BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_H18 (953 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z82077-3|CAB63331.1| 122|Caenorhabditis elegans Hypothetical pr... 157 8e-39 Z82077-4|CAB63332.1| 70|Caenorhabditis elegans Hypothetical pr... 85 5e-17 AC006638-2|AAK85481.1| 1256|Caenorhabditis elegans Cyclase assoc... 26 2.4 AC006638-1|AAK85482.1| 495|Caenorhabditis elegans Cyclase assoc... 26 2.6 >Z82077-3|CAB63331.1| 122|Caenorhabditis elegans Hypothetical protein W09C5.6a protein. Length = 122 Score = 157 bits (382), Expect = 8e-39 Identities = 70/120 (58%), Positives = 90/120 (75%) Frame = +3 Query: 105 PKGERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDT 284 PK E+K +S INEVVTREYT+++H R+ G+G KKRAPRAI EI+KFA+ QM T D+RVDT Sbjct: 3 PKNEKKSRSTINEVVTREYTIHIHARIRGIGSKKRAPRAIDEIKKFAKIQMKTNDVRVDT 62 Query: 285 RLNKFLWSKGVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTENVDASQ 464 +LNKF+WSKG++NVP+ N+DEDSA KL+TL TYVP + GL NVD+ + Sbjct: 63 KLNKFIWSKGIKNVPYRVRVRLSRRRNEDEDSAQKLYTLCTYVPCTNFHGLTNVNVDSEE 122 >Z82077-4|CAB63332.1| 70|Caenorhabditis elegans Hypothetical protein W09C5.6b protein. Length = 70 Score = 85.4 bits (202), Expect = 5e-17 Identities = 37/70 (52%), Positives = 48/70 (68%) Frame = +3 Query: 255 MGTPDIRVDTRLNKFLWSKGVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKG 434 M T D+RVDT+LNKF+WSKG++NVP+ N+DEDSA KL+TL TYVP + G Sbjct: 1 MKTNDVRVDTKLNKFIWSKGIKNVPYRVRVRLSRRRNEDEDSAQKLYTLCTYVPCTNFHG 60 Query: 435 LQTENVDASQ 464 L NVD+ + Sbjct: 61 LTNVNVDSEE 70 >AC006638-2|AAK85481.1| 1256|Caenorhabditis elegans Cyclase associated protein homologprotein 1, isoform a protein. Length = 1256 Score = 25.8 bits (54), Expect(2) = 2.4 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +1 Query: 664 AXAXFVXXXPXXPXSPPPPPP 726 A A P P PPPPPP Sbjct: 997 AAAPSAPKAPAGPGGPPPPPP 1017 Score = 22.6 bits (46), Expect(2) = 2.4 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +1 Query: 709 PPPPPPXXXXFFXXXP 756 PPPPPP F P Sbjct: 1014 PPPPPPPADFFANIAP 1029 >AC006638-1|AAK85482.1| 495|Caenorhabditis elegans Cyclase associated protein homologprotein 1, isoform b protein. Length = 495 Score = 25.8 bits (54), Expect(2) = 2.6 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +1 Query: 664 AXAXFVXXXPXXPXSPPPPPP 726 A A P P PPPPPP Sbjct: 236 AAAPSAPKAPAGPGGPPPPPP 256 Score = 22.6 bits (46), Expect(2) = 2.6 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +1 Query: 709 PPPPPPXXXXFFXXXP 756 PPPPPP F P Sbjct: 253 PPPPPPPADFFANIAP 268 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,407,908 Number of Sequences: 27780 Number of extensions: 270773 Number of successful extensions: 1552 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 830 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1387 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2475644248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -