BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_H18 (953 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC890.08 |rpl31||60S ribosomal protein L31|Schizosaccharomyces... 114 2e-26 SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac... 23 2.7 SPAC105.01c |||potassium ion/proton antiporter|Schizosaccharomyc... 27 2.9 SPAC1F8.03c |str3||siderophore-iron transporter Str3 |Schizosacc... 27 3.9 SPCC306.09c |cap1|cap|adenylyl cyclase-associated protein Cap1|S... 23 4.0 SPBPB8B6.02c |||urea transporter |Schizosaccharomyces pombe|chr ... 26 9.0 >SPAC890.08 |rpl31||60S ribosomal protein L31|Schizosaccharomyces pombe|chr 1|||Manual Length = 113 Score = 114 bits (274), Expect = 2e-26 Identities = 56/102 (54%), Positives = 73/102 (71%) Frame = +3 Query: 126 KSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKFLW 305 KSAIN+VVTR+YT+++HKRL+GV FKKRAPRAIKEI FA+K M T ++RVD LNK +W Sbjct: 6 KSAINQVVTRDYTIHMHKRLYGVSFKKRAPRAIKEIVAFAQKHMQTKEVRVDPSLNKEVW 65 Query: 306 SKGVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIK 431 +G+RNVP +D++D A L+T V V VA+ K Sbjct: 66 KRGIRNVPHRLRLRLSRKRSDEDDKA--LYTYVQAVDVANPK 105 >SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 2363 Score = 23.4 bits (48), Expect(2) = 2.7 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +1 Query: 700 PXSPPPPPP 726 P PPPPPP Sbjct: 21 PSQPPPPPP 29 Score = 22.2 bits (45), Expect(2) = 2.7 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +1 Query: 691 PXXPXSPPPPP 723 P P PPPPP Sbjct: 6 PGNPPPPPPPP 16 >SPAC105.01c |||potassium ion/proton antiporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 898 Score = 27.5 bits (58), Expect = 2.9 Identities = 19/62 (30%), Positives = 28/62 (45%) Frame = -2 Query: 274 RMSGVPICFSANFRISLIALGARFLNPTP*SRLCKLTVYSRVTTSFMADLPFLSPLGLAI 95 R+ +P+ F R+ +G L PT R+ K Y TS M L +S LGL + Sbjct: 45 RLIHIPLSFLQQPRVIAEIIGGIVLGPTVMGRIPKFLDYI-FPTSSMGPLNLVSNLGLVL 103 Query: 94 VI 89 + Sbjct: 104 FL 105 >SPAC1F8.03c |str3||siderophore-iron transporter Str3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 630 Score = 27.1 bits (57), Expect = 3.9 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -1 Query: 299 EFV*ASVYSNVRSSHLFFSELSDFFDCSWGTLFKSNTMKSF 177 E V S+Y N R +L ++ CSW + +S+T S+ Sbjct: 68 EAVRDSIYQNKRGMYLAYAFGIAILACSWASAIQSSTTYSY 108 >SPCC306.09c |cap1|cap|adenylyl cyclase-associated protein Cap1|Schizosaccharomyces pombe|chr 3|||Manual Length = 551 Score = 23.0 bits (47), Expect(2) = 4.0 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +1 Query: 700 PXSPPPPPP 726 P PPPPPP Sbjct: 306 PPPPPPPPP 314 Score = 22.2 bits (45), Expect(2) = 4.0 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +1 Query: 709 PPPPPPXXXXFF 744 PPPPPP F+ Sbjct: 308 PPPPPPPSNDFW 319 >SPBPB8B6.02c |||urea transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 673 Score = 25.8 bits (54), Expect = 9.0 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -2 Query: 475 GVYSWLASTFSVCKPLID 422 GV WLAST+S C +++ Sbjct: 464 GVVCWLASTYSFCDGIVN 481 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,657,355 Number of Sequences: 5004 Number of extensions: 44016 Number of successful extensions: 114 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 78 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 99 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 487313384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -