGICALLKPVTFG 86 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 124 bits (298), Expect = 1e-28 Identities = 54/59 (91%), Positives = 54/59 (91%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAAXXGNRISRARYVGGATEFLKWWPNYGYTR 524 PP QPDRCALSGNYRLES PV HDLSPLAA GNRISRARYVGGATEFLKWWPNYGYTR Sbjct: 12 PPVQPDRCALSGNYRLESNPVRHDLSPLAAATGNRISRARYVGGATEFLKWWPNYGYTR 70 >SB_25122| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 71.7 bits (168), Expect = 8e-13 Identities = 37/49 (75%), Positives = 38/49 (77%) Frame = -3 Query: 215 EQESARGSFQGETPGXFIXLSGXATSDLSVDFCDARQGGGAYGKTPATR 69 EQESARGS QGET G FI LSG AT+DLSV F DA QGGGAYGKT R Sbjct: 10 EQESARGSRQGETLGIFIVLSGFATTDLSVRFRDACQGGGAYGKTALPR 58 >SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 70.1 bits (164), Expect = 2e-12 Identities = 33/44 (75%), Positives = 34/44 (77%) Frame = +3 Query: 102 PLTSITKIDAQVRGGXTRQXYKXTXRFPLEAPSCALLFRPCRLP 233 PLTSITK DAQ+ GG TRQ YK T RFPL APSCALLF P LP Sbjct: 119 PLTSITKSDAQISGGETRQDYKDTRRFPLAAPSCALLFLPFGLP 162 >SB_34414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 62.1 bits (144), Expect = 6e-10 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 PP QPDRCALSGNYRLES PV HDLSPLAA Sbjct: 12 PPVQPDRCALSGNYRLESKPVRHDLSPLAA 41 >SB_7309| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 62.1 bits (144), Expect = 6e-10 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 PP QPDRCALSGNYRLES PV HDLSPLAA Sbjct: 12 PPVQPDRCALSGNYRLESNPVRHDLSPLAA 41 >SB_1903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 62.1 bits (144), Expect = 6e-10 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 PP QPDRCALSGNYRLES PV HDLSPLAA Sbjct: 12 PPVQPDRCALSGNYRLESNPVRHDLSPLAA 41 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 60.9 bits (141), Expect = 1e-09 Identities = 30/51 (58%), Positives = 32/51 (62%) Frame = +3 Query: 81 RFSIGSAPLTSITKIDAQVRGGXTRQXYKXTXRFPLEAPSCALLFRPCRLP 233 RFSIGSAPLTSITK DAQ+ GG TRQ YK T R C +L P P Sbjct: 150 RFSIGSAPLTSITKSDAQISGGETRQDYKDTRRLHQAGTLCGVLILPFGFP 200 >SB_38053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 60.5 bits (140), Expect = 2e-09 Identities = 31/52 (59%), Positives = 33/52 (63%), Gaps = 1/52 (1%) Frame = +3 Query: 303 VRCXSFAPSWAVCXN-PPXQPDRCALSGNYRLESXPVXHDLSPLAAXXGNRI 455 V+C S C + PP QPDRCALSGNYRLES P DLSPL GNRI Sbjct: 48 VKCKCSMMSNLGCVHEPPVQPDRCALSGNYRLESNPGRPDLSPLGTATGNRI 99 >SB_30985| Best HMM Match : DUF1450 (HMM E-Value=1.5) Length = 599 Score = 51.2 bits (117), Expect = 1e-06 Identities = 25/49 (51%), Positives = 29/49 (59%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAAXXGNRISRARYVGGATEFL 494 PP Q DRCALSGNYRLES P H +PLAA + + + G FL Sbjct: 368 PPVQSDRCALSGNYRLESNPERHAKAPLAAATVDIVLMSCLAGALRSFL 416 >SB_51245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 50.4 bits (115), Expect = 2e-06 Identities = 24/40 (60%), Positives = 25/40 (62%) Frame = +3 Query: 318 FAPSWAVCXNPPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 FA PP Q DRCALSGNYRLES P H +PLAA Sbjct: 3 FASKLDCMHEPPVQSDRCALSGNYRLESNPERHAKAPLAA 42 >SB_54507| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 PP Q DRCALSGNYRLES P H +PLAA Sbjct: 25 PPVQSDRCALSGNYRLESNPERHAKAPLAA 54 >SB_58426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 PP Q DRCALSGNYRLES P H +PLAA Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAA 41 >SB_57366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 PP Q DRCALSGNYRLES P H +PLAA Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAA 41 >SB_56245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 PP Q DRCALSGNYRLES P H +PLAA Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAA 41 >SB_55566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 PP Q DRCALSGNYRLES P H +PLAA Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAA 41 >SB_55077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 PP Q DRCALSGNYRLES P H +PLAA Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAA 41 >SB_53790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 PP Q DRCALSGNYRLES P H +PLAA Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAA 41 >SB_52894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 PP Q DRCALSGNYRLES P H +PLAA Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAA 41 >SB_48533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 PP Q DRCALSGNYRLES P H +PLAA Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAA 41 >SB_47211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 PP Q DRCALSGNYRLES P H +PLAA Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAA 41 >SB_46066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 PP Q DRCALSGNYRLES P H +PLAA Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAA 41 >SB_45109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 PP Q DRCALSGNYRLES P H +PLAA Sbjct: 139 PPVQSDRCALSGNYRLESNPERHAKAPLAA 168 >SB_43715| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 PP Q DRCALSGNYRLES P H +PLAA Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAA 41 >SB_42865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 PP Q DRCALSGNYRLES P H +PLAA Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAA 41 >SB_41269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 PP Q DRCALSGNYRLES P H +PLAA Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAA 41 >SB_40020| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 PP Q DRCALSGNYRLES P H +PLAA Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAA 41 >SB_38531| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 PP Q DRCALSGNYRLES P H +PLAA Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAA 41 >SB_35148| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 PP Q DRCALSGNYRLES P H +PLAA Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAA 41 >SB_31008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 PP Q DRCALSGNYRLES P H +PLAA Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAA 41 >SB_29391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 PP Q DRCALSGNYRLES P H +PLAA Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAA 41 >SB_27738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 49.6 bits (113), Expect = 4e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDL 422 PP QPDRCALSGNYRLES PV H L Sbjct: 12 PPVQPDRCALSGNYRLESNPVRHRL 36 >SB_24808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 PP Q DRCALSGNYRLES P H +PLAA Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAA 41 >SB_23019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 PP Q DRCALSGNYRLES P H +PLAA Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAA 41 >SB_21707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 PP Q DRCALSGNYRLES P H +PLAA Sbjct: 32 PPVQSDRCALSGNYRLESNPERHAKAPLAA 61 >SB_19542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 PP Q DRCALSGNYRLES P H +PLAA Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAA 41 >SB_19098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 PP Q DRCALSGNYRLES P H +PLAA Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAA 41 >SB_19031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 PP Q DRCALSGNYRLES P H +PLAA Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAA 41 >SB_17805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 PP Q DRCALSGNYRLES P H +PLAA Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAA 41 >SB_15695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 PP Q DRCALSGNYRLES P H +PLAA Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAA 41 >SB_12040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 PP Q DRCALSGNYRLES P H +PLAA Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAA 41 >SB_9760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 PP Q DRCALSGNYRLES P H +PLAA Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAA 41 >SB_5267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 PP Q DRCALSGNYRLES P H +PLAA Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAA 41 >SB_3766| Best HMM Match : Moricin (HMM E-Value=5.1) Length = 108 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 PP Q DRCALSGNYRLES P H +PLAA Sbjct: 76 PPVQSDRCALSGNYRLESNPERHAKAPLAA 105 >SB_1707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 PP Q DRCALSGNYRLES P H +PLAA Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAA 41 >SB_1382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 PP Q DRCALSGNYRLES P H +PLAA Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAA 41 >SB_1275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXPVXHDLSPLAA 437 PP Q DRCALSGNYRLES P H +PLAA Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAA 41 >SB_25376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 34 Score = 46.8 bits (106), Expect = 3e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 293 YSVSYEKAPRFPKGERRTGI 234 YSVSYEKAPRFPKGERRTGI Sbjct: 14 YSVSYEKAPRFPKGERRTGI 33 >SB_52929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 35 Score = 45.6 bits (103), Expect = 6e-05 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = +3 Query: 360 PDRCALSGNYRLESXPVXHDLSPLAA 437 PDRCALSGNYRLES P H +PLAA Sbjct: 8 PDRCALSGNYRLESNPERHAKAPLAA 33 >SB_12752| Best HMM Match : Borrelia_orfA (HMM E-Value=0.15) Length = 1774 Score = 44.8 bits (101), Expect = 1e-04 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = -3 Query: 158 LSGXATSDLSVDFCDARQGGGAYGKTPATR 69 LSG AT+DLSV F DA QGGGAYGKT R Sbjct: 352 LSGFATTDLSVRFRDACQGGGAYGKTALPR 381 >SB_10421| Best HMM Match : Guanylate_cyc (HMM E-Value=0) Length = 1485 Score = 44.8 bits (101), Expect = 1e-04 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = -3 Query: 158 LSGXATSDLSVDFCDARQGGGAYGKTPATR 69 LSG AT+DLSV F DA QGGGAYGKT R Sbjct: 1187 LSGFATTDLSVRFRDACQGGGAYGKTALPR 1216 >SB_8415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 44.8 bits (101), Expect = 1e-04 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = -3 Query: 158 LSGXATSDLSVDFCDARQGGGAYGKTPATR 69 LSG AT+DLSV F DA QGGGAYGKT R Sbjct: 2 LSGFATTDLSVRFRDACQGGGAYGKTALPR 31 >SB_58224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_55737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_54286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_54219| Best HMM Match : Toxin_8 (HMM E-Value=8.1) Length = 75 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 56 PPVQPDRCALSGNYRLESNP 75 >SB_41217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_38325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_17471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_16089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_9623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_59708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_59685| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_59589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_59479| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_58142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_57899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_57889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_57793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_57693| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_57320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_55905| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_55790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_55716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_55631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_55333| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_55090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_54702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_54683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_54384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_53884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 45 PPVQPDRCALSGNYRLESNP 64 >SB_53624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_53241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_52402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_51349| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_51271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_50626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_49587| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_49375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_49357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_49260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_49181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_48829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_48601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_48323| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_48037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_47484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_47382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_47359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_47312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_46998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_46785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_46606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_46553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_46274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_46222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_46158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_45670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_45556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_45238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_44797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_44462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_43465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_42828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_42781| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_42533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_42195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_41845| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_40938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_39214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_38586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_38311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_37725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_37267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_37229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_36145| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_35184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_34961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_34855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_34644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_34569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_33632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_33419| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_33059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_32948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_32667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_32556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_31680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_31259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_30530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_30465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_30185| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_29900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_29015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_28377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_28369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_28136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_27976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_27792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_27734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_26258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_26165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_25748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_25006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_24933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_24744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_24530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_23602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_23082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_23076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_22933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_22408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_22371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_21708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_21671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_21133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_21107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_20737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_20572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_19574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_19433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_18666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_17812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_17809| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_17259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_17176| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_16930| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_16732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_16453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_15769| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_15576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_15019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_14967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_14861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_14376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_14280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_14068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_12970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_12483| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_12400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_11534| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_11286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_11221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_10946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_10173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_9717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_9609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_9186| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_9181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_8946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_8892| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_8840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_8665| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_8650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_8602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_8412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_8098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_7942| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_7762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_7701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_6381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 27 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 8 PPVQPDRCALSGNYRLESNP 27 >SB_5634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_5583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_5352| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_4816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_4803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_4739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_4616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_4498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_4379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_3983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_3821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_3004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_2988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_2927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_2917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_2901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_2472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_2187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_2000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_1929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_1735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_1566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_1545| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_1521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_1469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_1412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_1338| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_1265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_338| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_33| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLES P Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -3 Query: 158 LSGXATSDLSVDFCDARQGGGAYGKT 81 LSG AT+DLSV F DA QGGGAYGKT Sbjct: 2 LSGFATTDLSVRFRDACQGGGAYGKT 27 >SB_49591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = +3 Query: 348 PPXQPDRCALSGNYRLESXP 407 PP QPDRCALSGNYRLE P Sbjct: 12 PPVQPDRCALSGNYRLEVHP 31 >SB_1435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 41.9 bits (94), Expect = 7e-04 Identities = 20/28 (71%), Positives = 20/28 (71%) Frame = +1 Query: 322 LQAGLCARTPRFSPTAAPYPVTIVLSPT 405 LQ P FSPTAAPYPVTIVLSPT Sbjct: 35 LQVDSRGSPPPFSPTAAPYPVTIVLSPT 62 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,896,865 Number of Sequences: 59808 Number of extensions: 363600 Number of successful extensions: 1736 Number of sequences better than 10.0: 389 Number of HSP's better than 10.0 without gapping: 1166 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1444 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2752873431 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -