BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_H16 (1010 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p pro... 41 0.003 BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p pro... 41 0.003 U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino pro... 40 0.004 BT004476-1|AAO42640.1| 286|Drosophila melanogaster LP07342p pro... 40 0.004 AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p pro... 40 0.004 AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p pro... 40 0.004 AY113557-1|AAM29562.1| 93|Drosophila melanogaster RH06401p pro... 40 0.004 AJ271041-1|CAB66004.1| 286|Drosophila melanogaster Gly-rich pro... 40 0.004 AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA... 40 0.004 AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB... 40 0.004 AE014297-4048|AAF56656.1| 286|Drosophila melanogaster CG5812-PA... 40 0.004 AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA,... 40 0.004 AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB,... 40 0.004 AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD,... 40 0.004 AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC,... 40 0.004 X05285-1|CAA28903.1| 147|Drosophila melanogaster fibrillarin pr... 40 0.007 BT021407-1|AAX33555.1| 720|Drosophila melanogaster LD06749p pro... 40 0.007 AF162774-1|AAF68853.2| 720|Drosophila melanogaster Nopp140-like... 40 0.007 AE014296-3628|AAF51788.3| 720|Drosophila melanogaster CG7421-PA... 40 0.007 AE013599-3536|AAF46950.1| 344|Drosophila melanogaster CG9888-PA... 40 0.007 U13178-1|AAA86955.1| 404|Drosophila melanogaster RNA binding pr... 39 0.010 M15765-1|AAA70425.1| 365|Drosophila melanogaster unknown protei... 39 0.010 L37083-1|AAC41563.1| 404|Drosophila melanogaster RNA binding pr... 39 0.010 BT022850-1|AAY55266.1| 538|Drosophila melanogaster IP13040p pro... 39 0.013 AE013599-1243|AAF58688.1| 610|Drosophila melanogaster CG13214-P... 39 0.013 AY070576-1|AAL48047.1| 527|Drosophila melanogaster RE12101p pro... 38 0.017 AE014297-4274|AAO41609.1| 494|Drosophila melanogaster CG1520-PC... 38 0.017 AE014297-4273|AAN14303.1| 527|Drosophila melanogaster CG1520-PB... 38 0.017 AE014297-4272|AAF56819.1| 527|Drosophila melanogaster CG1520-PA... 38 0.017 BT001738-1|AAN71493.1| 331|Drosophila melanogaster RE72617p pro... 38 0.022 AE014296-3444|AAF51657.1| 98|Drosophila melanogaster CG11458-P... 38 0.029 AE014296-2897|AAF49349.4| 926|Drosophila melanogaster CG13731-P... 38 0.029 X71975-1|CAA50795.1| 239|Drosophila melanogaster GCR 101 protein. 36 0.067 AY075501-1|AAO39496.1| 299|Drosophila melanogaster RE52135p pro... 36 0.067 AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p pro... 36 0.067 AE014298-2542|AAF48711.1| 133|Drosophila melanogaster CG5172-PA... 36 0.067 AE014298-2541|AAS65393.1| 95|Drosophila melanogaster CG5172-PB... 36 0.067 AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA... 36 0.067 AE013599-3129|AAF46672.1| 237|Drosophila melanogaster CG4038-PA... 36 0.067 BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p pro... 36 0.089 AL031366-1|CAA20520.1| 809|Drosophila melanogaster EG:100G7.6 p... 36 0.089 AE014298-3143|AAF50813.1| 183|Drosophila melanogaster CG10918-P... 36 0.089 AE014298-475|AAF45833.2| 887|Drosophila melanogaster CG3588-PB,... 36 0.089 AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA... 36 0.089 U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous pro... 36 0.12 BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p pro... 36 0.12 BT011463-1|AAR99121.1| 212|Drosophila melanogaster RE25907p pro... 36 0.12 AY113383-1|AAM29388.1| 242|Drosophila melanogaster RE04770p pro... 36 0.12 AE014296-227|AAF47476.2| 242|Drosophila melanogaster CG9184-PA,... 36 0.12 AE014296-226|AAN11471.1| 212|Drosophila melanogaster CG9184-PB,... 36 0.12 AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB... 36 0.12 AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA... 36 0.12 AE014298-9|AAX52465.1| 193|Drosophila melanogaster CG13376-PA p... 35 0.20 AE014296-862|AAF47912.1| 707|Drosophila melanogaster CG13722-PA... 35 0.20 AE014134-733|AAO41157.1| 579|Drosophila melanogaster CG33003-PA... 35 0.20 BT003564-1|AAO39568.1| 468|Drosophila melanogaster LP03989p pro... 34 0.27 AY089515-1|AAL90253.1| 468|Drosophila melanogaster GM01350p pro... 34 0.27 AE014297-1625|AAF54898.1| 460|Drosophila melanogaster CG11670-P... 34 0.27 AE014297-1281|AAF54625.1| 468|Drosophila melanogaster CG5214-PA... 34 0.27 BT025941-1|ABG02185.1| 207|Drosophila melanogaster IP14143p pro... 34 0.36 BT025938-1|ABG02182.1| 207|Drosophila melanogaster IP14043p pro... 34 0.36 AY069683-1|AAL39828.1| 993|Drosophila melanogaster LD45449p pro... 34 0.36 AE014298-2035|AAF48374.1| 993|Drosophila melanogaster CG9411-PA... 34 0.36 AE014134-759|AAF50995.3| 1118|Drosophila melanogaster CG15635-PA... 34 0.36 BT028801-1|ABI34182.1| 286|Drosophila melanogaster LP21747p pro... 33 0.47 BT004875-1|AAO45231.1| 399|Drosophila melanogaster LD22761p pro... 33 0.47 AE014298-2351|AAN09389.1| 399|Drosophila melanogaster CG3606-PB... 33 0.47 AE014298-2350|AAF48578.2| 399|Drosophila melanogaster CG3606-PA... 33 0.47 AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-P... 33 0.63 AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. 33 0.63 DQ539309-1|ABG02830.1| 342|Drosophila melanogaster CG17108 prot... 33 0.83 DQ539308-1|ABG02829.1| 342|Drosophila melanogaster CG17108 prot... 33 0.83 DQ539307-1|ABG02828.1| 342|Drosophila melanogaster CG17108 prot... 33 0.83 DQ539306-1|ABG02827.1| 342|Drosophila melanogaster CG17108 prot... 33 0.83 DQ539305-1|ABG02826.1| 342|Drosophila melanogaster CG17108 prot... 33 0.83 DQ539304-1|ABG02825.1| 342|Drosophila melanogaster CG17108 prot... 33 0.83 DQ539303-1|ABG02824.1| 342|Drosophila melanogaster CG17108 prot... 33 0.83 DQ539302-1|ABG02823.1| 342|Drosophila melanogaster CG17108 prot... 33 0.83 DQ539301-1|ABG02822.1| 342|Drosophila melanogaster CG17108 prot... 33 0.83 DQ539300-1|ABG02821.1| 342|Drosophila melanogaster CG17108 prot... 33 0.83 DQ539299-1|ABG02820.1| 342|Drosophila melanogaster CG17108 prot... 33 0.83 DQ539298-1|ABG02819.1| 342|Drosophila melanogaster CG17108 prot... 33 0.83 DQ539297-1|ABG02818.1| 342|Drosophila melanogaster CG17108 prot... 33 0.83 DQ539296-1|ABG02817.1| 342|Drosophila melanogaster CG17108 prot... 33 0.83 DQ539295-1|ABG02816.1| 342|Drosophila melanogaster CG17108 prot... 33 0.83 DQ539294-1|ABG02815.1| 342|Drosophila melanogaster CG17108 prot... 33 0.83 DQ539293-1|ABG02814.1| 342|Drosophila melanogaster CG17108 prot... 33 0.83 DQ539292-1|ABG02813.1| 342|Drosophila melanogaster CG17108 prot... 33 0.83 DQ539291-1|ABG02812.1| 342|Drosophila melanogaster CG17108 prot... 33 0.83 DQ539290-1|ABG02811.1| 342|Drosophila melanogaster CG17108 prot... 33 0.83 DQ539289-1|ABG02810.1| 342|Drosophila melanogaster CG17108 prot... 33 0.83 DQ539288-1|ABG02809.1| 342|Drosophila melanogaster CG17108 prot... 33 0.83 DQ539287-1|ABG02808.1| 342|Drosophila melanogaster CG17108 prot... 33 0.83 DQ539286-1|ABG02807.1| 342|Drosophila melanogaster CG17108 prot... 33 0.83 DQ539285-1|ABG02806.1| 342|Drosophila melanogaster CG17108 prot... 33 0.83 DQ539284-1|ABG02805.1| 342|Drosophila melanogaster CG17108 prot... 33 0.83 DQ539283-1|ABG02804.1| 342|Drosophila melanogaster CG17108 prot... 33 0.83 DQ539282-1|ABG02803.1| 342|Drosophila melanogaster CG17108 prot... 33 0.83 DQ539281-1|ABG02802.1| 342|Drosophila melanogaster CG17108 prot... 33 0.83 BT030113-1|ABN49252.1| 342|Drosophila melanogaster IP06991p pro... 33 0.83 BT011144-1|AAR82812.1| 356|Drosophila melanogaster GH24939p pro... 33 0.83 AE014297-3551|AAF56299.2| 290|Drosophila melanogaster CG13615-P... 33 0.83 AE014134-1932|AAF52992.1| 342|Drosophila melanogaster CG17108-P... 33 0.83 AE013599-1244|AAS64915.1| 253|Drosophila melanogaster CG13214-P... 33 0.83 X73134-1|CAA51651.1| 127|Drosophila melanogaster GCR 20 protein. 32 1.1 AY075448-1|AAL68261.2| 218|Drosophila melanogaster RE09269p pro... 32 1.1 AY070976-1|AAL48598.1| 127|Drosophila melanogaster RE07460p pro... 32 1.1 AE014298-2797|AAF48914.2| 193|Drosophila melanogaster CG14191-P... 32 1.1 AE014297-1701|AAF54959.1| 127|Drosophila melanogaster CG9757-PA... 32 1.1 X71974-1|CAA50794.1| 196|Drosophila melanogaster GCR 17 protein. 32 1.4 AY119556-1|AAM50210.1| 1272|Drosophila melanogaster GH28840p pro... 32 1.4 AY071088-1|AAL48710.1| 173|Drosophila melanogaster RE15531p pro... 32 1.4 AY069304-1|AAL39449.1| 587|Drosophila melanogaster HL07962p pro... 32 1.4 AE014298-2545|AAF48713.1| 173|Drosophila melanogaster CG10598-P... 32 1.4 AE014298-2544|AAN09437.1| 230|Drosophila melanogaster CG10598-P... 32 1.4 AE014298-2543|AAF48712.2| 237|Drosophila melanogaster CG12997-P... 32 1.4 AE014298-1675|AAF48083.2| 587|Drosophila melanogaster CG1841-PB... 32 1.4 AE014298-1674|AAN09296.1| 587|Drosophila melanogaster CG1841-PA... 32 1.4 AE014298-1554|AAF48000.3| 3539|Drosophila melanogaster CG11122-P... 32 1.4 AE014297-3695|AAF56384.1| 208|Drosophila melanogaster CG11786-P... 32 1.4 AE014296-852|AAF47904.2| 242|Drosophila melanogaster CG11345-PA... 32 1.4 BT023900-1|ABA81834.1| 1576|Drosophila melanogaster LP13775p pro... 31 1.9 BT011530-1|AAS15666.1| 145|Drosophila melanogaster RE20733p pro... 31 1.9 BT003654-1|AAO39658.1| 1273|Drosophila melanogaster AT04875p pro... 31 1.9 BT003208-1|AAO24963.1| 478|Drosophila melanogaster SD23764p pro... 31 1.9 AY118781-1|AAM50641.1| 117|Drosophila melanogaster GH13168p pro... 31 1.9 AY058341-1|AAL13570.1| 1024|Drosophila melanogaster GH11706p pro... 31 1.9 AE014297-3096|AAF55954.1| 117|Drosophila melanogaster CG5778-PA... 31 1.9 AE014297-1806|AAF55026.1| 1024|Drosophila melanogaster CG14355-P... 31 1.9 AE013599-2439|AAM68499.1| 145|Drosophila melanogaster CG30458-P... 31 1.9 AE013599-1871|AAF58260.1| 856|Drosophila melanogaster CG13942-P... 31 1.9 AE013599-1621|AAF58436.2| 478|Drosophila melanogaster CG3884-PA... 31 1.9 AE014297-2648|AAF55656.1| 555|Drosophila melanogaster CG14280-P... 31 2.5 U21123-1|AAA85120.1| 684|Drosophila melanogaster ena polypeptid... 31 3.3 M83931-1|AAB04680.1| 1595|Drosophila melanogaster son of sevenle... 31 3.3 M77501-1|AAA28904.1| 1596|Drosophila melanogaster son of sevenle... 31 3.3 DQ991915-1|ABJ09588.1| 2176|Drosophila melanogaster eyes shut pr... 31 3.3 DQ780942-1|ABH07112.1| 2165|Drosophila melanogaster spacemaker p... 31 3.3 BT011407-1|AAR96199.1| 669|Drosophila melanogaster AT20168p pro... 31 3.3 BT004488-1|AAO42652.1| 687|Drosophila melanogaster LD23655p pro... 31 3.3 BT003571-1|AAO39575.1| 285|Drosophila melanogaster LD41821p pro... 31 3.3 BT001610-1|AAN71365.1| 279|Drosophila melanogaster RE31819p pro... 31 3.3 AY084210-1|AAL89948.1| 831|Drosophila melanogaster SD08336p pro... 31 3.3 AY084171-1|AAL89909.1| 286|Drosophila melanogaster RE40851p pro... 31 3.3 AY069106-1|AAL39251.1| 763|Drosophila melanogaster GH12404p pro... 31 3.3 AE014298-1193|AAF46385.1| 679|Drosophila melanogaster CG33181-P... 31 3.3 AE014297-3971|AAN14080.1| 279|Drosophila melanogaster CG6447-PB... 31 3.3 AE014297-3970|AAF56603.2| 285|Drosophila melanogaster CG6447-PA... 31 3.3 AE014297-3969|AAF56602.1| 286|Drosophila melanogaster CG6478-PA... 31 3.3 AE014297-450|ABI31144.1| 669|Drosophila melanogaster CG33097-PB... 31 3.3 AE014297-449|AAF54130.2| 763|Drosophila melanogaster CG33097-PA... 31 3.3 AE014134-2404|AAF53336.2| 1596|Drosophila melanogaster CG7793-PA... 31 3.3 AE014134-390|AAZ83988.1| 1984|Drosophila melanogaster CG33955-PB... 31 3.3 AE013599-3071|AAF46625.1| 239|Drosophila melanogaster CG15225-P... 31 3.3 AE013599-2829|AAM68439.1| 829|Drosophila melanogaster CG15112-P... 31 3.3 AE013599-2828|AAX52697.1| 684|Drosophila melanogaster CG15112-P... 31 3.3 AE013599-2827|AAM68438.2| 684|Drosophila melanogaster CG15112-P... 31 3.3 AE013599-2826|AAF57598.2| 684|Drosophila melanogaster CG15112-P... 31 3.3 AE013599-2825|AAX52696.1| 687|Drosophila melanogaster CG15112-P... 31 3.3 BT016162-1|AAV37047.1| 702|Drosophila melanogaster AT08270p pro... 30 4.4 BT015282-1|AAT94511.1| 1250|Drosophila melanogaster LD04601p pro... 30 4.4 BT012315-1|AAS77440.1| 385|Drosophila melanogaster LD32727p pro... 30 4.4 BT003763-1|AAO41442.1| 652|Drosophila melanogaster RE39251p pro... 30 4.4 AY119041-1|AAM50901.1| 393|Drosophila melanogaster LP06455p pro... 30 4.4 AY113490-1|AAM29495.1| 158|Drosophila melanogaster RE47308p pro... 30 4.4 AY069625-1|AAL39770.1| 268|Drosophila melanogaster LD39545p pro... 30 4.4 AF255733-1|AAF71288.1| 1250|Drosophila melanogaster DNA topoisom... 30 4.4 AE014298-1899|AAF48264.2| 158|Drosophila melanogaster CG1987-PA... 30 4.4 AE014297-1716|AAF54967.1| 385|Drosophila melanogaster CG12749-P... 30 4.4 AE014297-1715|AAN13574.1| 325|Drosophila melanogaster CG12749-P... 30 4.4 AE014297-416|AAF51905.3| 393|Drosophila melanogaster CG10303-PA... 30 4.4 AE014296-964|AAN12098.1| 682|Drosophila melanogaster CG10625-PC... 30 4.4 AE014296-963|AAF50773.2| 682|Drosophila melanogaster CG10625-PB... 30 4.4 AE014296-962|AAN12097.1| 268|Drosophila melanogaster CG10625-PD... 30 4.4 AE014296-961|AAN12096.1| 268|Drosophila melanogaster CG10625-PA... 30 4.4 AE014134-3114|AAF53813.2| 1250|Drosophila melanogaster CG10123-P... 30 4.4 AE013599-2521|AAF57825.3| 702|Drosophila melanogaster CG11423-P... 30 4.4 X62638-1|CAA44504.1| 345|Drosophila melanogaster hrp40.2 protein. 30 5.8 U18130-1|AAC46512.1| 1047|Drosophila melanogaster masquerade pro... 30 5.8 AY118423-1|AAM48452.1| 263|Drosophila melanogaster RH04014p pro... 30 5.8 AY051568-1|AAK92992.1| 263|Drosophila melanogaster GH21518p pro... 30 5.8 AM412918-1|CAL85541.1| 178|Drosophila melanogaster CG16743 prot... 30 5.8 AM294881-1|CAL26867.1| 158|Drosophila melanogaster CG10853 prot... 30 5.8 AM294880-1|CAL26866.1| 158|Drosophila melanogaster CG10853 prot... 30 5.8 AM294879-1|CAL26865.1| 158|Drosophila melanogaster CG10853 prot... 30 5.8 AM294876-1|CAL26862.1| 158|Drosophila melanogaster CG10853 prot... 30 5.8 AM294875-1|CAL26861.1| 158|Drosophila melanogaster CG10853 prot... 30 5.8 AM294874-1|CAL26860.1| 158|Drosophila melanogaster CG10853 prot... 30 5.8 AE014298-1529|AAF47983.2| 2602|Drosophila melanogaster CG2174-PA... 30 5.8 AE014298-1528|ABI30975.1| 2693|Drosophila melanogaster CG2174-PB... 30 5.8 AE014297-2841|AAF55795.1| 263|Drosophila melanogaster CG4000-PA... 30 5.8 AE013599-2048|AAF58145.1| 532|Drosophila melanogaster CG16801-P... 30 5.8 AE013599-2047|AAM68536.1| 744|Drosophila melanogaster CG16801-P... 30 5.8 X71976-1|CAA50796.1| 188|Drosophila melanogaster GCR 1 protein ... 29 7.7 U54982-2|AAC16666.1| 1262|Drosophila melanogaster stn-B protein. 29 7.7 BT021242-1|AAX33390.1| 1011|Drosophila melanogaster RE67944p pro... 29 7.7 BT011172-1|AAR88533.1| 1262|Drosophila melanogaster RH38069p pro... 29 7.7 BT003283-1|AAO25040.1| 178|Drosophila melanogaster HL05737p pro... 29 7.7 BT001384-1|AAN71139.1| 178|Drosophila melanogaster GH03391p pro... 29 7.7 AY119164-1|AAM51024.1| 192|Drosophila melanogaster RH23514p pro... 29 7.7 AY119132-1|AAM50992.1| 188|Drosophila melanogaster RE35358p pro... 29 7.7 AY118439-1|AAM48468.1| 1114|Drosophila melanogaster RH61354p pro... 29 7.7 AY118420-1|AAM48449.1| 250|Drosophila melanogaster RE74758p pro... 29 7.7 AY094783-1|AAM11136.1| 118|Drosophila melanogaster LD12750p pro... 29 7.7 AY089614-1|AAL90352.1| 417|Drosophila melanogaster RE28792p pro... 29 7.7 AY075564-1|AAL68371.1| 161|Drosophila melanogaster RH68528p pro... 29 7.7 AY075468-1|AAL68280.1| 127|Drosophila melanogaster RE28280p pro... 29 7.7 AY071607-1|AAL49229.1| 174|Drosophila melanogaster RE65554p pro... 29 7.7 AY060989-1|AAL28537.1| 222|Drosophila melanogaster GM14833p pro... 29 7.7 AM412919-1|CAL85542.1| 181|Drosophila melanogaster CG16743 prot... 29 7.7 AM412917-1|CAL85540.1| 181|Drosophila melanogaster CG16743 prot... 29 7.7 AL031640-2|CAA21052.1| 979|Drosophila melanogaster EG:114D9.2 p... 29 7.7 AF314193-1|AAK00302.1| 3109|Drosophila melanogaster Toutatis pro... 29 7.7 AE014298-3231|ABI31012.1| 1260|Drosophila melanogaster CG12473-P... 29 7.7 AE014298-3230|EAA46059.2| 1260|Drosophila melanogaster CG12473-P... 29 7.7 AE014298-1712|AAF48112.1| 118|Drosophila melanogaster CG1840-PA... 29 7.7 AE014298-174|AAF45600.2| 1114|Drosophila melanogaster CG14622-PA... 29 7.7 AE014298-173|AAN09040.1| 1153|Drosophila melanogaster CG14622-PB... 29 7.7 AE014298-172|AAF45601.2| 1455|Drosophila melanogaster CG14622-PC... 29 7.7 AE014297-4805|AAF57194.1| 188|Drosophila melanogaster CG2150-PA... 29 7.7 AE014297-2366|AAF55430.3| 787|Drosophila melanogaster CG5836-PA... 29 7.7 AE014297-1707|AAS65146.1| 178|Drosophila melanogaster CG16901-P... 29 7.7 AE014297-1706|AAF54963.2| 344|Drosophila melanogaster CG16901-P... 29 7.7 AE014296-1850|AAF50135.2| 250|Drosophila melanogaster CG12523-P... 29 7.7 AE014134-1996|AAF53039.1| 192|Drosophila melanogaster CG16743-P... 29 7.7 AE014134-1931|AAF52991.1| 127|Drosophila melanogaster CG7294-PA... 29 7.7 AE014134-1930|AAF52990.2| 161|Drosophila melanogaster CG7296-PA... 29 7.7 AE013599-1322|AAF58638.2| 3080|Drosophila melanogaster CG10897-P... 29 7.7 >BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p protein. Length = 1153 Score = 40.7 bits (91), Expect = 0.003 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPP--XXXPPXXPPXP 964 P P P PP P PP PP P P PPP PP PP P Sbjct: 580 PPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAP 635 Score = 32.7 bits (71), Expect = 0.83 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 866 PXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P PPP P P PP PP PP P Sbjct: 575 PHAVAPPPPPPPPPLPAFVAPPPPPPPPPPPPP 607 Score = 32.7 bits (71), Expect = 0.83 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 824 HPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 H PP P P PPP P P PP PP P P Sbjct: 576 HAVAPPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAP 628 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P P P PP PPP P P P PP P Sbjct: 597 PPPPPPPPPPPMANYGAPPPPPP----PPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSAS 652 Query: 980 P 982 P Sbjct: 653 P 653 >BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p protein. Length = 1286 Score = 40.7 bits (91), Expect = 0.003 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPP--XXXPPXXPPXP 964 P P P PP P PP PP P P PPP PP PP P Sbjct: 713 PPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAP 768 Score = 32.7 bits (71), Expect = 0.83 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 866 PXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P PPP P P PP PP PP P Sbjct: 708 PHAVAPPPPPPPPPLPAFVAPPPPPPPPPPPPP 740 Score = 32.7 bits (71), Expect = 0.83 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 824 HPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 H PP P P PPP P P PP PP P P Sbjct: 709 HAVAPPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAP 761 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P P P PP PPP P P P PP P Sbjct: 730 PPPPPPPPPPPMANYGAPPPPPP----PPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSAS 785 Query: 980 P 982 P Sbjct: 786 P 786 >U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino protein. Length = 1058 Score = 40.3 bits (90), Expect = 0.004 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPP--XXXPPXXPPXP 964 P P P PP P PP PP P P PPP PP PP P Sbjct: 485 PPPPPPPPPLPAFVAPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 540 Score = 32.7 bits (71), Expect = 0.83 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 866 PXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P PPP P P PP PP PP P Sbjct: 480 PHAVAPPPPPPPPPLPAFVAPPPPPPPPPPPPP 512 Score = 32.7 bits (71), Expect = 0.83 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 824 HPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 H PP P P PPP P P PP PP P P Sbjct: 481 HAVAPPPPPPPPPLPAFVAPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAP 533 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P P P PP PPP P P P PP P Sbjct: 502 PPPPPPPPPPPLANYGAPPPPPP----PPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSAS 557 Query: 980 P 982 P Sbjct: 558 P 558 >BT004476-1|AAO42640.1| 286|Drosophila melanogaster LP07342p protein. Length = 286 Score = 40.3 bits (90), Expect = 0.004 Identities = 23/61 (37%), Positives = 23/61 (37%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G GG GG GGG G G GGG GG G GG G G G Sbjct: 53 GGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFG-GGFGGGSGGGSGGGFGG 111 Query: 801 G 799 G Sbjct: 112 G 112 Score = 34.3 bits (75), Expect = 0.27 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 3/64 (4%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGG---GXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G GG GG GG G G G GGG GG G GG G G Sbjct: 45 GGGSSGGFGGGIGGGF-GGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGGSGG 103 Query: 810 XXGG 799 GG Sbjct: 104 GSGG 107 Score = 33.5 bits (73), Expect = 0.47 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G GG G GGG G G GGG GG G GG G G Sbjct: 71 GGFSSGGGGGFSSGGGGGGGGGFGGGFGGGSGGGS--GGGFGGGGSIGGFGGGGGGG 125 Score = 33.5 bits (73), Expect = 0.47 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G G GGG G G GG G GG Sbjct: 76 GGGGGFSSGGGGGGGGGFGGGFGGGSGGGSGGGFGGGGSIGGFGGGGGGGGG 127 Score = 31.1 bits (67), Expect = 2.5 Identities = 20/64 (31%), Positives = 20/64 (31%), Gaps = 3/64 (4%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGG---GXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G GG GG GG G G G G G G GG G G Sbjct: 33 GGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGG 92 Query: 810 XXGG 799 GG Sbjct: 93 FGGG 96 Score = 29.9 bits (64), Expect = 5.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGG 880 G G GG GG GGG G G GGG Sbjct: 94 GGGFGGGSGGGSGGGFGGGGSIGGFGGGGGGGGG 127 Score = 29.5 bits (63), Expect = 7.7 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -3 Query: 930 GGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GGG G G GGG G GG G G GG Sbjct: 27 GGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGG 70 >AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p protein. Length = 1049 Score = 40.3 bits (90), Expect = 0.004 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPP---XXXPPXXPPXP 964 P P P PP P PP PPP P PPP PP PP P Sbjct: 475 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 531 Score = 30.7 bits (66), Expect = 3.3 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 2/48 (4%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXX--PPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P PP P PP PPP P P PP PP P Sbjct: 470 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPP 517 >AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p protein. Length = 846 Score = 40.3 bits (90), Expect = 0.004 Identities = 22/64 (34%), Positives = 22/64 (34%), Gaps = 3/64 (4%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPX-PPXXXXPPP--XXXXXPXPXXXPPPXXXPPXXPPXPXX 970 PP P P PP P PP PPP P P PP PP PP P Sbjct: 123 PPASPRFDPPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPT 182 Query: 971 XXXP 982 P Sbjct: 183 VEPP 186 Score = 40.3 bits (90), Expect = 0.004 Identities = 20/65 (30%), Positives = 20/65 (30%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P PP P P PPP P P P P PP P Sbjct: 172 PPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPPAPPKVEL 231 Query: 980 PXXXA 994 P A Sbjct: 232 PPPPA 236 Score = 37.5 bits (83), Expect = 0.029 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 4/53 (7%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXX----PXPXXXPPPXXXPPXXPPXPXXXXXPXXXA 994 PP P PP PPP P P PP PP PP P P A Sbjct: 151 PPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPA 203 Score = 37.5 bits (83), Expect = 0.029 Identities = 23/69 (33%), Positives = 23/69 (33%), Gaps = 4/69 (5%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXP----PXXPPXPX 967 PP P P PP P PP PPP P PPP P P PP P Sbjct: 152 PPPAPPTIKP------PPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPA 205 Query: 968 XXXXPXXXA 994 P A Sbjct: 206 EVEPPPPPA 214 Score = 35.9 bits (79), Expect = 0.089 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +2 Query: 812 PXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXPXXX 991 P P PP P PP PP PPP P PP P P Sbjct: 95 PPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPP 154 Query: 992 A 994 A Sbjct: 155 A 155 Score = 35.9 bits (79), Expect = 0.089 Identities = 21/89 (23%), Positives = 22/89 (24%) Frame = +3 Query: 735 PLXHPPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXP 914 P PPPP + P P P PP P P Sbjct: 103 PKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPP 162 Query: 915 PXXXXXXXXPPXXXPXXPPXXXXXRPPRP 1001 P PP P PP PP P Sbjct: 163 PPPAPPTVEPPPPPPPAPPTVEPPPPPPP 191 Score = 35.5 bits (78), Expect = 0.12 Identities = 20/65 (30%), Positives = 20/65 (30%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P PP PP P P P P P P P PP P Sbjct: 164 PPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPP---PAPAEVEPPPPPAPTELEP 220 Query: 980 PXXXA 994 P A Sbjct: 221 PPPPA 225 Score = 31.5 bits (68), Expect = 1.9 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P PP P PP P P PP PP PP P Sbjct: 185 PPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPPAPPKVELPP--PPAP 237 Score = 30.7 bits (66), Expect = 3.3 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXPXXXA 994 P PP P P PPP P PP P PP P P A Sbjct: 90 PKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPAS-PRFDPPPPHTIEPPPPPA 144 Score = 29.9 bits (64), Expect = 5.8 Identities = 17/58 (29%), Positives = 17/58 (29%), Gaps = 3/58 (5%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXX---PPPXXXPPXXPPXP 964 PP P PP P PP P P PPP P PP P Sbjct: 96 PPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPP 153 >AY113557-1|AAM29562.1| 93|Drosophila melanogaster RH06401p protein. Length = 93 Score = 40.3 bits (90), Expect = 0.004 Identities = 21/55 (38%), Positives = 21/55 (38%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG G GGG G G GGG GG G GG G G GG Sbjct: 26 GGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGGSQGGHGG 80 Score = 32.7 bits (71), Expect = 0.83 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G GG GG GGG G G GG GG G GG Sbjct: 43 GGGGQSGYGG--GGQKNGGGGHGGGGQGSYGGGSQGGHGGGGQGG 85 Score = 29.5 bits (63), Expect = 7.7 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G G GGG G G G G GG Sbjct: 21 GLLGGGGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGG 72 Score = 29.5 bits (63), Expect = 7.7 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXX-GGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG GG GGG G G GGG GG G G G G GG Sbjct: 34 GGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYG--GGSQGGHGGGGQGG 85 >AJ271041-1|CAB66004.1| 286|Drosophila melanogaster Gly-rich protein protein. Length = 286 Score = 40.3 bits (90), Expect = 0.004 Identities = 23/61 (37%), Positives = 23/61 (37%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G GG GG GGG G G GGG GG G GG G G G Sbjct: 53 GGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFG-GGFGGGSGGGSGGGFGG 111 Query: 801 G 799 G Sbjct: 112 G 112 Score = 34.3 bits (75), Expect = 0.27 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 3/64 (4%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGG---GXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G GG GG GG G G G GGG GG G GG G G Sbjct: 45 GGGSSGGFGGGIGGGF-GGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGGSGG 103 Query: 810 XXGG 799 GG Sbjct: 104 GSGG 107 Score = 33.5 bits (73), Expect = 0.47 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G GG G GGG G G GGG GG G GG G G Sbjct: 71 GGFSSGGGGGFSSGGGGGGGGGFGGGFGGGSGGGS--GGGFGGGGSIGGFGGGGGGG 125 Score = 31.1 bits (67), Expect = 2.5 Identities = 20/64 (31%), Positives = 20/64 (31%), Gaps = 3/64 (4%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGG---GXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G GG GG GG G G G G G G GG G G Sbjct: 33 GGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGG 92 Query: 810 XXGG 799 GG Sbjct: 93 FGGG 96 Score = 29.5 bits (63), Expect = 7.7 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -3 Query: 930 GGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GGG G G GGG G GG G G GG Sbjct: 27 GGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGG 70 >AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA, isoform A protein. Length = 1109 Score = 40.3 bits (90), Expect = 0.004 Identities = 22/64 (34%), Positives = 22/64 (34%), Gaps = 3/64 (4%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPX-PPXXXXPPP--XXXXXPXPXXXPPPXXXPPXXPPXPXX 970 PP P P PP P PP PPP P P PP PP PP P Sbjct: 386 PPASPRFDPPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPT 445 Query: 971 XXXP 982 P Sbjct: 446 VEPP 449 Score = 40.3 bits (90), Expect = 0.004 Identities = 20/65 (30%), Positives = 20/65 (30%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P PP P P PPP P P P P PP P Sbjct: 435 PPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPPAPPKVEL 494 Query: 980 PXXXA 994 P A Sbjct: 495 PPPPA 499 Score = 37.5 bits (83), Expect = 0.029 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 4/53 (7%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXX----PXPXXXPPPXXXPPXXPPXPXXXXXPXXXA 994 PP P PP PPP P P PP PP PP P P A Sbjct: 414 PPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPA 466 Score = 37.5 bits (83), Expect = 0.029 Identities = 23/69 (33%), Positives = 23/69 (33%), Gaps = 4/69 (5%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXP----PXXPPXPX 967 PP P P PP P PP PPP P PPP P P PP P Sbjct: 415 PPPAPPTIKP------PPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPA 468 Query: 968 XXXXPXXXA 994 P A Sbjct: 469 EVEPPPPPA 477 Score = 35.9 bits (79), Expect = 0.089 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +2 Query: 812 PXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXPXXX 991 P P PP P PP PP PPP P PP P P Sbjct: 358 PPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPP 417 Query: 992 A 994 A Sbjct: 418 A 418 Score = 35.9 bits (79), Expect = 0.089 Identities = 21/89 (23%), Positives = 22/89 (24%) Frame = +3 Query: 735 PLXHPPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXP 914 P PPPP + P P P PP P P Sbjct: 366 PKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPP 425 Query: 915 PXXXXXXXXPPXXXPXXPPXXXXXRPPRP 1001 P PP P PP PP P Sbjct: 426 PPPAPPTVEPPPPPPPAPPTVEPPPPPPP 454 Score = 35.5 bits (78), Expect = 0.12 Identities = 20/65 (30%), Positives = 20/65 (30%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P PP PP P P P P P P P PP P Sbjct: 427 PPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPP---PAPAEVEPPPPPAPTELEP 483 Query: 980 PXXXA 994 P A Sbjct: 484 PPPPA 488 Score = 31.5 bits (68), Expect = 1.9 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P PP P PP P P PP PP PP P Sbjct: 448 PPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPPAPPKVELPP--PPAP 500 Score = 30.7 bits (66), Expect = 3.3 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXPXXXA 994 P PP P P PPP P PP P PP P P A Sbjct: 353 PKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPAS-PRFDPPPPHTIEPPPPPA 407 Score = 29.9 bits (64), Expect = 5.8 Identities = 17/58 (29%), Positives = 17/58 (29%), Gaps = 3/58 (5%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXX---PPPXXXPPXXPPXP 964 PP P PP P PP P P PPP P PP P Sbjct: 359 PPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPP 416 >AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB, isoform B protein. Length = 1150 Score = 40.3 bits (90), Expect = 0.004 Identities = 22/64 (34%), Positives = 22/64 (34%), Gaps = 3/64 (4%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPX-PPXXXXPPP--XXXXXPXPXXXPPPXXXPPXXPPXPXX 970 PP P P PP P PP PPP P P PP PP PP P Sbjct: 386 PPASPRFDPPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPT 445 Query: 971 XXXP 982 P Sbjct: 446 VEPP 449 Score = 40.3 bits (90), Expect = 0.004 Identities = 20/65 (30%), Positives = 20/65 (30%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P PP P P PPP P P P P PP P Sbjct: 435 PPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPPAPPKVEL 494 Query: 980 PXXXA 994 P A Sbjct: 495 PPPPA 499 Score = 37.5 bits (83), Expect = 0.029 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 4/53 (7%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXX----PXPXXXPPPXXXPPXXPPXPXXXXXPXXXA 994 PP P PP PPP P P PP PP PP P P A Sbjct: 414 PPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPA 466 Score = 37.5 bits (83), Expect = 0.029 Identities = 23/69 (33%), Positives = 23/69 (33%), Gaps = 4/69 (5%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXP----PXXPPXPX 967 PP P P PP P PP PPP P PPP P P PP P Sbjct: 415 PPPAPPTIKP------PPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPA 468 Query: 968 XXXXPXXXA 994 P A Sbjct: 469 EVEPPPPPA 477 Score = 35.9 bits (79), Expect = 0.089 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +2 Query: 812 PXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXPXXX 991 P P PP P PP PP PPP P PP P P Sbjct: 358 PPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPP 417 Query: 992 A 994 A Sbjct: 418 A 418 Score = 35.9 bits (79), Expect = 0.089 Identities = 21/89 (23%), Positives = 22/89 (24%) Frame = +3 Query: 735 PLXHPPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXP 914 P PPPP + P P P PP P P Sbjct: 366 PKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPP 425 Query: 915 PXXXXXXXXPPXXXPXXPPXXXXXRPPRP 1001 P PP P PP PP P Sbjct: 426 PPPAPPTVEPPPPPPPAPPTVEPPPPPPP 454 Score = 35.5 bits (78), Expect = 0.12 Identities = 20/65 (30%), Positives = 20/65 (30%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P PP PP P P P P P P P PP P Sbjct: 427 PPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPP---PAPAEVEPPPPPAPTELEP 483 Query: 980 PXXXA 994 P A Sbjct: 484 PPPPA 488 Score = 31.5 bits (68), Expect = 1.9 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P PP P PP P P PP PP PP P Sbjct: 448 PPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPPAPPKVELPP--PPAP 500 Score = 30.7 bits (66), Expect = 3.3 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXPXXXA 994 P PP P P PPP P PP P PP P P A Sbjct: 353 PKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPAS-PRFDPPPPHTIEPPPPPA 407 Score = 29.9 bits (64), Expect = 5.8 Identities = 17/58 (29%), Positives = 17/58 (29%), Gaps = 3/58 (5%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXX---PPPXXXPPXXPPXP 964 PP P PP P PP P P PPP P PP P Sbjct: 359 PPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPP 416 >AE014297-4048|AAF56656.1| 286|Drosophila melanogaster CG5812-PA protein. Length = 286 Score = 40.3 bits (90), Expect = 0.004 Identities = 23/61 (37%), Positives = 23/61 (37%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G GG GG GGG G G GGG GG G GG G G G Sbjct: 53 GGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFG-GGFGGGSGGGSGGGFGG 111 Query: 801 G 799 G Sbjct: 112 G 112 Score = 34.3 bits (75), Expect = 0.27 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 3/64 (4%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGG---GXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G GG GG GG G G G GGG GG G GG G G Sbjct: 45 GGGSSGGFGGGIGGGF-GGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGGSGG 103 Query: 810 XXGG 799 GG Sbjct: 104 GSGG 107 Score = 33.5 bits (73), Expect = 0.47 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G GG G GGG G G GGG GG G GG G G Sbjct: 71 GGFSSGGGGGFSSGGGGGGGGGFGGGFGGGSGGGS--GGGFGGGGSIGGFGGGGGGG 125 Score = 33.5 bits (73), Expect = 0.47 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G G GGG G G GG G GG Sbjct: 76 GGGGGFSSGGGGGGGGGFGGGFGGGSGGGSGGGFGGGGSIGGFGGGGGGGGG 127 Score = 31.1 bits (67), Expect = 2.5 Identities = 20/64 (31%), Positives = 20/64 (31%), Gaps = 3/64 (4%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGG---GXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G GG GG GG G G G G G G GG G G Sbjct: 33 GGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGG 92 Query: 810 XXGG 799 GG Sbjct: 93 FGGG 96 Score = 29.9 bits (64), Expect = 5.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGG 880 G G GG GG GGG G G GGG Sbjct: 94 GGGFGGGSGGGSGGGFGGGGSIGGFGGGGGGGGG 127 Score = 29.5 bits (63), Expect = 7.7 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -3 Query: 930 GGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GGG G G GGG G GG G G GG Sbjct: 27 GGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGG 70 >AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA, isoform A protein. Length = 1059 Score = 40.3 bits (90), Expect = 0.004 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPP---XXXPPXXPPXP 964 P P P PP P PP PPP P PPP PP PP P Sbjct: 485 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 541 Score = 30.7 bits (66), Expect = 3.3 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 2/48 (4%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXX--PPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P PP P PP PPP P P PP PP P Sbjct: 480 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPP 527 >AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB, isoform B protein. Length = 1049 Score = 40.3 bits (90), Expect = 0.004 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPP---XXXPPXXPPXP 964 P P P PP P PP PPP P PPP PP PP P Sbjct: 475 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 531 Score = 30.7 bits (66), Expect = 3.3 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 2/48 (4%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXX--PPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P PP P PP PPP P P PP PP P Sbjct: 470 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPP 517 >AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD, isoform D protein. Length = 1207 Score = 40.3 bits (90), Expect = 0.004 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPP---XXXPPXXPPXP 964 P P P PP P PP PPP P PPP PP PP P Sbjct: 633 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 689 Score = 30.7 bits (66), Expect = 3.3 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 2/48 (4%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXX--PPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P PP P PP PPP P P PP PP P Sbjct: 628 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPP 675 >AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC, isoform C protein. Length = 1154 Score = 40.3 bits (90), Expect = 0.004 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPP---XXXPPXXPPXP 964 P P P PP P PP PPP P PPP PP PP P Sbjct: 580 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 636 Score = 30.7 bits (66), Expect = 3.3 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 2/48 (4%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXX--PPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P PP P PP PPP P P PP PP P Sbjct: 575 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPP 622 >X05285-1|CAA28903.1| 147|Drosophila melanogaster fibrillarin protein. Length = 147 Score = 39.5 bits (88), Expect = 0.007 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXG-XXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GG GGG G G GGG GG G GG G G GG Sbjct: 60 GFGGGRGGGGRGGGGGGGRGAFGGRGGGGGRGGGGRGGGGRGGGGRGGGAGGFKGG 115 Score = 34.3 bits (75), Expect = 0.27 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 4/65 (6%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXG----GXGXGGXXXXXXGXXXX 814 G G GG G GGG G G GGG G G G GG G Sbjct: 19 GGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGGR 78 Query: 813 GXXGG 799 G GG Sbjct: 79 GAFGG 83 Score = 33.1 bits (72), Expect = 0.63 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G G GGG G GG G G GG Sbjct: 17 GGGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGG 68 Score = 32.3 bits (70), Expect = 1.1 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG GG GGG G GGG G G GG G GG Sbjct: 17 GGGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGG 69 >BT021407-1|AAX33555.1| 720|Drosophila melanogaster LD06749p protein. Length = 720 Score = 39.5 bits (88), Expect = 0.007 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G GG GG GGG G G GGG GG G GG Sbjct: 651 GRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGG 695 Score = 37.5 bits (83), Expect = 0.029 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXX-XGGXGXGGXXXXXXGXXXXGXXGG 799 GG GG GGG G G GGG GG G GG G G GG Sbjct: 645 GGRGGGGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGGRGG 698 Score = 32.7 bits (71), Expect = 0.83 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G GG G GGG G G GGG GG G G Sbjct: 645 GGRGGGGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRG 689 >AF162774-1|AAF68853.2| 720|Drosophila melanogaster Nopp140-like nucleolar protein protein. Length = 720 Score = 39.5 bits (88), Expect = 0.007 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G GG GG GGG G G GGG GG G GG Sbjct: 651 GRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGG 695 Score = 37.5 bits (83), Expect = 0.029 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXX-XGGXGXGGXXXXXXGXXXXGXXGG 799 GG GG GGG G G GGG GG G GG G G GG Sbjct: 645 GGRGGGGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGGRGG 698 Score = 32.7 bits (71), Expect = 0.83 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G GG G GGG G G GGG GG G G Sbjct: 645 GGRGGGGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRG 689 >AE014296-3628|AAF51788.3| 720|Drosophila melanogaster CG7421-PA, isoform A protein. Length = 720 Score = 39.5 bits (88), Expect = 0.007 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G GG GG GGG G G GGG GG G GG Sbjct: 651 GRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGG 695 Score = 37.5 bits (83), Expect = 0.029 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXX-XGGXGXGGXXXXXXGXXXXGXXGG 799 GG GG GGG G G GGG GG G GG G G GG Sbjct: 645 GGRGGGGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGGRGG 698 Score = 32.7 bits (71), Expect = 0.83 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G GG G GGG G G GGG GG G G Sbjct: 645 GGRGGGGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRG 689 >AE013599-3536|AAF46950.1| 344|Drosophila melanogaster CG9888-PA protein. Length = 344 Score = 39.5 bits (88), Expect = 0.007 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXG-XXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GG GGG G G GGG GG G GG G G GG Sbjct: 53 GFGGGRGGGGRGGGGGGGRGAFGGRGGGGGRGGGGRGGGGRGGGGRGGGAGGFKGG 108 Score = 34.3 bits (75), Expect = 0.27 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 4/65 (6%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXG----GXGXGGXXXXXXGXXXX 814 G G GG G GGG G G GGG G G G GG G Sbjct: 12 GGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGGR 71 Query: 813 GXXGG 799 G GG Sbjct: 72 GAFGG 76 Score = 33.1 bits (72), Expect = 0.63 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G G GGG G GG G G GG Sbjct: 10 GGGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGG 61 Score = 32.3 bits (70), Expect = 1.1 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG GG GGG G GGG G G GG G GG Sbjct: 10 GGGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGG 62 >U13178-1|AAA86955.1| 404|Drosophila melanogaster RNA binding protein protein. Length = 404 Score = 39.1 bits (87), Expect = 0.010 Identities = 23/61 (37%), Positives = 23/61 (37%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G GG GG GGG G G GGG GG G GG G G G Sbjct: 218 GGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGG----GGNGGGGGGRYDRGGGGGGGGG 273 Query: 801 G 799 G Sbjct: 274 G 274 Score = 33.9 bits (74), Expect = 0.36 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -3 Query: 945 GGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG GGG G G GGG GG G GG G G GG Sbjct: 212 GGGGGGGGGGRG-GFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGG 259 >M15765-1|AAA70425.1| 365|Drosophila melanogaster unknown protein protein. Length = 365 Score = 39.1 bits (87), Expect = 0.010 Identities = 23/61 (37%), Positives = 23/61 (37%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G GG GG GGG G G GGG GG G GG G G G Sbjct: 180 GGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGG----GGNGGGGGGRYDRGGGGGGGGG 235 Query: 801 G 799 G Sbjct: 236 G 236 Score = 33.9 bits (74), Expect = 0.36 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -3 Query: 945 GGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG GGG G G GGG GG G GG G G GG Sbjct: 174 GGGGGGGGGGRG-GFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGG 221 >L37083-1|AAC41563.1| 404|Drosophila melanogaster RNA binding protein protein. Length = 404 Score = 39.1 bits (87), Expect = 0.010 Identities = 23/61 (37%), Positives = 23/61 (37%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G GG GG GGG G G GGG GG G GG G G G Sbjct: 218 GGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGG----GGNGGGGGGRYDRGGGGGGGGG 273 Query: 801 G 799 G Sbjct: 274 G 274 Score = 33.9 bits (74), Expect = 0.36 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -3 Query: 945 GGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG GGG G G GGG GG G GG G G GG Sbjct: 212 GGGGGGGGGGRG-GFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGG 259 >BT022850-1|AAY55266.1| 538|Drosophila melanogaster IP13040p protein. Length = 538 Score = 38.7 bits (86), Expect = 0.013 Identities = 21/65 (32%), Positives = 21/65 (32%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGGXXXXX 784 G G GG GGG G G GG G G GG G G GG Sbjct: 195 GGGSGGGGGGAGGGGGYGSGGGSGRGGAPGGPGAPGGGGFGGQGGGGGYGGAGGGAGRGG 254 Query: 783 XXGXP 769 G P Sbjct: 255 SPGGP 259 Score = 35.1 bits (77), Expect = 0.15 Identities = 21/71 (29%), Positives = 21/71 (29%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G GG G GGG G G GG G G GG G G G Sbjct: 257 GGPGSPGGGGFGGQGGAGGGYGGGGGGGRGGGGAPGAPGSPGGGGFGGQGGGGGFGGGGG 316 Query: 801 GXXXXXXXGXP 769 G P Sbjct: 317 RGGAPGAPGSP 327 Score = 34.7 bits (76), Expect = 0.20 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G GG G GGG G G GG GG G G G G Sbjct: 161 GGGYSGGPGGQGAGGGGGGGSGYGGGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRG 220 Query: 801 G 799 G Sbjct: 221 G 221 Score = 33.9 bits (74), Expect = 0.36 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 1/64 (1%) Frame = -3 Query: 957 GGXXG-GXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGGXXXXXX 781 GG G G GGG G G GGG G G GG G G G Sbjct: 166 GGPGGQGAGGGGGGGSGYGGGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRGGAPGG 225 Query: 780 XGXP 769 G P Sbjct: 226 PGAP 229 Score = 33.5 bits (73), Expect = 0.47 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGGXXXXXXX 778 GG G G G G G GGG GG GG G G G Sbjct: 161 GGGYSGGPGGQGAGGGGGGGSGYGGGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRG 220 Query: 777 GXP 769 G P Sbjct: 221 GAP 223 Score = 32.7 bits (71), Expect = 0.83 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G GG G G G G G GGG GG G G G G Sbjct: 176 GGGGGSGYGGGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRGGAPGGPGAPGGGGFG 235 Query: 801 G 799 G Sbjct: 236 G 236 Score = 32.3 bits (70), Expect = 1.1 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 1/66 (1%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXG-GXGXGGXXXXXXGXXXXGXXGGXXXX 787 G G GG GGG G G G G G G G GG G G GG Sbjct: 163 GYSGGPGGQGAGGGGGGGSGYGG--GSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRG 220 Query: 786 XXXGXP 769 G P Sbjct: 221 GAPGGP 226 Score = 31.5 bits (68), Expect = 1.9 Identities = 20/63 (31%), Positives = 20/63 (31%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGGXXXXXXX 778 GG GG GGG G G GG G G GG G GG Sbjct: 299 GGGFGGQGGGGGFGGGGGR----GGAPGAPGSPGGGGYGGQGGAGGGYGGGGGRGGGGAP 354 Query: 777 GXP 769 G P Sbjct: 355 GAP 357 Score = 31.1 bits (67), Expect = 2.5 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G G G GGG G G GGG GG G GG G G Sbjct: 174 GGGGGGGSGYGGGSGFGGGGAGGGSG---GGGGGAGGGGGYGSGGGSGRGGAPGGPGAPG 230 Query: 801 G 799 G Sbjct: 231 G 231 Score = 31.1 bits (67), Expect = 2.5 Identities = 21/65 (32%), Positives = 21/65 (32%) Frame = -3 Query: 993 AXXXGXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXX 814 A G G GG GG G G G GGG G G GG G Sbjct: 228 APGGGGFGGQGGGGGYGGAGGGAGRGGSPGGPGSPGGG----GFGGQGGAGGGYGGGGGG 283 Query: 813 GXXGG 799 G GG Sbjct: 284 GRGGG 288 Score = 30.7 bits (66), Expect = 3.3 Identities = 17/57 (29%), Positives = 17/57 (29%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G GG G G G G GGG GG G G G G Sbjct: 169 GGQGAGGGGGGGSGYGGGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRGGAPGG 225 Score = 30.7 bits (66), Expect = 3.3 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G GG G GGG G GG GG G G G G Sbjct: 182 GYGGGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRGGAPGGPGAPGGGGFGGQGGGG 241 Query: 801 G 799 G Sbjct: 242 G 242 Score = 30.7 bits (66), Expect = 3.3 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGG--XXXXGGXGXGGXXXXXXGXXXXGX 808 G G G GG GGG G GGG GG G GG G Sbjct: 333 GGQGGAGGGYGGGGGRGGGGAPGAPGAPGSPGGGGFGGQGGGGGFGGGGGRGGAPGAPGS 392 Query: 807 XGG 799 GG Sbjct: 393 PGG 395 Score = 30.7 bits (66), Expect = 3.3 Identities = 20/63 (31%), Positives = 20/63 (31%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGGXXXXXXX 778 GG GG GGG G G GG G G GG G G G Sbjct: 365 GGGFGGQGGGGGFGGGGGR----GGAPGAPGSPGGGGFGGQGGGGGYGGGAGRGGAPGAP 420 Query: 777 GXP 769 G P Sbjct: 421 GSP 423 Score = 30.7 bits (66), Expect = 3.3 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 2/57 (3%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGG--XXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G G GG GGG G GGG GG G GG G GG Sbjct: 369 GGQGGGGGFGGGGGRGGAPGAPGSPGGGGFGGQGGGGGYGGGAGRGGAPGAPGSPGG 425 Score = 29.5 bits (63), Expect = 7.7 Identities = 19/62 (30%), Positives = 19/62 (30%), Gaps = 1/62 (1%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXX-GGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXX 805 G G GG G GGG G G G G G G G G G Sbjct: 406 GYGGGAGRGGAPGAPGSPGGGGFGGQGGGGGFGAGGGRGGAGGAPGGPGSPGGPGYGGGA 465 Query: 804 GG 799 GG Sbjct: 466 GG 467 >AE013599-1243|AAF58688.1| 610|Drosophila melanogaster CG13214-PA, isoform A protein. Length = 610 Score = 38.7 bits (86), Expect = 0.013 Identities = 21/65 (32%), Positives = 21/65 (32%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGGXXXXX 784 G G GG GGG G G GG G G GG G G GG Sbjct: 267 GGGSGGGGGGAGGGGGYGSGGGSGRGGAPGGPGAPGGGGFGGQGGGGGYGGAGGGAGRGG 326 Query: 783 XXGXP 769 G P Sbjct: 327 SPGGP 331 Score = 35.1 bits (77), Expect = 0.15 Identities = 21/71 (29%), Positives = 21/71 (29%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G GG G GGG G G GG G G GG G G G Sbjct: 329 GGPGSPGGGGFGGQGGAGGGYGGGGGGGRGGGGAPGAPGSPGGGGFGGQGGGGGFGGGGG 388 Query: 801 GXXXXXXXGXP 769 G P Sbjct: 389 RGGAPGAPGSP 399 Score = 34.7 bits (76), Expect = 0.20 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G GG G GGG G G GG GG G G G G Sbjct: 233 GGGYSGGPGGQGAGGGGGGGSGYGGGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRG 292 Query: 801 G 799 G Sbjct: 293 G 293 Score = 33.9 bits (74), Expect = 0.36 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 1/64 (1%) Frame = -3 Query: 957 GGXXG-GXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGGXXXXXX 781 GG G G GGG G G GGG G G GG G G G Sbjct: 238 GGPGGQGAGGGGGGGSGYGGGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRGGAPGG 297 Query: 780 XGXP 769 G P Sbjct: 298 PGAP 301 Score = 33.5 bits (73), Expect = 0.47 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGGXXXXXXX 778 GG G G G G G GGG GG GG G G G Sbjct: 233 GGGYSGGPGGQGAGGGGGGGSGYGGGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRG 292 Query: 777 GXP 769 G P Sbjct: 293 GAP 295 Score = 32.7 bits (71), Expect = 0.83 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G GG GG GGG G GGG G G G G G Sbjct: 48 GGGGGFGGGGAGGGYGGGGGGGPAGGFGGGPGGGGAGGFGGGNNGLGGFANGRPIAPGGG 107 Query: 801 G 799 G Sbjct: 108 G 108 Score = 32.7 bits (71), Expect = 0.83 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G GG G G G G G GGG GG G G G G Sbjct: 248 GGGGGSGYGGGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRGGAPGGPGAPGGGGFG 307 Query: 801 G 799 G Sbjct: 308 G 308 Score = 32.3 bits (70), Expect = 1.1 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 1/66 (1%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXG-GXGXGGXXXXXXGXXXXGXXGGXXXX 787 G G GG GGG G G G G G G G GG G G GG Sbjct: 235 GYSGGPGGQGAGGGGGGGSGYGG--GSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRG 292 Query: 786 XXXGXP 769 G P Sbjct: 293 GAPGGP 298 Score = 31.5 bits (68), Expect = 1.9 Identities = 20/63 (31%), Positives = 20/63 (31%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGGXXXXXXX 778 GG GG GGG G G GG G G GG G GG Sbjct: 371 GGGFGGQGGGGGFGGGGGR----GGAPGAPGSPGGGGYGGQGGAGGGYGGGGGRGGGGAP 426 Query: 777 GXP 769 G P Sbjct: 427 GAP 429 Score = 31.1 bits (67), Expect = 2.5 Identities = 21/65 (32%), Positives = 21/65 (32%) Frame = -3 Query: 993 AXXXGXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXX 814 A G G G GG GGG G GGG GG G G G Sbjct: 29 AASAGGSPGAGLQGPGGGFGGGGGFGGGGA-----GGGYGGGGGGGPAGGFGGGPGGGGA 83 Query: 813 GXXGG 799 G GG Sbjct: 84 GGFGG 88 Score = 31.1 bits (67), Expect = 2.5 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G G G GGG G G GGG GG G GG G G Sbjct: 246 GGGGGGGSGYGGGSGFGGGGAGGGSG---GGGGGAGGGGGYGSGGGSGRGGAPGGPGAPG 302 Query: 801 G 799 G Sbjct: 303 G 303 Score = 31.1 bits (67), Expect = 2.5 Identities = 21/65 (32%), Positives = 21/65 (32%) Frame = -3 Query: 993 AXXXGXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXX 814 A G G GG GG G G G GGG G G GG G Sbjct: 300 APGGGGFGGQGGGGGYGGAGGGAGRGGSPGGPGSPGGG----GFGGQGGAGGGYGGGGGG 355 Query: 813 GXXGG 799 G GG Sbjct: 356 GRGGG 360 Score = 30.7 bits (66), Expect = 3.3 Identities = 17/57 (29%), Positives = 17/57 (29%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G GG G G G G GGG GG G G G G Sbjct: 241 GGQGAGGGGGGGSGYGGGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRGGAPGG 297 Score = 30.7 bits (66), Expect = 3.3 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G GG G GGG G GG GG G G G G Sbjct: 254 GYGGGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRGGAPGGPGAPGGGGFGGQGGGG 313 Query: 801 G 799 G Sbjct: 314 G 314 Score = 30.7 bits (66), Expect = 3.3 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGG--XXXXGGXGXGGXXXXXXGXXXXGX 808 G G G GG GGG G GGG GG G GG G Sbjct: 405 GGQGGAGGGYGGGGGRGGGGAPGAPGAPGSPGGGGFGGQGGGGGFGGGGGRGGAPGAPGS 464 Query: 807 XGG 799 GG Sbjct: 465 PGG 467 Score = 30.7 bits (66), Expect = 3.3 Identities = 20/63 (31%), Positives = 20/63 (31%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGGXXXXXXX 778 GG GG GGG G G GG G G GG G G G Sbjct: 437 GGGFGGQGGGGGFGGGGGR----GGAPGAPGSPGGGGFGGQGGGGGYGGGAGRGGAPGAP 492 Query: 777 GXP 769 G P Sbjct: 493 GSP 495 Score = 30.7 bits (66), Expect = 3.3 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 2/57 (3%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGG--XXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G G GG GGG G GGG GG G GG G GG Sbjct: 441 GGQGGGGGFGGGGGRGGAPGAPGSPGGGGFGGQGGGGGYGGGAGRGGAPGAPGSPGG 497 Score = 29.5 bits (63), Expect = 7.7 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 1/62 (1%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGG-GXXXXGGXGXGGXXXXXXGXXXXGXX 805 G G GG GG GGG G G GG G G G GG G Sbjct: 51 GGFGGGGAGGGYGGGG-GGGPAGGFGGGPGGGGAGGFGGGNNGLGGFANGRPIAPGGGGG 109 Query: 804 GG 799 GG Sbjct: 110 GG 111 Score = 29.5 bits (63), Expect = 7.7 Identities = 19/62 (30%), Positives = 19/62 (30%), Gaps = 1/62 (1%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXX-GGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXX 805 G G GG G GGG G G G G G G G G G Sbjct: 478 GYGGGAGRGGAPGAPGSPGGGGFGGQGGGGGFGAGGGRGGAGGAPGGPGSPGGPGYGGGA 537 Query: 804 GG 799 GG Sbjct: 538 GG 539 >AY070576-1|AAL48047.1| 527|Drosophila melanogaster RE12101p protein. Length = 527 Score = 38.3 bits (85), Expect = 0.017 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P PP PP PPP P PPP P PP P Sbjct: 343 PPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPP 397 Score = 34.3 bits (75), Expect = 0.27 Identities = 19/63 (30%), Positives = 19/63 (30%), Gaps = 2/63 (3%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPX--PPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXX 973 PP P P P PP PPP P P P PP PP P Sbjct: 334 PPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAV 393 Query: 974 XXP 982 P Sbjct: 394 PPP 396 Score = 33.5 bits (73), Expect = 0.47 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 3/58 (5%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPP---XXPPXP 964 PP P HP P PP PP P PPP PP PP P Sbjct: 317 PPPVPTR-HPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPP 373 >AE014297-4274|AAO41609.1| 494|Drosophila melanogaster CG1520-PC, isoform C protein. Length = 494 Score = 38.3 bits (85), Expect = 0.017 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P PP PP PPP P PPP P PP P Sbjct: 310 PPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPP 364 Score = 34.3 bits (75), Expect = 0.27 Identities = 19/63 (30%), Positives = 19/63 (30%), Gaps = 2/63 (3%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPX--PPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXX 973 PP P P P PP PPP P P P PP PP P Sbjct: 301 PPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAV 360 Query: 974 XXP 982 P Sbjct: 361 PPP 363 Score = 33.5 bits (73), Expect = 0.47 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 3/58 (5%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPP---XXPPXP 964 PP P HP P PP PP P PPP PP PP P Sbjct: 284 PPPVPTR-HPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPP 340 >AE014297-4273|AAN14303.1| 527|Drosophila melanogaster CG1520-PB, isoform B protein. Length = 527 Score = 38.3 bits (85), Expect = 0.017 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P PP PP PPP P PPP P PP P Sbjct: 343 PPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPP 397 Score = 34.3 bits (75), Expect = 0.27 Identities = 19/63 (30%), Positives = 19/63 (30%), Gaps = 2/63 (3%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPX--PPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXX 973 PP P P P PP PPP P P P PP PP P Sbjct: 334 PPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAV 393 Query: 974 XXP 982 P Sbjct: 394 PPP 396 Score = 33.5 bits (73), Expect = 0.47 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 3/58 (5%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPP---XXPPXP 964 PP P HP P PP PP P PPP PP PP P Sbjct: 317 PPPVPTR-HPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPP 373 >AE014297-4272|AAF56819.1| 527|Drosophila melanogaster CG1520-PA, isoform A protein. Length = 527 Score = 38.3 bits (85), Expect = 0.017 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P PP PP PPP P PPP P PP P Sbjct: 343 PPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPP 397 Score = 34.3 bits (75), Expect = 0.27 Identities = 19/63 (30%), Positives = 19/63 (30%), Gaps = 2/63 (3%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPX--PPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXX 973 PP P P P PP PPP P P P PP PP P Sbjct: 334 PPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAV 393 Query: 974 XXP 982 P Sbjct: 394 PPP 396 Score = 33.5 bits (73), Expect = 0.47 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 3/58 (5%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPP---XXPPXP 964 PP P HP P PP PP P PPP PP PP P Sbjct: 317 PPPVPTR-HPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPP 373 >BT001738-1|AAN71493.1| 331|Drosophila melanogaster RE72617p protein. Length = 331 Score = 37.9 bits (84), Expect = 0.022 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G GG G GGG G G GGG G G GG G G G Sbjct: 12 GGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGAFGGRGGGGGRG 71 Query: 801 G 799 G Sbjct: 72 G 72 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 4/57 (7%) Frame = -3 Query: 957 GGXXGGXXXGGG----XXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG GG GGG G G GGG GG GG G G GG Sbjct: 10 GGGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGAFGGRGG 66 >AE014296-3444|AAF51657.1| 98|Drosophila melanogaster CG11458-PA protein. Length = 98 Score = 37.5 bits (83), Expect = 0.029 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GG GGG G GGG GG G GG G G G Sbjct: 40 GGGGGQGGWQKGGGGGGGGKHGGGGGGGGKHGGGNGGGGKHGGGGGGGGGGGKHG 94 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 2/57 (3%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGX--GXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG G GGG G G GGG G G GG G G GG Sbjct: 26 GGGGQGGWQKNGGGGGGGGQGGWQKGGGGGGGGKHGGGGGGGGKHGGGNGGGGKHGG 82 Score = 31.9 bits (69), Expect = 1.4 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG G GGG G GGG G G G G G GG Sbjct: 41 GGGGQGGWQKGGGGGGGGKHGGGGGGGGKHGGGNGGGGKHGGGGGGGGGGGKHGG 95 Score = 30.3 bits (65), Expect = 4.4 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG GG GG G G GGG GG G G G G GG Sbjct: 37 GGGGGGGGQGGWQKGGGGG----GGGKHGGGGGGGGKHGGGNGGGGKHGGGGG 85 Score = 29.9 bits (64), Expect = 5.8 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGG 862 G G GG G GGG G G GGG GG Sbjct: 58 GKHGGGGGGGGKHGGGNGGGGKHGGGGGGGGGGGKHGGGG 97 Score = 29.5 bits (63), Expect = 7.7 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G GG GG GG G G GGG G G GG Sbjct: 55 GGGGKHGGGGGGGGKHGGGN--GGGGKHGGGGGGGGGGGKHGGGG 97 >AE014296-2897|AAF49349.4| 926|Drosophila melanogaster CG13731-PA protein. Length = 926 Score = 37.5 bits (83), Expect = 0.029 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 PP P P PP PP PP P P PPP PP PP Sbjct: 193 PPTRPPTRPPTRPPTPPPTYLPPTNKPLPPVTTRLPPP--PPPPRTPPPTRPP 243 Score = 36.7 bits (81), Expect = 0.051 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 PP P P PP PP PP P PPP P PP Sbjct: 230 PPPPPRTPPPTRPPTRPPTTRPPATYLPPTNKPLPPVTTRLPPPPPSPRTPPP 282 Score = 36.7 bits (81), Expect = 0.051 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 PP P P PP PP PP P PPP P PP Sbjct: 273 PPPSPRTPPPTRPPTRPPTTRPPATYLPPTNKPLPPVTTRLPPPPPPPRTPPP 325 Score = 34.7 bits (76), Expect = 0.20 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P PP PP PP P P P PP PP P Sbjct: 316 PPPPPRTPPPTRPPTKPPTTRPPATYLPPTNKPPPPVTTRRPTP---PPTRPPPP 367 Score = 34.3 bits (75), Expect = 0.27 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 5/60 (8%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPX-----PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P PP P PP PPP P PP PP P P Sbjct: 205 PPTPPPTYLPPTNKPLPPVTTRLPPPPPPPRTPPPTRPPTRPPTTRPPATYLPPTNKPLP 264 Score = 33.1 bits (72), Expect = 0.63 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 2/57 (3%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPX--PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P PP P PP PP P PPP PP P P Sbjct: 185 PPTRPPTRPPTRPPTRPPTRPPTPPPTYLPPTNKPLPPVTTRLPPPP--PPPRTPPP 239 Score = 32.7 bits (71), Expect = 0.83 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P PP P PP PPP P PP PP P P Sbjct: 307 PPVTTRLPPPPPPP--RTPPPTRPPTKPPTTRPPATYLPPTNKPPP 350 Score = 31.1 bits (67), Expect = 2.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 857 PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P PP PPP P PP PP P P Sbjct: 272 PPPPSPRTPPPTRPPTRPPTTRPPATYLPPTNKPLP 307 Score = 30.3 bits (65), Expect = 4.4 Identities = 24/95 (25%), Positives = 24/95 (25%), Gaps = 6/95 (6%) Frame = +3 Query: 735 PLXHPPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXX----PXXXXXPXXXXX 902 P P PP R P P PP PP P P Sbjct: 484 PTNKPLPPVTVRTTVRTTPRPTLPPTKPPTRPPTTYLPPPTVRTTRPPPPPTRPPTKPPT 543 Query: 903 XXXPPXXXXXXXX--PPXXXPXXPPXXXXXRPPRP 1001 PP PP P PP RPP P Sbjct: 544 TYLPPVTVRTTRATPPPTRPPTRPPTPPPTRPPPP 578 >X71975-1|CAA50795.1| 239|Drosophila melanogaster GCR 101 protein. Length = 239 Score = 36.3 bits (80), Expect = 0.067 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G GG GG GGG G GGG GG G GG Sbjct: 10 GGGGGRGFGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGG 54 Score = 31.5 bits (68), Expect = 1.9 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGX-XXGXGXXXXXGGGXXXXGGXGXGG 847 G G GG G GGG G G GGG GG G GG Sbjct: 4 GKPRGGGGGGGRGFGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGG 49 Score = 31.5 bits (68), Expect = 1.9 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -3 Query: 945 GGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG GGG G GGG GG GG G G GG Sbjct: 171 GGGGGGGGFGGRGGRGGGRGGGGRGGGGGRGGGGFRGGAGRNGGGGGGG 219 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G GG GG GGG G GGG G GG Sbjct: 184 GRGGGRGGGGRGGGGGRGGGGFRGGAGRNGGGGGGGGGFNRGRGG 228 Score = 30.7 bits (66), Expect = 3.3 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXX-GGGXXXGXGXXXXXGGGXXXXGGXG 856 G G GG GG GGG G G GGG GG G Sbjct: 195 GGGGGRGGGGFRGGAGRNGGGGGGGGGFNRGRGGGGGGGGGRG 237 >AY075501-1|AAO39496.1| 299|Drosophila melanogaster RE52135p protein. Length = 299 Score = 36.3 bits (80), Expect = 0.067 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G GG GG GGG G GGG GG G GG Sbjct: 12 GGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGG 56 Score = 34.7 bits (76), Expect = 0.20 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 GG GG GGG G GGG GG G GG G G Sbjct: 9 GGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGG 57 Score = 33.1 bits (72), Expect = 0.63 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G GG G GGG G G GGG GG GG Sbjct: 13 GGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGG 57 Score = 31.1 bits (67), Expect = 2.5 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = -3 Query: 942 GXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG-GXXXXXXGXXXXGXXGG 799 G GGG G G GGG GG G G G G G GG Sbjct: 4 GKPRGGGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGG 52 >AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p protein. Length = 420 Score = 36.3 bits (80), Expect = 0.067 Identities = 19/65 (29%), Positives = 19/65 (29%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P PP PP P P P PP P PP P Sbjct: 100 PPRPPPQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPPQPT 159 Query: 980 PXXXA 994 P A Sbjct: 160 PSAPA 164 Score = 35.1 bits (77), Expect = 0.15 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P PP PP P P P PP PP PP P Sbjct: 80 PPPQPTPPAPRPSYG-PPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPPRPPPQP 133 Score = 35.1 bits (77), Expect = 0.15 Identities = 22/74 (29%), Positives = 22/74 (29%), Gaps = 3/74 (4%) Frame = +2 Query: 770 GXPXXXXXXXPPXXPXXXHPXXXXXXPPXPXP---PXXXXPPPXXXXXPXPXXXPPPXXX 940 G P P P P P P P P PPP P P P P Sbjct: 168 GPPQPQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPP----PPPRPQPTPGYG 223 Query: 941 PPXXPPXPXXXXXP 982 PP PP P P Sbjct: 224 PPPPPPPPKPQPTP 237 Score = 34.3 bits (75), Expect = 0.27 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 1/66 (1%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPP-PXXXPPXXPPXPXXXX 976 PP P P PP P PP P P P P PP P P PP P Sbjct: 193 PPDQPKP-RPTPSRPQPPPPPPP---RPQPTPGYGPPPPPPPPKPQPTPGYGPPTPPPGP 248 Query: 977 XPXXXA 994 P A Sbjct: 249 GPAQPA 254 Score = 34.3 bits (75), Expect = 0.27 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 2/57 (3%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXP--PPXXXPPXXPPXP 964 PP P P PP P PP P P P P P P PP P Sbjct: 209 PPPPPPRPQPTPGYGPPPPPPPPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPPRP 265 Score = 33.5 bits (73), Expect = 0.47 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 PP P P P PP P P P PPP PP PP Sbjct: 75 PPPPPPPPQPTPPAPRPSY-GPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPP 126 Score = 33.1 bits (72), Expect = 0.63 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 4/57 (7%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPP---XXXXPPPXXXXXPXP-XXXPPPXXXPPXXPP 958 PP P P P PP PPP P P PPP PP PP Sbjct: 95 PPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPP 151 Score = 31.9 bits (69), Expect = 1.4 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 1/56 (1%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXP-XPXXXPPPXXXPPXXPPXP 964 P P P PP P PPP P P PPP P P P Sbjct: 87 PAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPP 142 Score = 31.9 bits (69), Expect = 1.4 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P PP PP PPP P P P P PP P Sbjct: 125 PPPRPPPQPTPSAPAPPPSYGPPQT--PPPRPPPQPTPSAPAPSYGPPQPQPPAPQPPSP 182 Query: 980 P 982 P Sbjct: 183 P 183 Score = 31.9 bits (69), Expect = 1.4 Identities = 29/130 (22%), Positives = 31/130 (23%), Gaps = 7/130 (5%) Frame = +3 Query: 633 PXPXPXXPXXXXXXXGPXSPXXEGXXXQTX*NXXPLXHPPPPXXXXAXXXXXXRXXPXPX 812 P P P P P +P T P PP P P P Sbjct: 131 PQPTPSAPAPPPSYGPPQTPPPRPPPQPTPSAPAPSYGPPQPQPPAPQPPSPPSPQPGPE 190 Query: 813 XXP-----XTPPXXXXXPPXXXXPXXXXXPXXXXXXXXPP--XXXXXXXXPPXXXPXXPP 971 P P PP P P PP PP P P Sbjct: 191 YLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPPPPPPKPQPTPGYGPPTPPPGPGP 250 Query: 972 XXXXXRPPRP 1001 +PPRP Sbjct: 251 AQPAPQPPRP 260 Score = 31.5 bits (68), Expect = 1.9 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P PP P P P P P P P P PP P Sbjct: 303 PPAPPAGPTYQPRPPAPPAPAPGPTYQPRPPAPPAPAPGPTYQPRPPSPPAPPAPTYQPQ 362 Query: 980 P 982 P Sbjct: 363 P 363 Score = 31.1 bits (67), Expect = 2.5 Identities = 15/54 (27%), Positives = 16/54 (29%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P + PP P PP P P P P P P P P Sbjct: 61 PSAPAPSYGPPQTRPPPPPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAP 114 Score = 31.1 bits (67), Expect = 2.5 Identities = 15/52 (28%), Positives = 15/52 (28%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 P P P PP P PPP P PPP P P Sbjct: 114 PPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPPQPTPSAPAP 165 Score = 30.7 bits (66), Expect = 3.3 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +2 Query: 851 PXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXPXXXA 994 P PP PPP P P P P PP P P A Sbjct: 66 PSYGPPQTRPPPPPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPA 113 Score = 30.3 bits (65), Expect = 4.4 Identities = 22/91 (24%), Positives = 23/91 (25%), Gaps = 2/91 (2%) Frame = +3 Query: 735 PLXHPPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPP-XXXXPXXXXXPXXXXXXXX 911 P PP P P P P P PP P P Sbjct: 175 PAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPPPPPPKPQ 234 Query: 912 PPXXXXXXXXPPXXXPXXP-PXXXXXRPPRP 1001 P PP P P P +PPRP Sbjct: 235 PTPGYGPPTPPPGPGPAQPAPQPPRPQPPRP 265 Score = 29.9 bits (64), Expect = 5.8 Identities = 17/61 (27%), Positives = 17/61 (27%), Gaps = 1/61 (1%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXP-PXPXXXXX 979 P P P P P PP P P P P P P P P P Sbjct: 208 PPPPPPPRPQPTPGYGPPPPPPPPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPPRPQP 267 Query: 980 P 982 P Sbjct: 268 P 268 >AE014298-2542|AAF48711.1| 133|Drosophila melanogaster CG5172-PA, isoform A protein. Length = 133 Score = 36.3 bits (80), Expect = 0.067 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G GG G GGG G G GGG GG G GG G G Sbjct: 26 GGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGGSQG 76 Score = 29.5 bits (63), Expect = 7.7 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G G GGG G G G G GG Sbjct: 21 GLLGGGGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGG 72 >AE014298-2541|AAS65393.1| 95|Drosophila melanogaster CG5172-PB, isoform B protein. Length = 95 Score = 36.3 bits (80), Expect = 0.067 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G GG G GGG G G GGG GG G GG G G Sbjct: 26 GGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGGSQG 76 Score = 29.5 bits (63), Expect = 7.7 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G G GGG G G G G GG Sbjct: 21 GLLGGGGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGG 72 >AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA protein. Length = 420 Score = 36.3 bits (80), Expect = 0.067 Identities = 19/65 (29%), Positives = 19/65 (29%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P PP PP P P P PP P PP P Sbjct: 100 PPRPPPQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPPQPT 159 Query: 980 PXXXA 994 P A Sbjct: 160 PSAPA 164 Score = 35.1 bits (77), Expect = 0.15 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P PP PP P P P PP PP PP P Sbjct: 80 PPPQPTPPAPRPSYG-PPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPPRPPPQP 133 Score = 35.1 bits (77), Expect = 0.15 Identities = 22/74 (29%), Positives = 22/74 (29%), Gaps = 3/74 (4%) Frame = +2 Query: 770 GXPXXXXXXXPPXXPXXXHPXXXXXXPPXPXP---PXXXXPPPXXXXXPXPXXXPPPXXX 940 G P P P P P P P P PPP P P P P Sbjct: 168 GPPQPQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPP----PPPRPQPTPGYG 223 Query: 941 PPXXPPXPXXXXXP 982 PP PP P P Sbjct: 224 PPPPPPPPKPQPTP 237 Score = 34.3 bits (75), Expect = 0.27 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 1/66 (1%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPP-PXXXPPXXPPXPXXXX 976 PP P P PP P PP P P P P PP P P PP P Sbjct: 193 PPDQPKP-RPTPSRPQPPPPPPP---RPQPTPGYGPPPPPPPPKPQPTPGYGPPTPPPGP 248 Query: 977 XPXXXA 994 P A Sbjct: 249 GPAQPA 254 Score = 34.3 bits (75), Expect = 0.27 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 2/57 (3%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXP--PPXXXPPXXPPXP 964 PP P P PP P PP P P P P P P PP P Sbjct: 209 PPPPPPRPQPTPGYGPPPPPPPPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPPRP 265 Score = 33.5 bits (73), Expect = 0.47 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 PP P P P PP P P P PPP PP PP Sbjct: 75 PPPPPPPPQPTPPAPRPSY-GPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPP 126 Score = 33.1 bits (72), Expect = 0.63 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 4/57 (7%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPP---XXXXPPPXXXXXPXP-XXXPPPXXXPPXXPP 958 PP P P P PP PPP P P PPP PP PP Sbjct: 95 PPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPP 151 Score = 31.9 bits (69), Expect = 1.4 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 1/56 (1%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXP-XPXXXPPPXXXPPXXPPXP 964 P P P PP P PPP P P PPP P P P Sbjct: 87 PAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPP 142 Score = 31.9 bits (69), Expect = 1.4 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P PP PP PPP P P P P PP P Sbjct: 125 PPPRPPPQPTPSAPAPPPSYGPPQT--PPPRPPPQPTPSAPAPSYGPPQPQPPAPQPPSP 182 Query: 980 P 982 P Sbjct: 183 P 183 Score = 31.9 bits (69), Expect = 1.4 Identities = 29/130 (22%), Positives = 31/130 (23%), Gaps = 7/130 (5%) Frame = +3 Query: 633 PXPXPXXPXXXXXXXGPXSPXXEGXXXQTX*NXXPLXHPPPPXXXXAXXXXXXRXXPXPX 812 P P P P P +P T P PP P P P Sbjct: 131 PQPTPSAPAPPPSYGPPQTPPPRPPPQPTPSAPAPSYGPPQPQPPAPQPPSPPSPQPGPE 190 Query: 813 XXP-----XTPPXXXXXPPXXXXPXXXXXPXXXXXXXXPP--XXXXXXXXPPXXXPXXPP 971 P P PP P P PP PP P P Sbjct: 191 YLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPPPPPPKPQPTPGYGPPTPPPGPGP 250 Query: 972 XXXXXRPPRP 1001 +PPRP Sbjct: 251 AQPAPQPPRP 260 Score = 31.5 bits (68), Expect = 1.9 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P PP P P P P P P P P PP P Sbjct: 303 PPAPPAGPTYQPRPPAPPAPAPGPTYQPRPPAPPAPAPGPTYQPRPPSPPAPPAPTYQPQ 362 Query: 980 P 982 P Sbjct: 363 P 363 Score = 31.1 bits (67), Expect = 2.5 Identities = 15/54 (27%), Positives = 16/54 (29%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P + PP P PP P P P P P P P P Sbjct: 61 PSAPAPSYGPPQTRPPPPPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAP 114 Score = 31.1 bits (67), Expect = 2.5 Identities = 15/52 (28%), Positives = 15/52 (28%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 P P P PP P PPP P PPP P P Sbjct: 114 PPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPPQPTPSAPAP 165 Score = 30.7 bits (66), Expect = 3.3 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +2 Query: 851 PXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXPXXXA 994 P PP PPP P P P P PP P P A Sbjct: 66 PSYGPPQTRPPPPPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPA 113 Score = 30.3 bits (65), Expect = 4.4 Identities = 22/91 (24%), Positives = 23/91 (25%), Gaps = 2/91 (2%) Frame = +3 Query: 735 PLXHPPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPP-XXXXPXXXXXPXXXXXXXX 911 P PP P P P P P PP P P Sbjct: 175 PAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPPPPPPKPQ 234 Query: 912 PPXXXXXXXXPPXXXPXXP-PXXXXXRPPRP 1001 P PP P P P +PPRP Sbjct: 235 PTPGYGPPTPPPGPGPAQPAPQPPRPQPPRP 265 Score = 29.9 bits (64), Expect = 5.8 Identities = 17/61 (27%), Positives = 17/61 (27%), Gaps = 1/61 (1%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXP-PXPXXXXX 979 P P P P P PP P P P P P P P P P Sbjct: 208 PPPPPPPRPQPTPGYGPPPPPPPPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPPRPQP 267 Query: 980 P 982 P Sbjct: 268 P 268 >AE013599-3129|AAF46672.1| 237|Drosophila melanogaster CG4038-PA protein. Length = 237 Score = 36.3 bits (80), Expect = 0.067 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G GG GG GGG G GGG GG G GG Sbjct: 12 GGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGG 56 Score = 34.7 bits (76), Expect = 0.20 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 GG GG GGG G GGG GG G GG G G Sbjct: 9 GGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGG 57 Score = 33.1 bits (72), Expect = 0.63 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G GG G GGG G G GGG GG GG Sbjct: 13 GGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGG 57 Score = 32.7 bits (71), Expect = 0.83 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G GG GGG G G GGG G G GG Sbjct: 190 GGGRGGGGGRGGGGFRGGAGRNGGGGGGGGFNRGRGGGG 228 Score = 32.7 bits (71), Expect = 0.83 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXG 856 G G GG GG GG G G GGG GG G Sbjct: 194 GGGGGRGGGGFRGGAGRNGGGGGGGGFNRGRGGGGGGGGGRG 235 Score = 31.1 bits (67), Expect = 2.5 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = -3 Query: 942 GXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG-GXXXXXXGXXXXGXXGG 799 G GGG G G GGG GG G G G G G GG Sbjct: 4 GKPRGGGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGG 52 >BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p protein. Length = 592 Score = 35.9 bits (79), Expect = 0.089 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P PP PPP P PP PP P P Sbjct: 154 PPPPPPPPPPPPPPPPHSHPHSHHPHPPIVTPPIIVPIP 192 Score = 33.9 bits (74), Expect = 0.36 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P P PP PPP P PPP P P P Sbjct: 218 PPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPPGPYPGPWIPLPVPVPW 277 Query: 980 P 982 P Sbjct: 278 P 278 Score = 31.1 bits (67), Expect = 2.5 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +2 Query: 848 PPXPXPPXXXXP-PPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P P PP P PP P PPP PP PP P P Sbjct: 213 PGPPGPPGTGPPGPPGPPGTTYPQPPPPP---PPPPPPPPSYPYPP 255 Score = 29.9 bits (64), Expect = 5.8 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 PP P P PP PPP PP PP Sbjct: 212 PPGPPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPP 248 Score = 29.9 bits (64), Expect = 5.8 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +2 Query: 770 GXPXXXXXXXPPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPP 931 G P PP P P PP P PP P P P P P P Sbjct: 228 GPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPPGPYPGP---WIPLPVPVPWP 278 Score = 29.5 bits (63), Expect = 7.7 Identities = 16/61 (26%), Positives = 16/61 (26%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP H P PP P P P P PP PP P Sbjct: 194 PPQKGEHGHHHHHKGSKGPPGPPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPY 253 Query: 980 P 982 P Sbjct: 254 P 254 Score = 29.5 bits (63), Expect = 7.7 Identities = 15/52 (28%), Positives = 15/52 (28%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P PP P P P P P PP PP P P P Sbjct: 216 PGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPPGPYPGP 267 >AL031366-1|CAA20520.1| 809|Drosophila melanogaster EG:100G7.6 protein. Length = 809 Score = 35.9 bits (79), Expect = 0.089 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P PP PP P PP PP PP P Sbjct: 642 PPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPP 680 Score = 30.7 bits (66), Expect = 3.3 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 2/47 (4%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXP--PPXXXPPXXPPXPXXXXXP 982 P P PP PPP P P PP P PP P P Sbjct: 639 PSYPPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVPYP 685 >AE014298-3143|AAF50813.1| 183|Drosophila melanogaster CG10918-PA protein. Length = 183 Score = 35.9 bits (79), Expect = 0.089 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 1/66 (1%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXX-XGGXGXGGXXXXXXGXXXXGXXGGXXXX 787 G GG GG GGG G GGG GG G G G G GG Sbjct: 20 GGGGRRGGRGGGGGGGRSLGGFGGRGGGGFGGRGGPGGTGGPGGFGGPGRFGGPGGLGGG 79 Query: 786 XXXGXP 769 G P Sbjct: 80 GGFGGP 85 >AE014298-475|AAF45833.2| 887|Drosophila melanogaster CG3588-PB, isoform B protein. Length = 887 Score = 35.9 bits (79), Expect = 0.089 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P PP PP P PP PP PP P Sbjct: 782 PPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPP 820 Score = 30.7 bits (66), Expect = 3.3 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 2/47 (4%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXP--PPXXXPPXXPPXPXXXXXP 982 P P PP PPP P P PP P PP P P Sbjct: 779 PSYPPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVPYP 825 >AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA protein. Length = 594 Score = 35.9 bits (79), Expect = 0.089 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P PP PPP P PP PP P P Sbjct: 156 PPPPPPPPPPPPPPPPHSHPHSHHPHPPIVTPPIIVPIP 194 Score = 33.9 bits (74), Expect = 0.36 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P P PP PPP P PPP P P P Sbjct: 220 PPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPPGPYPGPWIPLPVPVPW 279 Query: 980 P 982 P Sbjct: 280 P 280 Score = 31.1 bits (67), Expect = 2.5 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +2 Query: 848 PPXPXPPXXXXP-PPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P P PP P PP P PPP PP PP P P Sbjct: 215 PGPPGPPGTGPPGPPGPPGTTYPQPPPPP---PPPPPPPPSYPYPP 257 Score = 29.9 bits (64), Expect = 5.8 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 PP P P PP PPP PP PP Sbjct: 214 PPGPPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPP 250 Score = 29.9 bits (64), Expect = 5.8 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +2 Query: 770 GXPXXXXXXXPPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPP 931 G P PP P P PP P PP P P P P P P Sbjct: 230 GPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPPGPYPGP---WIPLPVPVPWP 280 Score = 29.5 bits (63), Expect = 7.7 Identities = 16/61 (26%), Positives = 16/61 (26%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP H P PP P P P P PP PP P Sbjct: 196 PPQKGEHGHHHHHKGSKGPPGPPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPY 255 Query: 980 P 982 P Sbjct: 256 P 256 Score = 29.5 bits (63), Expect = 7.7 Identities = 15/52 (28%), Positives = 15/52 (28%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P PP P P P P P PP PP P P P Sbjct: 218 PGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPPGPYPGP 269 >U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous protein protein. Length = 1091 Score = 35.5 bits (78), Expect = 0.12 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 3/58 (5%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPP---XXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P PP P PP PPP P PPP P P P Sbjct: 539 PPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGPPPPPMMMGPMVPVLP 596 Score = 31.1 bits (67), Expect = 2.5 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 7/58 (12%) Frame = +2 Query: 812 PXXXHPXXXXXXPPXPXPPXXXX-----PPPXXXXXPXPXXXPPPXXXPP--XXPPXP 964 P P PP P PP PPP P PPP PP PP P Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPP 569 Score = 29.5 bits (63), Expect = 7.7 Identities = 18/65 (27%), Positives = 18/65 (27%), Gaps = 4/65 (6%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPP----XXXPPXXPPXPX 967 PP P PP P P PP P PPP P PP P Sbjct: 526 PPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGPPPPP 585 Query: 968 XXXXP 982 P Sbjct: 586 MMMGP 590 >BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p protein. Length = 1091 Score = 35.5 bits (78), Expect = 0.12 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 3/58 (5%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPP---XXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P PP P PP PPP P PPP P P P Sbjct: 539 PPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGPPPPPMMMGPMVPVLP 596 Score = 31.1 bits (67), Expect = 2.5 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 7/58 (12%) Frame = +2 Query: 812 PXXXHPXXXXXXPPXPXPPXXXX-----PPPXXXXXPXPXXXPPPXXXPP--XXPPXP 964 P P PP P PP PPP P PPP PP PP P Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPP 569 Score = 29.5 bits (63), Expect = 7.7 Identities = 18/65 (27%), Positives = 18/65 (27%), Gaps = 4/65 (6%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPP----XXXPPXXPPXPX 967 PP P PP P P PP P PPP P PP P Sbjct: 526 PPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGPPPPP 585 Query: 968 XXXXP 982 P Sbjct: 586 MMMGP 590 >BT011463-1|AAR99121.1| 212|Drosophila melanogaster RE25907p protein. Length = 212 Score = 35.5 bits (78), Expect = 0.12 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +2 Query: 824 HPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 HP P P PPP P P PPP PP PP P Sbjct: 69 HPRQYGYPPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPP--PPGP 113 >AY113383-1|AAM29388.1| 242|Drosophila melanogaster RE04770p protein. Length = 242 Score = 35.5 bits (78), Expect = 0.12 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +2 Query: 824 HPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 HP P P PPP P P PPP PP PP P Sbjct: 99 HPRQYGYPPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPP--PPGP 143 >AE014296-227|AAF47476.2| 242|Drosophila melanogaster CG9184-PA, isoform A protein. Length = 242 Score = 35.5 bits (78), Expect = 0.12 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +2 Query: 824 HPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 HP P P PPP P P PPP PP PP P Sbjct: 99 HPRQYGYPPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPP--PPGP 143 >AE014296-226|AAN11471.1| 212|Drosophila melanogaster CG9184-PB, isoform B protein. Length = 212 Score = 35.5 bits (78), Expect = 0.12 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +2 Query: 824 HPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 HP P P PPP P P PPP PP PP P Sbjct: 69 HPRQYGYPPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPP--PPGP 113 >AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB, isoform B protein. Length = 1091 Score = 35.5 bits (78), Expect = 0.12 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 3/58 (5%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPP---XXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P PP P PP PPP P PPP P P P Sbjct: 539 PPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGPPPPPMMMGPMVPVLP 596 Score = 31.1 bits (67), Expect = 2.5 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 7/58 (12%) Frame = +2 Query: 812 PXXXHPXXXXXXPPXPXPPXXXX-----PPPXXXXXPXPXXXPPPXXXPP--XXPPXP 964 P P PP P PP PPP P PPP PP PP P Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPP 569 Score = 29.5 bits (63), Expect = 7.7 Identities = 18/65 (27%), Positives = 18/65 (27%), Gaps = 4/65 (6%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPP----XXXPPXXPPXPX 967 PP P PP P P PP P PPP P PP P Sbjct: 526 PPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGPPPPP 585 Query: 968 XXXXP 982 P Sbjct: 586 MMMGP 590 >AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA, isoform A protein. Length = 1091 Score = 35.5 bits (78), Expect = 0.12 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 3/58 (5%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPP---XXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P PP P PP PPP P PPP P P P Sbjct: 539 PPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGPPPPPMMMGPMVPVLP 596 Score = 31.1 bits (67), Expect = 2.5 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 7/58 (12%) Frame = +2 Query: 812 PXXXHPXXXXXXPPXPXPPXXXX-----PPPXXXXXPXPXXXPPPXXXPP--XXPPXP 964 P P PP P PP PPP P PPP PP PP P Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPP 569 Score = 29.5 bits (63), Expect = 7.7 Identities = 18/65 (27%), Positives = 18/65 (27%), Gaps = 4/65 (6%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPP----XXXPPXXPPXPX 967 PP P PP P P PP P PPP P PP P Sbjct: 526 PPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGPPPPP 585 Query: 968 XXXXP 982 P Sbjct: 586 MMMGP 590 >AE014298-9|AAX52465.1| 193|Drosophila melanogaster CG13376-PA protein. Length = 193 Score = 34.7 bits (76), Expect = 0.20 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G GG GG GGG G G GGG GG G G G G Sbjct: 63 GGGWSSGGGGGGGGWSSGGG-GGGGGWSSGGGGGGWSSGGGGGSGSDVKLIKIISLGGGG 121 Query: 801 G 799 G Sbjct: 122 G 122 Score = 33.5 bits (73), Expect = 0.47 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G GG GG GGG G GGG G G GG Sbjct: 58 GGGGGGGGWSSGGGGGGGGWSSGGGGGGGGWSSGGGGGG 96 Score = 32.3 bits (70), Expect = 1.1 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G G GGG GG G GG G GG Sbjct: 55 GSSGGGGGGGGWSSGGGGG---GGGWSSGGGGGGGGWSSGGGGGGWSSGGGG 103 >AE014296-862|AAF47912.1| 707|Drosophila melanogaster CG13722-PA protein. Length = 707 Score = 34.7 bits (76), Expect = 0.20 Identities = 20/63 (31%), Positives = 21/63 (33%), Gaps = 2/63 (3%) Frame = +2 Query: 800 PPXXPXXXH--PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXX 973 PP P + P PP PP PP P P PPP P PP P Sbjct: 418 PPPQPKSGYDYPKPAIPFPPPTNPPQKYLPPVVPTSPPQPKYLPPP---KPTNPPQPKYL 474 Query: 974 XXP 982 P Sbjct: 475 PPP 477 Score = 33.5 bits (73), Expect = 0.47 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +2 Query: 824 HPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 +P PP PP PP P P PPP P PP P P Sbjct: 371 YPKPAVPFPPPTNPPQKYLPPVVPTTPPQPKYLPPP---KPTNPPQPKYLPPP 420 Score = 33.1 bits (72), Expect = 0.63 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +2 Query: 824 HPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 +P PP PP PP P P PPP P PP P Sbjct: 227 YPKPAIPFPPPTNPPQKYLPPVVPTSPPVPKYVPPP--TPTYIPPPP 271 Score = 33.1 bits (72), Expect = 0.63 Identities = 22/91 (24%), Positives = 23/91 (25%) Frame = +2 Query: 674 PGPRFPFXXGXXXPNXIKXXXXXXXXXXXXXXGXPXXXXXXXPPXXPXXXHPXXXXXXPP 853 P P PF P P PP +P PP Sbjct: 228 PKPAIPFPPPTNPPQKYLPPVVPTSPPVPKYVPPPTPTYIPPPPKKQGYDYPKPAIPFPP 287 Query: 854 XPXPPXXXXPPPXXXXXPXPXXXPPPXXXPP 946 PP PP P P PPP PP Sbjct: 288 PTAPPQKYLPPVTTTQAPPP---PPPKYLPP 315 Score = 30.7 bits (66), Expect = 3.3 Identities = 15/53 (28%), Positives = 16/53 (30%) Frame = +2 Query: 824 HPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 +P PP PP PP P P PPP P P P Sbjct: 636 YPKPAIPFPPPTNPPQKYIPPVVPTSPPTPKYLPPPQVKQGYDYPKPVIPFPP 688 Score = 29.9 bits (64), Expect = 5.8 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 2/57 (3%) Frame = +2 Query: 800 PPXXPXXXH--PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P + P P PP PPP P P P PP PP P Sbjct: 475 PPPQPKSGYDYPKPAIPFPAPTNPPQKYLPPPVIPTSP-----PVPKYLPPTNPPTP 526 >AE014134-733|AAO41157.1| 579|Drosophila melanogaster CG33003-PA protein. Length = 579 Score = 34.7 bits (76), Expect = 0.20 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPP 931 PP P PP PPP P P PPP Sbjct: 463 PPPPPPPPPPPPPPPPPTEPPPPPPPPP 490 Score = 34.7 bits (76), Expect = 0.20 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 881 PPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PPP P P PPP PP PP P Sbjct: 463 PPPPPPPPPPPPPPPPPTEPPPPPPPPP 490 Score = 32.7 bits (71), Expect = 0.83 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +2 Query: 824 HPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 HP P PP PPP P P PPP PP PP P Sbjct: 453 HPHHHHHVHHPPPPPPPPPPPP----PPPPPTEPPP---PPPPPPEP 492 >BT003564-1|AAO39568.1| 468|Drosophila melanogaster LP03989p protein. Length = 468 Score = 34.3 bits (75), Expect = 0.27 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 851 PXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P P PPP P P PPP P PP P P Sbjct: 174 PAPAAAPKPAPPPPAAGAPKPPPPPPPKAAPRPPPPAPVAALKP 217 >AY089515-1|AAL90253.1| 468|Drosophila melanogaster GM01350p protein. Length = 468 Score = 34.3 bits (75), Expect = 0.27 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 851 PXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P P PPP P P PPP P PP P P Sbjct: 174 PAPAAAPKPAPPPPAAGAPKPPPPPPPKAAPRPPPPAPVAALKP 217 >AE014297-1625|AAF54898.1| 460|Drosophila melanogaster CG11670-PA protein. Length = 460 Score = 34.3 bits (75), Expect = 0.27 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 851 PXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 P P P PPP P PPP PP PP Sbjct: 44 PVPDPTRPPPPPPSPPCGRPPPGSPPPGPPPPGPPP 79 Score = 31.9 bits (69), Expect = 1.4 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +2 Query: 824 HPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 +P P P P PPP P P PP PP PP P Sbjct: 33 YPEPYRNPNPNPVPDPTRPPPPP----PSPPCGRPPPGSPPPGPPPP 75 Score = 30.7 bits (66), Expect = 3.3 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXP 955 P PP P PP PP P P PP P P Sbjct: 46 PDPTRPPPPPPSPPCGRPPPGSPPPGPPPPGPPPGCPGGPGGP 88 Score = 30.7 bits (66), Expect = 3.3 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P PPP P PPP PP P P Sbjct: 52 PPPPPSPPCGRPPPGS-----PPPGPPPPGPPPGCPGGP 85 >AE014297-1281|AAF54625.1| 468|Drosophila melanogaster CG5214-PA protein. Length = 468 Score = 34.3 bits (75), Expect = 0.27 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 851 PXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P P PPP P P PPP P PP P P Sbjct: 174 PAPAAAPKPAPPPPAAGAPKPPPPPPPKAAPRPPPPAPVAALKP 217 >BT025941-1|ABG02185.1| 207|Drosophila melanogaster IP14143p protein. Length = 207 Score = 33.9 bits (74), Expect = 0.36 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 4/41 (9%) Frame = +2 Query: 848 PPXPXPPXXXXPPP----XXXXXPXPXXXPPPXXXPPXXPP 958 PP P PP PPP P P P P PP PP Sbjct: 53 PPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPP 93 Score = 32.7 bits (71), Expect = 0.83 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P P PP P P P P PPP PP PP P Sbjct: 50 PAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPP--PPDP 101 Score = 31.5 bits (68), Expect = 1.9 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 6/52 (11%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPP---PXXXXXPXPXXXPPPXXX---PPXXPPXP 964 P PP P PP PP P P P PPP PP P P Sbjct: 53 PPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPATP 104 >BT025938-1|ABG02182.1| 207|Drosophila melanogaster IP14043p protein. Length = 207 Score = 33.9 bits (74), Expect = 0.36 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 4/41 (9%) Frame = +2 Query: 848 PPXPXPPXXXXPPP----XXXXXPXPXXXPPPXXXPPXXPP 958 PP P PP PPP P P P P PP PP Sbjct: 53 PPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPP 93 Score = 32.7 bits (71), Expect = 0.83 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P P PP P P P P PPP PP PP P Sbjct: 50 PAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPP--PPDP 101 Score = 31.5 bits (68), Expect = 1.9 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 6/52 (11%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPP---PXXXXXPXPXXXPPPXXX---PPXXPPXP 964 P PP P PP PP P P P PPP PP P P Sbjct: 53 PPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPATP 104 >AY069683-1|AAL39828.1| 993|Drosophila melanogaster LD45449p protein. Length = 993 Score = 33.9 bits (74), Expect = 0.36 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = +2 Query: 812 PXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P H PP P P PPP P P PPP P P P P Sbjct: 117 PHIQHKPAQQYGPPPPKPAPQYGPPPQ----PAPQYGPPPPKPAPQYGPPPTQYGPP 169 >AE014298-2035|AAF48374.1| 993|Drosophila melanogaster CG9411-PA protein. Length = 993 Score = 33.9 bits (74), Expect = 0.36 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = +2 Query: 812 PXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P H PP P P PPP P P PPP P P P P Sbjct: 117 PHIQHKPAQQYGPPPPKPAPQYGPPPQ----PAPQYGPPPPKPAPQYGPPPTQYGPP 169 >AE014134-759|AAF50995.3| 1118|Drosophila melanogaster CG15635-PA protein. Length = 1118 Score = 33.9 bits (74), Expect = 0.36 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 812 PXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 P P PP P PP PP P P P P PP PP Sbjct: 29 PSAPAPPPKPRPPPPPPPPPTTTRPP--TTTPTPTTTPTPITTPPPPPP 75 Score = 32.7 bits (71), Expect = 0.83 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P P PP P P P P PPP PP PP P Sbjct: 32 PAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPP--PPDP 83 Score = 31.5 bits (68), Expect = 1.9 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 6/52 (11%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPP---PXXXXXPXPXXXPPPXXX---PPXXPPXP 964 P PP P PP PP P P P PPP PP P P Sbjct: 35 PPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPATP 86 >BT028801-1|ABI34182.1| 286|Drosophila melanogaster LP21747p protein. Length = 286 Score = 33.5 bits (73), Expect = 0.47 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G GG G GGG G G GGG GG G GG G G Sbjct: 71 GGFSSGGGGGFSSGVGGGGGGGFGGGFGGGSGGGS--GGGFGGGGSIGGFGGGGGGG 125 Score = 32.7 bits (71), Expect = 0.83 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G G GG GGG G GGG GG G G G G G Sbjct: 59 GFGGGFGGGSGGGGFSSGGG--GGFSSGVGGGGGGGFGGGFGGGSGGGSGGGFGGGGSIG 116 Query: 801 G 799 G Sbjct: 117 G 117 Score = 31.1 bits (67), Expect = 2.5 Identities = 20/64 (31%), Positives = 20/64 (31%), Gaps = 3/64 (4%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGG---GXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G GG GG GG G G G G G G GG G G Sbjct: 33 GGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGVGGGGGGG 92 Query: 810 XXGG 799 GG Sbjct: 93 FGGG 96 Score = 31.1 bits (67), Expect = 2.5 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 4/65 (6%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGG----XXXXGGXGXGGXXXXXXGXXXX 814 G G GG GG GGG G G GG GG G GG G Sbjct: 45 GGGSSGGFGGGIGGGF-GGGFGGGSGGGGFSSGGGGGFSSGVGGGGGGGFGGGFGGGSGG 103 Query: 813 GXXGG 799 G GG Sbjct: 104 GSGGG 108 Score = 29.9 bits (64), Expect = 5.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGG 880 G G GG GG GGG G G GGG Sbjct: 94 GGGFGGGSGGGSGGGFGGGGSIGGFGGGGGGGGG 127 Score = 29.5 bits (63), Expect = 7.7 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -3 Query: 930 GGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GGG G G GGG G GG G G GG Sbjct: 27 GGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGG 70 >BT004875-1|AAO45231.1| 399|Drosophila melanogaster LD22761p protein. Length = 399 Score = 33.5 bits (73), Expect = 0.47 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXG---XXXXXGGGXXXXGGXGXGG 847 G G GG GG GGG G G GGG GG G GG Sbjct: 219 GGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGG 266 >AE014298-2351|AAN09389.1| 399|Drosophila melanogaster CG3606-PB, isoform B protein. Length = 399 Score = 33.5 bits (73), Expect = 0.47 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXG---XXXXXGGGXXXXGGXGXGG 847 G G GG GG GGG G G GGG GG G GG Sbjct: 219 GGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGG 266 >AE014298-2350|AAF48578.2| 399|Drosophila melanogaster CG3606-PA, isoform A protein. Length = 399 Score = 33.5 bits (73), Expect = 0.47 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXG---XXXXXGGGXXXXGGXGXGG 847 G G GG GG GGG G G GGG GG G GG Sbjct: 219 GGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGG 266 >AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-PA protein. Length = 1644 Score = 33.1 bits (72), Expect = 0.63 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P PP P P PPP P PPP PP P Sbjct: 259 PSQPVGVSAKTTPPPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPP 312 >AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. Length = 1644 Score = 33.1 bits (72), Expect = 0.63 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P PP P P PPP P PPP PP P Sbjct: 259 PSQPVGVSAKTTPPPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPP 312 >DQ539309-1|ABG02830.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 32.7 bits (71), Expect = 0.83 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G GGG GG G G G G GG Sbjct: 204 GVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGG 255 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G G GG GGG G G GGG GG G GG G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGGG--GHSGGGSGIGGGPGFGGGIGGGGGHSGGG 179 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G G GG GGG G G GGG G G G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGG 317 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG G G G G G GGG GG G GG G G G Sbjct: 126 GGIGDGPGFGSGGYSGGGGGI-GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSG 177 Score = 29.9 bits (64), Expect = 5.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXX-XGGXGXGGXXXXXXGXXXXG 811 G GG G G G G G GGG GG G GG G G Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGSG 196 >DQ539308-1|ABG02829.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 32.7 bits (71), Expect = 0.83 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G GGG GG G G G G GG Sbjct: 204 GVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGG 255 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G G GG GGG G G GGG GG G GG G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGGG--GHSGGGSGIGGGPGFGGGIGGGGGHSGGG 179 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G G GG GGG G G GGG G G G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGG 317 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG G G G G G GGG GG G GG G G G Sbjct: 126 GGIGDGPGFGSGGYSGGGGGI-GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSG 177 Score = 29.9 bits (64), Expect = 5.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXX-XGGXGXGGXXXXXXGXXXXG 811 G GG G G G G G GGG GG G GG G G Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGSG 196 >DQ539307-1|ABG02828.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 32.7 bits (71), Expect = 0.83 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G GGG GG G G G G GG Sbjct: 204 GVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGG 255 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G G GG GGG G G GGG GG G GG G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGGG--GHSGGGSGIGGGPGFGGGIGGGGGHSGGG 179 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G G GG GGG G G GGG G G G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGG 317 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG G G G G G GGG GG G GG G G G Sbjct: 126 GGIGDGPGFGSGGYSGGGGGI-GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSG 177 Score = 29.9 bits (64), Expect = 5.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXX-XGGXGXGGXXXXXXGXXXXG 811 G GG G G G G G GGG GG G GG G G Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGSG 196 >DQ539306-1|ABG02827.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 32.7 bits (71), Expect = 0.83 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G GGG GG G G G G GG Sbjct: 204 GVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGG 255 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G G GG GGG G G GGG GG G GG G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGGG--GHSGGGSGIGGGPGFGGGIGGGGGHSGGG 179 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G G GG GGG G G GGG G G G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGG 317 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG G G G G G GGG GG G GG G G G Sbjct: 126 GGIGDGPGFGSGGYSGGGGGI-GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSG 177 Score = 29.9 bits (64), Expect = 5.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXX-XGGXGXGGXXXXXXGXXXXG 811 G GG G G G G G GGG GG G GG G G Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGSG 196 >DQ539305-1|ABG02826.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 32.7 bits (71), Expect = 0.83 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G GGG GG G G G G GG Sbjct: 204 GVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGG 255 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G G GG GGG G G GGG GG G GG G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGGG--GHSGGGSGIGGGPGFGGGIGGGGGHSGGG 179 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G G GG GGG G G GGG G G G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGG 317 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG G G G G G GGG GG G GG G G G Sbjct: 126 GGIGDGPGFGSGGYSGGGGGI-GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSG 177 Score = 29.9 bits (64), Expect = 5.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXX-XGGXGXGGXXXXXXGXXXXG 811 G GG G G G G G GGG GG G GG G G Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGSG 196 >DQ539304-1|ABG02825.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 32.7 bits (71), Expect = 0.83 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G GGG GG G G G G GG Sbjct: 204 GVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGG 255 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G G GG GGG G G GGG GG G GG G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGGG--GHSGGGSGIGGGPGFGGGIGGGGGHSGGG 179 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G G GG GGG G G GGG G G G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGG 317 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG G G G G G GGG GG G GG G G G Sbjct: 126 GGIGDGPGFGSGGYSGGGGGI-GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSG 177 Score = 29.9 bits (64), Expect = 5.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXX-XGGXGXGGXXXXXXGXXXXG 811 G GG G G G G G GGG GG G GG G G Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGSG 196 >DQ539303-1|ABG02824.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 32.7 bits (71), Expect = 0.83 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G GGG GG G G G G GG Sbjct: 204 GVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGG 255 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G G GG GGG G G GGG GG G GG G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGGG--GHSGGGSGIGGGPGFGGGIGGGGGHSGGG 179 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G G GG GGG G G GGG G G G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGG 317 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG G G G G G GGG GG G GG G G G Sbjct: 126 GGIGDGPGFGSGGYSGGGGGI-GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSG 177 Score = 29.9 bits (64), Expect = 5.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXX-XGGXGXGGXXXXXXGXXXXG 811 G GG G G G G G GGG GG G GG G G Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGSG 196 >DQ539302-1|ABG02823.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 32.7 bits (71), Expect = 0.83 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G GGG GG G G G G GG Sbjct: 204 GVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGG 255 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G G GG GGG G G GGG GG G GG G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGGG--GHSGGGSGIGGGPGFGGGIGGGGGHSGGG 179 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G G GG GGG G G GGG G G G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGG 317 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG G G G G G GGG GG G GG G G G Sbjct: 126 GGIGDGPGFGSGGYSGGGGGI-GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSG 177 Score = 29.9 bits (64), Expect = 5.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXX-XGGXGXGGXXXXXXGXXXXG 811 G GG G G G G G GGG GG G GG G G Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGSG 196 >DQ539301-1|ABG02822.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 32.7 bits (71), Expect = 0.83 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G GGG GG G G G G GG Sbjct: 204 GVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGG 255 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G G GG GGG G G GGG GG G GG G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGGG--GHSGGGSGIGGGPGFGGGIGGGGGHSGGG 179 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G G GG GGG G G GGG G G G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGG 317 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG G G G G G GGG GG G GG G G G Sbjct: 126 GGIGDGPGFGSGGYSGGGGGI-GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSG 177 Score = 29.9 bits (64), Expect = 5.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXX-XGGXGXGGXXXXXXGXXXXG 811 G GG G G G G G GGG GG G GG G G Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGSG 196 >DQ539300-1|ABG02821.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 32.7 bits (71), Expect = 0.83 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G GGG GG G G G G GG Sbjct: 204 GVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGG 255 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G G GG GGG G G GGG GG G GG G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGGG--GHSGGGSGIGGGPGFGGGIGGGGGHSGGG 179 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G G GG GGG G G GGG G G G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGG 317 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG G G G G G GGG GG G GG G G G Sbjct: 126 GGIGDGPGFGSGGYSGGGGGI-GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSG 177 Score = 29.9 bits (64), Expect = 5.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXX-XGGXGXGGXXXXXXGXXXXG 811 G GG G G G G G GGG GG G GG G G Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGSG 196 >DQ539299-1|ABG02820.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 32.7 bits (71), Expect = 0.83 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G GGG GG G G G G GG Sbjct: 204 GVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGG 255 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G G GG GGG G G GGG GG G GG G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGGG--GHSGGGSGIGGGPGFGGGIGGGGGHSGGG 179 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G G GG GGG G G GGG G G G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGG 317 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG G G G G G GGG GG G GG G G G Sbjct: 126 GGIGDGPGFGSGGYSGGGGGI-GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSG 177 Score = 29.9 bits (64), Expect = 5.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXX-XGGXGXGGXXXXXXGXXXXG 811 G GG G G G G G GGG GG G GG G G Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGSG 196 >DQ539298-1|ABG02819.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 32.7 bits (71), Expect = 0.83 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G GGG GG G G G G GG Sbjct: 204 GVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGG 255 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G G GG GGG G G GGG GG G GG G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGGG--GHSGGGSGIGGGPGFGGGIGGGGGHSGGG 179 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G G GG GGG G G GGG G G G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGG 317 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG G G G G G GGG GG G GG G G G Sbjct: 126 GGIGDGPGFGSGGYSGGGGGI-GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSG 177 Score = 29.9 bits (64), Expect = 5.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXX-XGGXGXGGXXXXXXGXXXXG 811 G GG G G G G G GGG GG G GG G G Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGSG 196 >DQ539297-1|ABG02818.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 32.7 bits (71), Expect = 0.83 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G GGG GG G G G G GG Sbjct: 204 GVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGG 255 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G G GG GGG G G GGG GG G GG G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGGG--GHSGGGSGIGGGPGFGGGIGGGGGHSGGG 179 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G G GG GGG G G GGG G G G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGG 317 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG G G G G G GGG GG G GG G G G Sbjct: 126 GGIGDGPGFGSGGYSGGGGGI-GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSG 177 Score = 29.9 bits (64), Expect = 5.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXX-XGGXGXGGXXXXXXGXXXXG 811 G GG G G G G G GGG GG G GG G G Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGSG 196 >DQ539296-1|ABG02817.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 32.7 bits (71), Expect = 0.83 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G GGG GG G G G G GG Sbjct: 204 GVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGG 255 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G G GG GGG G G GGG GG G GG G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGGG--GHSGGGSGIGGGPGFGGGIGGGGGHSGGG 179 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G G GG GGG G G GGG G G G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGG 317 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG G G G G G GGG GG G GG G G G Sbjct: 126 GGIGDGPGFGSGGYSGGGGGI-GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSG 177 Score = 29.9 bits (64), Expect = 5.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXX-XGGXGXGGXXXXXXGXXXXG 811 G GG G G G G G GGG GG G GG G G Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGSG 196 >DQ539295-1|ABG02816.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 32.7 bits (71), Expect = 0.83 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G GGG GG G G G G GG Sbjct: 204 GVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGG 255 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G G GG GGG G G GGG GG G GG G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGGG--GHSGGGSGIGGGPGFGGGIGGGGGHSGGG 179 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G G GG GGG G G GGG G G G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGG 317 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG G G G G G GGG GG G GG G G G Sbjct: 126 GGIGDGPGFGSGGYSGGGGGI-GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSG 177 Score = 29.9 bits (64), Expect = 5.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXX-XGGXGXGGXXXXXXGXXXXG 811 G GG G G G G G GGG GG G GG G G Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGSG 196 >DQ539294-1|ABG02815.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 32.7 bits (71), Expect = 0.83 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G GGG GG G G G G GG Sbjct: 204 GVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGG 255 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G G GG GGG G G GGG GG G GG G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGGG--GHSGGGSGIGGGPGFGGGIGGGGGHSGGG 179 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G G GG GGG G G GGG G G G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGG 317 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG G G G G G GGG GG G GG G G G Sbjct: 126 GGIGDGPGFGSGGYSGGGGGI-GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSG 177 Score = 29.9 bits (64), Expect = 5.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXX-XGGXGXGGXXXXXXGXXXXG 811 G GG G G G G G GGG GG G GG G G Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGSG 196 >DQ539293-1|ABG02814.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 32.7 bits (71), Expect = 0.83 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G GGG GG G G G G GG Sbjct: 204 GVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGG 255 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G G GG GGG G G GGG GG G GG G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGGG--GHSGGGSGIGGGPGFGGGIGGGGGHSGGG 179 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G G GG GGG G G GGG G G G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGG 317 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG G G G G G GGG GG G GG G G G Sbjct: 126 GGIGDGPGFGSGGYSGGGGGI-GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSG 177 Score = 29.9 bits (64), Expect = 5.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXX-XGGXGXGGXXXXXXGXXXXG 811 G GG G G G G G GGG GG G GG G G Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGSG 196 >DQ539292-1|ABG02813.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 32.7 bits (71), Expect = 0.83 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G GGG GG G G G G GG Sbjct: 204 GVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGG 255 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G G GG GGG G G GGG GG G GG G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGGG--GHSGGGSGIGGGPGFGGGIGGGGGHSGGG 179 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G G GG GGG G G GGG G G G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGG 317 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG G G G G G GGG GG G GG G G G Sbjct: 126 GGIGDGPGFGSGGYSGGGGGI-GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSG 177 Score = 29.9 bits (64), Expect = 5.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXX-XGGXGXGGXXXXXXGXXXXG 811 G GG G G G G G GGG GG G GG G G Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGSG 196 >DQ539291-1|ABG02812.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 32.7 bits (71), Expect = 0.83 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G GGG GG G G G G GG Sbjct: 204 GVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGG 255 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G G GG GGG G G GGG GG G GG G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGGG--GHSGGGSGIGGGPGFGGGIGGGGGHSGGG 179 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G G GG GGG G G GGG G G G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGG 317 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG G G G G G GGG GG G GG G G G Sbjct: 126 GGIGDGPGFGSGGYSGGGGGI-GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSG 177 Score = 29.9 bits (64), Expect = 5.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXX-XGGXGXGGXXXXXXGXXXXG 811 G GG G G G G G GGG GG G GG G G Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGSG 196 >DQ539290-1|ABG02811.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 32.7 bits (71), Expect = 0.83 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G GGG GG G G G G GG Sbjct: 204 GVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGG 255 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G G GG GGG G G GGG GG G GG G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGGG--GHSGGGSGIGGGPGFGGGIGGGGGHSGGG 179 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G G GG GGG G G GGG G G G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGG 317 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG G G G G G GGG GG G GG G G G Sbjct: 126 GGIGDGPGFGSGGYSGGGGGI-GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSG 177 Score = 29.9 bits (64), Expect = 5.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXX-XGGXGXGGXXXXXXGXXXXG 811 G GG G G G G G GGG GG G GG G G Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGSG 196 >DQ539289-1|ABG02810.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 32.7 bits (71), Expect = 0.83 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G GGG GG G G G G GG Sbjct: 204 GVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGG 255 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G G GG GGG G G GGG GG G GG G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGGG--GHSGGGSGIGGGPGFGGGIGGGGGHSGGG 179 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G G GG GGG G G GGG G G G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGG 317 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG G G G G G GGG GG G GG G G G Sbjct: 126 GGIGDGPGFGSGGYSGGGGGI-GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSG 177 Score = 29.9 bits (64), Expect = 5.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXX-XGGXGXGGXXXXXXGXXXXG 811 G GG G G G G G GGG GG G GG G G Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGSG 196 >DQ539288-1|ABG02809.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 32.7 bits (71), Expect = 0.83 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G GGG GG G G G G GG Sbjct: 204 GVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGG 255 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G G GG GGG G G GGG GG G GG G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGGG--GHSGGGSGIGGGPGFGGGIGGGGGHSGGG 179 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G G GG GGG G G GGG G G G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGG 317 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG G G G G G GGG GG G GG G G G Sbjct: 126 GGIGDGPGFGSGGYSGGGGGI-GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSG 177 Score = 29.9 bits (64), Expect = 5.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXX-XGGXGXGGXXXXXXGXXXXG 811 G GG G G G G G GGG GG G GG G G Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGSG 196 >DQ539287-1|ABG02808.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 32.7 bits (71), Expect = 0.83 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G GGG GG G G G G GG Sbjct: 204 GVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGG 255 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G G GG GGG G G GGG GG G GG G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGGG--GHSGGGSGIGGGPGFGGGIGGGGGHSGGG 179 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G G GG GGG G G GGG G G G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGG 317 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG G G G G G GGG GG G GG G G G Sbjct: 126 GGIGDGPGFGSGGYSGGGGGI-GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSG 177 Score = 29.9 bits (64), Expect = 5.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXX-XGGXGXGGXXXXXXGXXXXG 811 G GG G G G G G GGG GG G GG G G Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGSG 196 >DQ539286-1|ABG02807.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 32.7 bits (71), Expect = 0.83 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G GGG GG G G G G GG Sbjct: 204 GVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGG 255 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G G GG GGG G G GGG GG G GG G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGGG--GHSGGGSGIGGGPGFGGGIGGGGGHSGGG 179 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G G GG GGG G G GGG G G G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGG 317 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG G G G G G GGG GG G GG G G G Sbjct: 126 GGIGDGPGFGSGGYSGGGGGI-GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSG 177 Score = 29.9 bits (64), Expect = 5.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXX-XGGXGXGGXXXXXXGXXXXG 811 G GG G G G G G GGG GG G GG G G Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGSG 196 >DQ539285-1|ABG02806.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 32.7 bits (71), Expect = 0.83 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G GGG GG G G G G GG Sbjct: 204 GVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGG 255 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G G GG GGG G G GGG GG G GG G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGGG--GHSGGGSGIGGGPGFGGGIGGGGGHSGGG 179 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G G GG GGG G G GGG G G G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGG 317 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG G G G G G GGG GG G GG G G G Sbjct: 126 GGIGDGPGFGSGGYSGGGGGI-GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSG 177 Score = 29.9 bits (64), Expect = 5.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXX-XGGXGXGGXXXXXXGXXXXG 811 G GG G G G G G GGG GG G GG G G Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGSG 196 >DQ539284-1|ABG02805.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 32.7 bits (71), Expect = 0.83 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G GGG GG G G G G GG Sbjct: 204 GVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGG 255 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G G GG GGG G G GGG GG G GG G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGGG--GHSGGGSGIGGGPGFGGGIGGGGGHSGGG 179 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G G GG GGG G G GGG G G G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGG 317 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG G G G G G GGG GG G GG G G G Sbjct: 126 GGIGDGPGFGSGGYSGGGGGI-GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSG 177 Score = 29.9 bits (64), Expect = 5.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXX-XGGXGXGGXXXXXXGXXXXG 811 G GG G G G G G GGG GG G GG G G Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGSG 196 >DQ539283-1|ABG02804.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 32.7 bits (71), Expect = 0.83 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G GGG GG G G G G GG Sbjct: 204 GVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGG 255 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G G GG GGG G G GGG GG G GG G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGGG--GHSGGGSGIGGGPGFGGGIGGGGGHSGGG 179 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G G GG GGG G G GGG G G G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGG 317 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG G G G G G GGG GG G GG G G G Sbjct: 126 GGIGDGPGFGSGGYSGGGGGI-GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSG 177 Score = 29.9 bits (64), Expect = 5.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXX-XGGXGXGGXXXXXXGXXXXG 811 G GG G G G G G GGG GG G GG G G Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGSG 196 >DQ539282-1|ABG02803.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 32.7 bits (71), Expect = 0.83 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G GGG GG G G G G GG Sbjct: 204 GVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGG 255 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G G GG GGG G G GGG GG G GG G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGGG--GHSGGGSGIGGGPGFGGGIGGGGGHSGGG 179 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G G GG GGG G G GGG G G G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGG 317 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG G G G G G GGG GG G GG G G G Sbjct: 126 GGIGDGPGFGSGGYSGGGGGI-GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSG 177 Score = 29.9 bits (64), Expect = 5.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXX-XGGXGXGGXXXXXXGXXXXG 811 G GG G G G G G GGG GG G GG G G Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGSG 196 >DQ539281-1|ABG02802.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 32.7 bits (71), Expect = 0.83 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G GGG GG G G G G GG Sbjct: 204 GVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGG 255 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G G GG GGG G G GGG GG G GG G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGGG--GHSGGGSGIGGGPGFGGGIGGGGGHSGGG 179 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G G GG GGG G G GGG G G G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGG 317 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG G G G G G GGG GG G GG G G G Sbjct: 126 GGIGDGPGFGSGGYSGGGGGI-GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSG 177 Score = 29.9 bits (64), Expect = 5.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXX-XGGXGXGGXXXXXXGXXXXG 811 G GG G G G G G GGG GG G GG G G Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGSG 196 >BT030113-1|ABN49252.1| 342|Drosophila melanogaster IP06991p protein. Length = 342 Score = 32.7 bits (71), Expect = 0.83 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G GGG GG G G G G GG Sbjct: 204 GVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGG 255 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G G GG GGG G G GGG GG G GG G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGGG--GHSGGGSGIGGGPGFGGGIGGGGGHSGGG 179 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G G GG GGG G G GGG G G G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGG 317 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG G G G G G GGG GG G GG G G G Sbjct: 126 GGIGDGPGFGSGGYSGGGGGI-GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSG 177 Score = 29.9 bits (64), Expect = 5.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXX-XGGXGXGGXXXXXXGXXXXG 811 G GG G G G G G GGG GG G GG G G Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGSG 196 >BT011144-1|AAR82812.1| 356|Drosophila melanogaster GH24939p protein. Length = 356 Score = 32.7 bits (71), Expect = 0.83 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G GGG GG G G G G GG Sbjct: 218 GVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGG 269 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G G GG GGG G G GGG GG G GG G G Sbjct: 139 GGGIGDGPGFGSGGYSGGGGGIGGGG--GHSGGGSGIGGGPGFGGGIGGGGGHSGGG 193 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G G GG GGG G G GGG G G G Sbjct: 288 GGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGG 331 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG G G G G G GGG GG G GG G G G Sbjct: 140 GGIGDGPGFGSGGYSGGGGGI-GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSG 191 Score = 29.9 bits (64), Expect = 5.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXX-XGGXGXGGXXXXXXGXXXXG 811 G GG G G G G G GGG GG G GG G G Sbjct: 159 GIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGSG 210 >AE014297-3551|AAF56299.2| 290|Drosophila melanogaster CG13615-PA protein. Length = 290 Score = 32.7 bits (71), Expect = 0.83 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 866 PXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P PPP P P PPP PP P P Sbjct: 68 PKAKLPPPPPPPPPPPPPPPPPPPSPPGVPANP 100 Score = 30.3 bits (65), Expect = 4.4 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P PP PPP P P P P PP P Sbjct: 73 PPPPPPPPPPPPPP----PPPPPSPPGVPANPVSLPPQP 107 Score = 29.9 bits (64), Expect = 5.8 Identities = 16/50 (32%), Positives = 16/50 (32%), Gaps = 4/50 (8%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPPPXXXXXP----XPXXXPPPXXXPPXXPPXP 964 P PP P PP PPP P P PP P P P Sbjct: 68 PKAKLPPPPPPPPPPPPPPPPPPPSPPGVPANPVSLPPQPVIVPLNPADP 117 >AE014134-1932|AAF52992.1| 342|Drosophila melanogaster CG17108-PA protein. Length = 342 Score = 32.7 bits (71), Expect = 0.83 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G GGG GG G G G G GG Sbjct: 204 GVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGG 255 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G G GG GGG G G GGG GG G GG G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGGG--GHSGGGSGIGGGPGFGGGIGGGGGHSGGG 179 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G G GG GGG G G GGG G G G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGG 317 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG G G G G G GGG GG G GG G G G Sbjct: 126 GGIGDGPGFGSGGYSGGGGGI-GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSG 177 Score = 29.9 bits (64), Expect = 5.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXX-XGGXGXGGXXXXXXGXXXXG 811 G GG G G G G G GGG GG G GG G G Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGSG 196 >AE013599-1244|AAS64915.1| 253|Drosophila melanogaster CG13214-PB, isoform B protein. Length = 253 Score = 32.7 bits (71), Expect = 0.83 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G GG GG GGG G GGG G G G G G Sbjct: 48 GGGGGFGGGGAGGGYGGGGGGGPAGGFGGGPGGGGAGGFGGGNNGLGGFANGRPIAPGGG 107 Query: 801 G 799 G Sbjct: 108 G 108 Score = 31.1 bits (67), Expect = 2.5 Identities = 21/65 (32%), Positives = 21/65 (32%) Frame = -3 Query: 993 AXXXGXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXX 814 A G G G GG GGG G GGG GG G G G Sbjct: 29 AASAGGSPGAGLQGPGGGFGGGGGFGGGGA-----GGGYGGGGGGGPAGGFGGGPGGGGA 83 Query: 813 GXXGG 799 G GG Sbjct: 84 GGFGG 88 Score = 29.5 bits (63), Expect = 7.7 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 1/62 (1%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGG-GXXXXGGXGXGGXXXXXXGXXXXGXX 805 G G GG GG GGG G G GG G G G GG G Sbjct: 51 GGFGGGGAGGGYGGGG-GGGPAGGFGGGPGGGGAGGFGGGNNGLGGFANGRPIAPGGGGG 109 Query: 804 GG 799 GG Sbjct: 110 GG 111 >X73134-1|CAA51651.1| 127|Drosophila melanogaster GCR 20 protein. Length = 127 Score = 32.3 bits (70), Expect = 1.1 Identities = 21/55 (38%), Positives = 21/55 (38%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GG GGG G GGG GG G GG G G GG Sbjct: 62 GPGGGFGGQ--GGGFGGPGGGFGGQGGGFGGQGGFG-GGGFGGRPGGGFGGPGGG 113 Score = 31.1 bits (67), Expect = 2.5 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 2/57 (3%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGG--XGXGGXXXXXXGXXXXGXXGG 799 G GG GG GGG G GGG GG G GG G G GG Sbjct: 55 GPGGGFGGP--GGGFGGQGGGFGGPGGGFGGQGGGFGGQGGFGGGGFGGRPGGGFGG 109 >AY075448-1|AAL68261.2| 218|Drosophila melanogaster RE09269p protein. Length = 218 Score = 32.3 bits (70), Expect = 1.1 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G GG GG G G GGG GG G GG Sbjct: 51 GSALSSGWSSGGGGGGYSGGYSGGHGGGGGYGGGGYGGGGYGGGG 95 Score = 30.7 bits (66), Expect = 3.3 Identities = 22/64 (34%), Positives = 22/64 (34%), Gaps = 3/64 (4%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGG---GXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G GG GG GG G G G GGG GG G GG G Sbjct: 119 GGGYGGGHGGGYGGGYGGGSSGGYSGGHGGGWSSGGG-YGGGGYGGGGNVKIIKVISDAG 177 Query: 810 XXGG 799 GG Sbjct: 178 SSGG 181 >AY070976-1|AAL48598.1| 127|Drosophila melanogaster RE07460p protein. Length = 127 Score = 32.3 bits (70), Expect = 1.1 Identities = 21/55 (38%), Positives = 21/55 (38%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GG GGG G GGG GG G GG G G GG Sbjct: 62 GPGGGFGGQ--GGGFGGPGGGFGGQGGGFGGQGGFG-GGGFGGRPGGGFGGPGGG 113 Score = 31.1 bits (67), Expect = 2.5 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 2/57 (3%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGG--XGXGGXXXXXXGXXXXGXXGG 799 G GG GG GGG G GGG GG G GG G G GG Sbjct: 55 GPGGGFGGP--GGGFGGQGGGFGGPGGGFGGQGGGFGGQGGFGGGGFGGRPGGGFGG 109 >AE014298-2797|AAF48914.2| 193|Drosophila melanogaster CG14191-PA protein. Length = 193 Score = 32.3 bits (70), Expect = 1.1 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G GG GG G G GGG GG G GG Sbjct: 26 GSALSSGWSSGGGGGGYSGGYSGGHGGGGGYGGGGYGGGGYGGGG 70 Score = 30.7 bits (66), Expect = 3.3 Identities = 22/64 (34%), Positives = 22/64 (34%), Gaps = 3/64 (4%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGG---GXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G GG GG GG G G G GGG GG G GG G Sbjct: 94 GGGYGGGHGGGYGGGYGGGSSGGYSGGHGGGWSSGGG-YGGGGYGSGGNVKIIKVISDAG 152 Query: 810 XXGG 799 GG Sbjct: 153 SSGG 156 >AE014297-1701|AAF54959.1| 127|Drosophila melanogaster CG9757-PA protein. Length = 127 Score = 32.3 bits (70), Expect = 1.1 Identities = 21/55 (38%), Positives = 21/55 (38%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GG GGG G GGG GG G GG G G GG Sbjct: 62 GPGGGFGGQ--GGGFGGPGGGFGGQGGGFGGQGGFG-GGGFGGRPGGGFGGPGGG 113 Score = 31.1 bits (67), Expect = 2.5 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 2/57 (3%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGG--XGXGGXXXXXXGXXXXGXXGG 799 G GG GG GGG G GGG GG G GG G G GG Sbjct: 55 GPGGGFGGP--GGGFGGQGGGFGGPGGGFGGQGGGFGGQGGFGGGGFGGRPGGGFGG 109 >X71974-1|CAA50794.1| 196|Drosophila melanogaster GCR 17 protein. Length = 196 Score = 31.9 bits (69), Expect = 1.4 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G GG GGG G GGG GG GG Sbjct: 64 GLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGG 102 Score = 31.9 bits (69), Expect = 1.4 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G GG GG GGG G GG GG G G Sbjct: 68 GLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGGGYSG 106 >AY119556-1|AAM50210.1| 1272|Drosophila melanogaster GH28840p protein. Length = 1272 Score = 31.9 bits (69), Expect = 1.4 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P PP P P PPP P PP P PP P Sbjct: 288 PPPPPASPSPSRSSSLPP-PASPSPSLPPPASPSLSLP---PPASPSPSPSPPPPAEATA 343 Query: 980 P 982 P Sbjct: 344 P 344 >AY071088-1|AAL48710.1| 173|Drosophila melanogaster RE15531p protein. Length = 173 Score = 31.9 bits (69), Expect = 1.4 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G GG GGG G GGG GG GG Sbjct: 64 GLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGG 102 Score = 31.9 bits (69), Expect = 1.4 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G GG GG GGG G GG GG G G Sbjct: 68 GLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGGGYSG 106 >AY069304-1|AAL39449.1| 587|Drosophila melanogaster HL07962p protein. Length = 587 Score = 31.9 bits (69), Expect = 1.4 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 1/62 (1%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGG-GXXXXGGXGXGGXXXXXXGXXXXGXX 805 G G G GG GG G G GG G GG G G G G Sbjct: 15 GVCGVGGAHGAAGGADGAGGAGGGGGCGAGGGGAGAGPGGGPGGGAAAADLAGEAAGGAA 74 Query: 804 GG 799 GG Sbjct: 75 GG 76 >AE014298-2545|AAF48713.1| 173|Drosophila melanogaster CG10598-PA, isoform A protein. Length = 173 Score = 31.9 bits (69), Expect = 1.4 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G GG GGG G GGG GG GG Sbjct: 64 GLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGG 102 Score = 31.9 bits (69), Expect = 1.4 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G GG GG GGG G GG GG G G Sbjct: 68 GLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGGGYSG 106 >AE014298-2544|AAN09437.1| 230|Drosophila melanogaster CG10598-PB, isoform B protein. Length = 230 Score = 31.9 bits (69), Expect = 1.4 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G GG GGG G GGG GG GG Sbjct: 121 GLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGG 159 Score = 31.9 bits (69), Expect = 1.4 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G GG GG GGG G GG GG G G Sbjct: 125 GLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGGGYSG 163 >AE014298-2543|AAF48712.2| 237|Drosophila melanogaster CG12997-PA protein. Length = 237 Score = 31.9 bits (69), Expect = 1.4 Identities = 19/65 (29%), Positives = 19/65 (29%) Frame = +2 Query: 770 GXPXXXXXXXPPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPX 949 G P PP P P P P PPP P P PP P Sbjct: 114 GQPEDPPEDQPPEPPPLFQPLEPPPLFQPPPDPPDDQPPP-----PSPPLFHPPDPPPED 168 Query: 950 XPPXP 964 PP P Sbjct: 169 QPPPP 173 Score = 31.1 bits (67), Expect = 2.5 Identities = 19/63 (30%), Positives = 19/63 (30%), Gaps = 3/63 (4%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXX--PPPXXXXXPXPXXX-PPPXXXPPXXPPXPXXX 973 P P P P PP PPP P P PPP P PP P Sbjct: 108 PELPELGQPEDPPEDQPPEPPPLFQPLEPPPLFQPPPDPPDDQPPPPSPPLFHPPDPPPE 167 Query: 974 XXP 982 P Sbjct: 168 DQP 170 >AE014298-1675|AAF48083.2| 587|Drosophila melanogaster CG1841-PB, isoform B protein. Length = 587 Score = 31.9 bits (69), Expect = 1.4 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 1/62 (1%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGG-GXXXXGGXGXGGXXXXXXGXXXXGXX 805 G G G GG GG G G GG G GG G G G G Sbjct: 15 GVCGVGGAHGAAGGADGAGGAGGGGGCGAGGGGAGAGPGGGPGGGAAAADLAGEAAGGAA 74 Query: 804 GG 799 GG Sbjct: 75 GG 76 >AE014298-1674|AAN09296.1| 587|Drosophila melanogaster CG1841-PA, isoform A protein. Length = 587 Score = 31.9 bits (69), Expect = 1.4 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 1/62 (1%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGG-GXXXXGGXGXGGXXXXXXGXXXXGXX 805 G G G GG GG G G GG G GG G G G G Sbjct: 15 GVCGVGGAHGAAGGADGAGGAGGGGGCGAGGGGAGAGPGGGPGGGAAAADLAGEAAGGAA 74 Query: 804 GG 799 GG Sbjct: 75 GG 76 >AE014298-1554|AAF48000.3| 3539|Drosophila melanogaster CG11122-PA protein. Length = 3539 Score = 31.9 bits (69), Expect = 1.4 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P PP P P PPP P PP P PP P Sbjct: 2555 PPPPPASPSPSRSSSLPP-PASPSPSLPPPASPSLSLP---PPASPSPSPSPPPPAEATA 2610 Query: 980 P 982 P Sbjct: 2611 P 2611 >AE014297-3695|AAF56384.1| 208|Drosophila melanogaster CG11786-PA protein. Length = 208 Score = 31.9 bits (69), Expect = 1.4 Identities = 17/56 (30%), Positives = 18/56 (32%), Gaps = 1/56 (1%) Frame = +2 Query: 800 PPXXPXXXH-PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P + P P P PPP P P PP P PP P Sbjct: 55 PPATPAPEYLPPPNNGYQYNPPPNNNYLPPPNNNYLPPPPEYGPPAGYPSYGPPPP 110 >AE014296-852|AAF47904.2| 242|Drosophila melanogaster CG11345-PA protein. Length = 242 Score = 31.9 bits (69), Expect = 1.4 Identities = 22/89 (24%), Positives = 23/89 (25%) Frame = +3 Query: 735 PLXHPPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXP 914 P PPPP P P PP PP P P P Sbjct: 91 PAYLPPPPPVIKVNPPKPAYLPPPPPVVKVNPPKPAYLPP--PPPVVKVNPPKPSYLPPP 148 Query: 915 PXXXXXXXXPPXXXPXXPPXXXXXRPPRP 1001 P P P PP PP+P Sbjct: 149 PPVVKVNPPKPAYVP-PPPPAVKVNPPKP 176 Score = 29.5 bits (63), Expect = 7.7 Identities = 16/60 (26%), Positives = 16/60 (26%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P P PP PP P P P PPP PP P P Sbjct: 55 PPEPVTVREAPVTVPPPVYLPPATVKPEIPVVRTPKPAYLPPPPPVIKVNPPKPAYLPPP 114 >BT023900-1|ABA81834.1| 1576|Drosophila melanogaster LP13775p protein. Length = 1576 Score = 31.5 bits (68), Expect = 1.9 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P HP P P PP P P PPP P PP P Sbjct: 764 PPERPPK-HPNLRVPSPELPPPPQSELDISYTFDEPLP-PPPPPEVLQPRPPPSP 816 >BT011530-1|AAS15666.1| 145|Drosophila melanogaster RE20733p protein. Length = 145 Score = 31.5 bits (68), Expect = 1.9 Identities = 17/61 (27%), Positives = 18/61 (29%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P + PP P P PP P PP P PP P Sbjct: 59 PPAAPAKAY-IPPPPPPPPPAPKNTYIPPAPAPVAPVETYIPPAAPAPAYIPPAPVQAEE 117 Query: 980 P 982 P Sbjct: 118 P 118 >BT003654-1|AAO39658.1| 1273|Drosophila melanogaster AT04875p protein. Length = 1273 Score = 31.5 bits (68), Expect = 1.9 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXP 907 PP P P PP P PP PPP P Sbjct: 697 PPPPPMPASPTASSAAPPPPPPPAPPAPPPPPGFSP 732 >BT003208-1|AAO24963.1| 478|Drosophila melanogaster SD23764p protein. Length = 478 Score = 31.5 bits (68), Expect = 1.9 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 1/56 (1%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPP-XXXPPXXPPXP 964 PP P P PP P P PP P P P PP P P Sbjct: 154 PPPPPPLEEPEKCPLSPPPPPSPPAMAPPLPAKPYPYPDLAAMPFPDRPPAYTPTP 209 >AY118781-1|AAM50641.1| 117|Drosophila melanogaster GH13168p protein. Length = 117 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G G GGG GG G GG G G G Sbjct: 44 GGNGGRGGGGGYNAGGG-----GGGYYNGGGGGGGGRRPVYSGNFGPGYGNG 90 >AY058341-1|AAL13570.1| 1024|Drosophila melanogaster GH11706p protein. Length = 1024 Score = 31.5 bits (68), Expect = 1.9 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -3 Query: 945 GGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GGG G G GGG GG G GG G G GG Sbjct: 837 GAGGDGGGIGGGGGARGVLGGGRSARGG-GAGGGGFRGPGGPGGGPGGG 884 >AE014297-3096|AAF55954.1| 117|Drosophila melanogaster CG5778-PA protein. Length = 117 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G G GGG GG G GG G G G Sbjct: 44 GGNGGRGGGGGYNAGGG-----GGGYYNGGGGGGGGRRPVYSGNFGPGYGNG 90 >AE014297-1806|AAF55026.1| 1024|Drosophila melanogaster CG14355-PA protein. Length = 1024 Score = 31.5 bits (68), Expect = 1.9 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -3 Query: 945 GGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GGG G G GGG GG G GG G G GG Sbjct: 837 GAGGDGGGIGGGGGARGVLGGGRSARGG-GAGGGGFRGPGGPGGGPGGG 884 >AE013599-2439|AAM68499.1| 145|Drosophila melanogaster CG30458-PA protein. Length = 145 Score = 31.5 bits (68), Expect = 1.9 Identities = 17/61 (27%), Positives = 18/61 (29%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P + PP P P PP P PP P PP P Sbjct: 59 PPAAPAKAY-IPPPPPPPPPAPKNTYIPPAPAPVAPVETYIPPAAPAPAYIPPAPVQAEE 117 Query: 980 P 982 P Sbjct: 118 P 118 >AE013599-1871|AAF58260.1| 856|Drosophila melanogaster CG13942-PA protein. Length = 856 Score = 31.5 bits (68), Expect = 1.9 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P HP P P PP P P PPP P PP P Sbjct: 702 PPERPPK-HPNLRVPSPELPPPPQSELDISYTFDEPLP-PPPPPEVLQPRPPPSP 754 >AE013599-1621|AAF58436.2| 478|Drosophila melanogaster CG3884-PA, isoform A protein. Length = 478 Score = 31.5 bits (68), Expect = 1.9 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 1/56 (1%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPP-XXXPPXXPPXP 964 PP P P PP P P PP P P P PP P P Sbjct: 154 PPPPPPLEEPEKCPLSPPPPPSPPAMAPPLPAKPYPYPDLAAMPFPDRPPAYTPTP 209 >AE014297-2648|AAF55656.1| 555|Drosophila melanogaster CG14280-PA protein. Length = 555 Score = 31.1 bits (67), Expect = 2.5 Identities = 19/68 (27%), Positives = 19/68 (27%), Gaps = 3/68 (4%) Frame = +2 Query: 770 GXPXXXXXXXPPXXPXXXHPXXXXXXP---PXPXPPXXXXPPPXXXXXPXPXXXPPPXXX 940 G P P P P P P P PP P P P P P Sbjct: 104 GTPPPEPAPTEPEEPEPTIPMRPTTIPVEEPSPQPPTMMVPTPSASPGMQPSSKPRPTGK 163 Query: 941 PPXXPPXP 964 P PP P Sbjct: 164 PSMSPPVP 171 >U21123-1|AAA85120.1| 684|Drosophila melanogaster ena polypeptide protein. Length = 684 Score = 30.7 bits (66), Expect = 3.3 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 857 PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P PPP P PPP P PP P Sbjct: 438 PPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPP 473 Score = 29.9 bits (64), Expect = 5.8 Identities = 22/76 (28%), Positives = 22/76 (28%), Gaps = 5/76 (6%) Frame = +2 Query: 770 GXPXXXXXXXPPXXPXXXHPXXXXXXPPXPXPP---XXXXPPPXXXXXPXPXXXPPP--X 934 G P PP P PP P PP PPP P P PP Sbjct: 399 GGPGGPPAPAPP-PPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMG 457 Query: 935 XXPPXXPPXPXXXXXP 982 PP P P P Sbjct: 458 GGPPPAPGGPGAPPPP 473 >M83931-1|AAB04680.1| 1595|Drosophila melanogaster son of sevenless protein protein. Length = 1595 Score = 30.7 bits (66), Expect = 3.3 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 GG G GGG G G GGG GG G G Sbjct: 15 GGGIGLGTGGGGGSGGSGSGSQGGGGGIGIGGGGVAG 51 >M77501-1|AAA28904.1| 1596|Drosophila melanogaster son of sevenless protein. Length = 1596 Score = 30.7 bits (66), Expect = 3.3 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 GG G GGG G G GGG GG G G Sbjct: 15 GGGIGLGTGGGGGSGGSGSGSQGGGGGIGIGGGGVAG 51 >DQ991915-1|ABJ09588.1| 2176|Drosophila melanogaster eyes shut protein. Length = 2176 Score = 30.7 bits (66), Expect = 3.3 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P P P PP P P PP PP PP P Sbjct: 903 PPATPA---PVPPATTTPPPSPPSLATETPTLPPTLPPVTLPPVTQPPPTIPPTP 954 >DQ780942-1|ABH07112.1| 2165|Drosophila melanogaster spacemaker protein. Length = 2165 Score = 30.7 bits (66), Expect = 3.3 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P P P PP P P PP PP PP P Sbjct: 892 PPATPA---PVPPATTTPPPSPPSLATETPTLPPTLPPVTLPPVTQPPPTIPPTP 943 >BT011407-1|AAR96199.1| 669|Drosophila melanogaster AT20168p protein. Length = 669 Score = 30.7 bits (66), Expect = 3.3 Identities = 15/52 (28%), Positives = 15/52 (28%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P PP P PPP P P PP PP P P Sbjct: 192 PHLMSQPPPNAAAPLLSQPPPNVRQQPPPMFQPPGMQAPPGFGQPPFCMPPP 243 >BT004488-1|AAO42652.1| 687|Drosophila melanogaster LD23655p protein. Length = 687 Score = 30.7 bits (66), Expect = 3.3 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 857 PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P PPP P PPP P PP P Sbjct: 441 PPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPP 476 Score = 29.9 bits (64), Expect = 5.8 Identities = 22/76 (28%), Positives = 22/76 (28%), Gaps = 5/76 (6%) Frame = +2 Query: 770 GXPXXXXXXXPPXXPXXXHPXXXXXXPPXPXPP---XXXXPPPXXXXXPXPXXXPPP--X 934 G P PP P PP P PP PPP P P PP Sbjct: 402 GGPGGPPAPAPP-PPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMG 460 Query: 935 XXPPXXPPXPXXXXXP 982 PP P P P Sbjct: 461 GGPPPAPGGPGAPPPP 476 >BT003571-1|AAO39575.1| 285|Drosophila melanogaster LD41821p protein. Length = 285 Score = 30.7 bits (66), Expect = 3.3 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 GG GG GGG G GGG G G GG Sbjct: 63 GGLIGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGG 99 >BT001610-1|AAN71365.1| 279|Drosophila melanogaster RE31819p protein. Length = 279 Score = 30.7 bits (66), Expect = 3.3 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 GG GG GGG G GGG G G GG Sbjct: 57 GGLIGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGG 93 >AY084210-1|AAL89948.1| 831|Drosophila melanogaster SD08336p protein. Length = 831 Score = 30.7 bits (66), Expect = 3.3 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 857 PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P PPP P PPP P PP P Sbjct: 584 PPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPP 619 Score = 29.9 bits (64), Expect = 5.8 Identities = 22/76 (28%), Positives = 22/76 (28%), Gaps = 5/76 (6%) Frame = +2 Query: 770 GXPXXXXXXXPPXXPXXXHPXXXXXXPPXPXPP---XXXXPPPXXXXXPXPXXXPPP--X 934 G P PP P PP P PP PPP P P PP Sbjct: 545 GGPGGPPAPAPP-PPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMG 603 Query: 935 XXPPXXPPXPXXXXXP 982 PP P P P Sbjct: 604 GGPPPAPGGPGAPPPP 619 >AY084171-1|AAL89909.1| 286|Drosophila melanogaster RE40851p protein. Length = 286 Score = 30.7 bits (66), Expect = 3.3 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 GG GG GGG G GGG G G GG Sbjct: 63 GGLIGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGG 99 >AY069106-1|AAL39251.1| 763|Drosophila melanogaster GH12404p protein. Length = 763 Score = 30.7 bits (66), Expect = 3.3 Identities = 15/52 (28%), Positives = 15/52 (28%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P PP P PPP P P PP PP P P Sbjct: 192 PHLMSQPPPNAAAPLLSQPPPNVRQQPPPMFQPPGMQAPPGFGQPPFCMPPP 243 >AE014298-1193|AAF46385.1| 679|Drosophila melanogaster CG33181-PA protein. Length = 679 Score = 30.7 bits (66), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 945 GGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 GG GGG G G GGG GG G G Sbjct: 194 GGGGGGGGGGGGIGGAGGGGGGGGGNGGIGSG 225 Score = 29.9 bits (64), Expect = 5.8 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G GG GGG G G GGG G G G Sbjct: 188 GAVSGGGGGGGGGGGGGGIGGAGGGGGGGGGNGGIG 223 >AE014297-3971|AAN14080.1| 279|Drosophila melanogaster CG6447-PB, isoform B protein. Length = 279 Score = 30.7 bits (66), Expect = 3.3 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 GG GG GGG G GGG G G GG Sbjct: 57 GGLIGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGG 93 >AE014297-3970|AAF56603.2| 285|Drosophila melanogaster CG6447-PA, isoform A protein. Length = 285 Score = 30.7 bits (66), Expect = 3.3 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 GG GG GGG G GGG G G GG Sbjct: 63 GGLIGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGG 99 >AE014297-3969|AAF56602.1| 286|Drosophila melanogaster CG6478-PA protein. Length = 286 Score = 30.7 bits (66), Expect = 3.3 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 GG GG GGG G GGG G G GG Sbjct: 63 GGLIGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGG 99 >AE014297-450|ABI31144.1| 669|Drosophila melanogaster CG33097-PB, isoform B protein. Length = 669 Score = 30.7 bits (66), Expect = 3.3 Identities = 15/52 (28%), Positives = 15/52 (28%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P PP P PPP P P PP PP P P Sbjct: 192 PHLMSQPPPNAAAPLLSQPPPNVRQQPPPMFQPPGMQAPPGFGQPPFCMPPP 243 >AE014297-449|AAF54130.2| 763|Drosophila melanogaster CG33097-PA, isoform A protein. Length = 763 Score = 30.7 bits (66), Expect = 3.3 Identities = 15/52 (28%), Positives = 15/52 (28%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P PP P PPP P P PP PP P P Sbjct: 192 PHLMSQPPPNAAAPLLSQPPPNVRQQPPPMFQPPGMQAPPGFGQPPFCMPPP 243 >AE014134-2404|AAF53336.2| 1596|Drosophila melanogaster CG7793-PA protein. Length = 1596 Score = 30.7 bits (66), Expect = 3.3 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 GG G GGG G G GGG GG G G Sbjct: 15 GGGIGLGTGGGGGSGGSGSGSQGGGGGIGIGGGGVAG 51 >AE014134-390|AAZ83988.1| 1984|Drosophila melanogaster CG33955-PB protein. Length = 1984 Score = 30.7 bits (66), Expect = 3.3 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P P P PP P P PP PP PP P Sbjct: 696 PPATPA---PVPPATTTPPPSPPSLATETPTLPPTLPPVTLPPVTQPPPTIPPTP 747 >AE013599-3071|AAF46625.1| 239|Drosophila melanogaster CG15225-PA protein. Length = 239 Score = 30.7 bits (66), Expect = 3.3 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPP 931 PP P PP P P P P PPP Sbjct: 186 PPPPPPPPYYPPYPYYPPPPPPPPLPPP 213 Score = 29.9 bits (64), Expect = 5.8 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 1/40 (2%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXP-XXXPPPXXXPPXXPPXP 964 P P PP PP P P P P PP PP P Sbjct: 102 PYYPYPPKYPPYPPYPHYSPYPAPPYPYPGYYPPPPPPYP 141 >AE013599-2829|AAM68439.1| 829|Drosophila melanogaster CG15112-PB, isoform B protein. Length = 829 Score = 30.7 bits (66), Expect = 3.3 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 857 PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P PPP P PPP P PP P Sbjct: 583 PPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPP 618 Score = 29.9 bits (64), Expect = 5.8 Identities = 22/76 (28%), Positives = 22/76 (28%), Gaps = 5/76 (6%) Frame = +2 Query: 770 GXPXXXXXXXPPXXPXXXHPXXXXXXPPXPXPP---XXXXPPPXXXXXPXPXXXPPP--X 934 G P PP P PP P PP PPP P P PP Sbjct: 544 GGPGGPPAPAPP-PPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMG 602 Query: 935 XXPPXXPPXPXXXXXP 982 PP P P P Sbjct: 603 GGPPPAPGGPGAPPPP 618 >AE013599-2828|AAX52697.1| 684|Drosophila melanogaster CG15112-PE, isoform E protein. Length = 684 Score = 30.7 bits (66), Expect = 3.3 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 857 PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P PPP P PPP P PP P Sbjct: 438 PPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPP 473 Score = 29.9 bits (64), Expect = 5.8 Identities = 22/76 (28%), Positives = 22/76 (28%), Gaps = 5/76 (6%) Frame = +2 Query: 770 GXPXXXXXXXPPXXPXXXHPXXXXXXPPXPXPP---XXXXPPPXXXXXPXPXXXPPP--X 934 G P PP P PP P PP PPP P P PP Sbjct: 399 GGPGGPPAPAPP-PPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMG 457 Query: 935 XXPPXXPPXPXXXXXP 982 PP P P P Sbjct: 458 GGPPPAPGGPGAPPPP 473 >AE013599-2827|AAM68438.2| 684|Drosophila melanogaster CG15112-PC, isoform C protein. Length = 684 Score = 30.7 bits (66), Expect = 3.3 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 857 PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P PPP P PPP P PP P Sbjct: 438 PPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPP 473 Score = 29.9 bits (64), Expect = 5.8 Identities = 22/76 (28%), Positives = 22/76 (28%), Gaps = 5/76 (6%) Frame = +2 Query: 770 GXPXXXXXXXPPXXPXXXHPXXXXXXPPXPXPP---XXXXPPPXXXXXPXPXXXPPP--X 934 G P PP P PP P PP PPP P P PP Sbjct: 399 GGPGGPPAPAPP-PPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMG 457 Query: 935 XXPPXXPPXPXXXXXP 982 PP P P P Sbjct: 458 GGPPPAPGGPGAPPPP 473 >AE013599-2826|AAF57598.2| 684|Drosophila melanogaster CG15112-PA, isoform A protein. Length = 684 Score = 30.7 bits (66), Expect = 3.3 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 857 PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P PPP P PPP P PP P Sbjct: 438 PPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPP 473 Score = 29.9 bits (64), Expect = 5.8 Identities = 22/76 (28%), Positives = 22/76 (28%), Gaps = 5/76 (6%) Frame = +2 Query: 770 GXPXXXXXXXPPXXPXXXHPXXXXXXPPXPXPP---XXXXPPPXXXXXPXPXXXPPP--X 934 G P PP P PP P PP PPP P P PP Sbjct: 399 GGPGGPPAPAPP-PPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMG 457 Query: 935 XXPPXXPPXPXXXXXP 982 PP P P P Sbjct: 458 GGPPPAPGGPGAPPPP 473 >AE013599-2825|AAX52696.1| 687|Drosophila melanogaster CG15112-PD, isoform D protein. Length = 687 Score = 30.7 bits (66), Expect = 3.3 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 857 PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P PPP P PPP P PP P Sbjct: 441 PPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPP 476 Score = 29.9 bits (64), Expect = 5.8 Identities = 22/76 (28%), Positives = 22/76 (28%), Gaps = 5/76 (6%) Frame = +2 Query: 770 GXPXXXXXXXPPXXPXXXHPXXXXXXPPXPXPP---XXXXPPPXXXXXPXPXXXPPP--X 934 G P PP P PP P PP PPP P P PP Sbjct: 402 GGPGGPPAPAPP-PPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMG 460 Query: 935 XXPPXXPPXPXXXXXP 982 PP P P P Sbjct: 461 GGPPPAPGGPGAPPPP 476 >BT016162-1|AAV37047.1| 702|Drosophila melanogaster AT08270p protein. Length = 702 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P PP PP P PPP PP P P Sbjct: 211 PAGSPPPKNVSAPPTGGSPPAKSGAPPPPKGPPPGTPPP 249 >BT015282-1|AAT94511.1| 1250|Drosophila melanogaster LD04601p protein. Length = 1250 Score = 30.3 bits (65), Expect = 4.4 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 1/58 (1%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXG-GGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G GG G G GG G G GGG G G GG G G Sbjct: 772 GGGPGPGPGGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGG 829 Score = 29.9 bits (64), Expect = 5.8 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G GG GGG G G GG G G GG Sbjct: 796 GPGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGG 831 >BT012315-1|AAS77440.1| 385|Drosophila melanogaster LD32727p protein. Length = 385 Score = 30.3 bits (65), Expect = 4.4 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 1/62 (1%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXG-GGXXXXGGXGXGGXXXXXXGXXXXGXX 805 G G GG GG GG G G GG GG G GG G Sbjct: 251 GGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGGYGGGNSNGSWGGNGGGG 310 Query: 804 GG 799 GG Sbjct: 311 GG 312 >BT003763-1|AAO41442.1| 652|Drosophila melanogaster RE39251p protein. Length = 652 Score = 30.3 bits (65), Expect = 4.4 Identities = 21/75 (28%), Positives = 21/75 (28%), Gaps = 4/75 (5%) Frame = +2 Query: 770 GXPXXXXXXXPPXXPXXXHPXXXXXXPPXPXPPXXXXPP----PXXXXXPXPXXXPPPXX 937 G P PP P P P P PP PP P P P P Sbjct: 521 GPPGPPGPPGPPGPPGPKGPTKPGPFGP-PGPPGPPGPPGPTRPGPYGPPGPPGPTGPTR 579 Query: 938 XPPXXPPXPXXXXXP 982 P PP P P Sbjct: 580 PGPPGPPGPTRPGPP 594 Score = 30.3 bits (65), Expect = 4.4 Identities = 22/91 (24%), Positives = 23/91 (25%), Gaps = 1/91 (1%) Frame = +2 Query: 674 PGPRFPFXXGXXXPNXIKXXXXXXXXXXXXXXGXPXXXXXXXPPXXPXXXHPXXXXXXPP 853 PGP+ P G P G P P P PP Sbjct: 535 PGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPP 594 Query: 854 XPXPPXXXXPP-PXXXXXPXPXXXPPPXXXP 943 P P PP P P P PP P Sbjct: 595 GPPGPTRPGPPGPTRPGPPGPTRPGPPGPSP 625 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 2/57 (3%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXX-PPXPXPPXXXXPP-PXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P PP P P PP P P P P P P P P Sbjct: 554 PPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGPTRP 610 Score = 29.5 bits (63), Expect = 7.7 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 4/49 (8%) Frame = +2 Query: 848 PPXPXPPXXXXPP----PXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 PP P P PP P P P P P P PP P P Sbjct: 557 PPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPP 605 >AY119041-1|AAM50901.1| 393|Drosophila melanogaster LP06455p protein. Length = 393 Score = 30.3 bits (65), Expect = 4.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXG 865 G GG GG GGG G G GGG G Sbjct: 169 GGGGGLGGNGGGGGGLLGGGGGDNGGGGGLLGG 201 >AY113490-1|AAM29495.1| 158|Drosophila melanogaster RE47308p protein. Length = 158 Score = 30.3 bits (65), Expect = 4.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGG 862 G GG GG GGG G GGG GG Sbjct: 93 GGGGGGGGGGSGGGGRGGGSGARAGGGGRAGDGG 126 Score = 29.5 bits (63), Expect = 7.7 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXG 856 G GG GG GG G G GGG G G Sbjct: 92 GGGGGGGGGGGSGGGGRGGGSGARAGGGGRAGDGGG 127 >AY069625-1|AAL39770.1| 268|Drosophila melanogaster LD39545p protein. Length = 268 Score = 30.3 bits (65), Expect = 4.4 Identities = 21/75 (28%), Positives = 21/75 (28%), Gaps = 4/75 (5%) Frame = +2 Query: 770 GXPXXXXXXXPPXXPXXXHPXXXXXXPPXPXPPXXXXPP----PXXXXXPXPXXXPPPXX 937 G P PP P P P P PP PP P P P P Sbjct: 137 GPPGPPGPPGPPGPPGPKGPTKPGPFGP-PGPPGPPGPPGPTRPGPYGPPGPPGPTGPTR 195 Query: 938 XPPXXPPXPXXXXXP 982 P PP P P Sbjct: 196 PGPPGPPGPTRPGPP 210 Score = 30.3 bits (65), Expect = 4.4 Identities = 22/91 (24%), Positives = 23/91 (25%), Gaps = 1/91 (1%) Frame = +2 Query: 674 PGPRFPFXXGXXXPNXIKXXXXXXXXXXXXXXGXPXXXXXXXPPXXPXXXHPXXXXXXPP 853 PGP+ P G P G P P P PP Sbjct: 151 PGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPP 210 Query: 854 XPXPPXXXXPP-PXXXXXPXPXXXPPPXXXP 943 P P PP P P P PP P Sbjct: 211 GPPGPTRPGPPGPTRPGPPGPTRPGPPGPSP 241 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 2/57 (3%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXX-PPXPXPPXXXXPP-PXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P PP P P PP P P P P P P P P Sbjct: 170 PPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGPTRP 226 Score = 29.5 bits (63), Expect = 7.7 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 4/49 (8%) Frame = +2 Query: 848 PPXPXPPXXXXPP----PXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 PP P P PP P P P P P P PP P P Sbjct: 173 PPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPP 221 >AF255733-1|AAF71288.1| 1250|Drosophila melanogaster DNA topoisomerase III alpha protein. Length = 1250 Score = 30.3 bits (65), Expect = 4.4 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 1/58 (1%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXG-GGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G GG G G GG G G GGG G G GG G G Sbjct: 772 GGGPGPGPGGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGG 829 Score = 29.9 bits (64), Expect = 5.8 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G GG GGG G G GG G G GG Sbjct: 796 GPGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGG 831 >AE014298-1899|AAF48264.2| 158|Drosophila melanogaster CG1987-PA protein. Length = 158 Score = 30.3 bits (65), Expect = 4.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGG 862 G GG GG GGG G GGG GG Sbjct: 93 GGGGGGGGGGSGGGGRGGGSGARAGGGGRAGDGG 126 Score = 29.5 bits (63), Expect = 7.7 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXG 856 G GG GG GG G G GGG G G Sbjct: 92 GGGGGGGGGGGSGGGGRGGGSGARAGGGGRAGDGGG 127 >AE014297-1716|AAF54967.1| 385|Drosophila melanogaster CG12749-PA, isoform A protein. Length = 385 Score = 30.3 bits (65), Expect = 4.4 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 1/62 (1%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXG-GGXXXXGGXGXGGXXXXXXGXXXXGXX 805 G G GG GG GG G G GG GG G GG G Sbjct: 251 GGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGGYGGGNSNGSWGGNGGGG 310 Query: 804 GG 799 GG Sbjct: 311 GG 312 >AE014297-1715|AAN13574.1| 325|Drosophila melanogaster CG12749-PB, isoform B protein. Length = 325 Score = 30.3 bits (65), Expect = 4.4 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 1/62 (1%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXG-GGXXXXGGXGXGGXXXXXXGXXXXGXX 805 G G GG GG GG G G GG GG G GG G Sbjct: 251 GGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGGYGGGNSNGSWGGNGGGG 310 Query: 804 GG 799 GG Sbjct: 311 GG 312 >AE014297-416|AAF51905.3| 393|Drosophila melanogaster CG10303-PA protein. Length = 393 Score = 30.3 bits (65), Expect = 4.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXG 865 G GG GG GGG G G GGG G Sbjct: 169 GGGGGLGGNGGGGGGLLGGGGGDNGGGGGLLGG 201 >AE014296-964|AAN12098.1| 682|Drosophila melanogaster CG10625-PC, isoform C protein. Length = 682 Score = 30.3 bits (65), Expect = 4.4 Identities = 21/75 (28%), Positives = 21/75 (28%), Gaps = 4/75 (5%) Frame = +2 Query: 770 GXPXXXXXXXPPXXPXXXHPXXXXXXPPXPXPPXXXXPP----PXXXXXPXPXXXPPPXX 937 G P PP P P P P PP PP P P P P Sbjct: 551 GPPGPPGPPGPPGPPGPKGPTKPGPFGP-PGPPGPPGPPGPTRPGPYGPPGPPGPTGPTR 609 Query: 938 XPPXXPPXPXXXXXP 982 P PP P P Sbjct: 610 PGPPGPPGPTRPGPP 624 Score = 30.3 bits (65), Expect = 4.4 Identities = 22/91 (24%), Positives = 23/91 (25%), Gaps = 1/91 (1%) Frame = +2 Query: 674 PGPRFPFXXGXXXPNXIKXXXXXXXXXXXXXXGXPXXXXXXXPPXXPXXXHPXXXXXXPP 853 PGP+ P G P G P P P PP Sbjct: 565 PGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPP 624 Query: 854 XPXPPXXXXPP-PXXXXXPXPXXXPPPXXXP 943 P P PP P P P PP P Sbjct: 625 GPPGPTRPGPPGPTRPGPPGPTRPGPPGPSP 655 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 2/57 (3%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXX-PPXPXPPXXXXPP-PXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P PP P P PP P P P P P P P P Sbjct: 584 PPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGPTRP 640 Score = 29.5 bits (63), Expect = 7.7 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 4/49 (8%) Frame = +2 Query: 848 PPXPXPPXXXXPP----PXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 PP P P PP P P P P P P PP P P Sbjct: 587 PPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPP 635 >AE014296-963|AAF50773.2| 682|Drosophila melanogaster CG10625-PB, isoform B protein. Length = 682 Score = 30.3 bits (65), Expect = 4.4 Identities = 21/75 (28%), Positives = 21/75 (28%), Gaps = 4/75 (5%) Frame = +2 Query: 770 GXPXXXXXXXPPXXPXXXHPXXXXXXPPXPXPPXXXXPP----PXXXXXPXPXXXPPPXX 937 G P PP P P P P PP PP P P P P Sbjct: 551 GPPGPPGPPGPPGPPGPKGPTKPGPFGP-PGPPGPPGPPGPTRPGPYGPPGPPGPTGPTR 609 Query: 938 XPPXXPPXPXXXXXP 982 P PP P P Sbjct: 610 PGPPGPPGPTRPGPP 624 Score = 30.3 bits (65), Expect = 4.4 Identities = 22/91 (24%), Positives = 23/91 (25%), Gaps = 1/91 (1%) Frame = +2 Query: 674 PGPRFPFXXGXXXPNXIKXXXXXXXXXXXXXXGXPXXXXXXXPPXXPXXXHPXXXXXXPP 853 PGP+ P G P G P P P PP Sbjct: 565 PGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPP 624 Query: 854 XPXPPXXXXPP-PXXXXXPXPXXXPPPXXXP 943 P P PP P P P PP P Sbjct: 625 GPPGPTRPGPPGPTRPGPPGPTRPGPPGPSP 655 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 2/57 (3%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXX-PPXPXPPXXXXPP-PXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P PP P P PP P P P P P P P P Sbjct: 584 PPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGPTRP 640 Score = 29.5 bits (63), Expect = 7.7 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 4/49 (8%) Frame = +2 Query: 848 PPXPXPPXXXXPP----PXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 PP P P PP P P P P P P PP P P Sbjct: 587 PPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPP 635 >AE014296-962|AAN12097.1| 268|Drosophila melanogaster CG10625-PD, isoform D protein. Length = 268 Score = 30.3 bits (65), Expect = 4.4 Identities = 21/75 (28%), Positives = 21/75 (28%), Gaps = 4/75 (5%) Frame = +2 Query: 770 GXPXXXXXXXPPXXPXXXHPXXXXXXPPXPXPPXXXXPP----PXXXXXPXPXXXPPPXX 937 G P PP P P P P PP PP P P P P Sbjct: 137 GPPGPPGPPGPPGPPGPKGPTKPGPFGP-PGPPGPPGPPGPTRPGPYGPPGPPGPTGPTR 195 Query: 938 XPPXXPPXPXXXXXP 982 P PP P P Sbjct: 196 PGPPGPPGPTRPGPP 210 Score = 30.3 bits (65), Expect = 4.4 Identities = 22/91 (24%), Positives = 23/91 (25%), Gaps = 1/91 (1%) Frame = +2 Query: 674 PGPRFPFXXGXXXPNXIKXXXXXXXXXXXXXXGXPXXXXXXXPPXXPXXXHPXXXXXXPP 853 PGP+ P G P G P P P PP Sbjct: 151 PGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPP 210 Query: 854 XPXPPXXXXPP-PXXXXXPXPXXXPPPXXXP 943 P P PP P P P PP P Sbjct: 211 GPPGPTRPGPPGPTRPGPPGPTRPGPPGPSP 241 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 2/57 (3%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXX-PPXPXPPXXXXPP-PXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P PP P P PP P P P P P P P P Sbjct: 170 PPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGPTRP 226 Score = 29.5 bits (63), Expect = 7.7 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 4/49 (8%) Frame = +2 Query: 848 PPXPXPPXXXXPP----PXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 PP P P PP P P P P P P PP P P Sbjct: 173 PPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPP 221 >AE014296-961|AAN12096.1| 268|Drosophila melanogaster CG10625-PA, isoform A protein. Length = 268 Score = 30.3 bits (65), Expect = 4.4 Identities = 21/75 (28%), Positives = 21/75 (28%), Gaps = 4/75 (5%) Frame = +2 Query: 770 GXPXXXXXXXPPXXPXXXHPXXXXXXPPXPXPPXXXXPP----PXXXXXPXPXXXPPPXX 937 G P PP P P P P PP PP P P P P Sbjct: 137 GPPGPPGPPGPPGPPGPKGPTKPGPFGP-PGPPGPPGPPGPTRPGPYGPPGPPGPTGPTR 195 Query: 938 XPPXXPPXPXXXXXP 982 P PP P P Sbjct: 196 PGPPGPPGPTRPGPP 210 Score = 30.3 bits (65), Expect = 4.4 Identities = 22/91 (24%), Positives = 23/91 (25%), Gaps = 1/91 (1%) Frame = +2 Query: 674 PGPRFPFXXGXXXPNXIKXXXXXXXXXXXXXXGXPXXXXXXXPPXXPXXXHPXXXXXXPP 853 PGP+ P G P G P P P PP Sbjct: 151 PGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPP 210 Query: 854 XPXPPXXXXPP-PXXXXXPXPXXXPPPXXXP 943 P P PP P P P PP P Sbjct: 211 GPPGPTRPGPPGPTRPGPPGPTRPGPPGPSP 241 Score = 30.3 bits (65), Expect = 4.4 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 2/57 (3%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXX-PPXPXPPXXXXPP-PXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P PP P P PP P P P P P P P P Sbjct: 170 PPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGPTRP 226 Score = 29.5 bits (63), Expect = 7.7 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 4/49 (8%) Frame = +2 Query: 848 PPXPXPPXXXXPP----PXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 PP P P PP P P P P P P PP P P Sbjct: 173 PPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPP 221 >AE014134-3114|AAF53813.2| 1250|Drosophila melanogaster CG10123-PA protein. Length = 1250 Score = 30.3 bits (65), Expect = 4.4 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 1/58 (1%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXG-GGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G GG G G GG G G GGG G G GG G G Sbjct: 772 GGGPGPGPGGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGG 829 Score = 29.9 bits (64), Expect = 5.8 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G GG GGG G G GG G G GG Sbjct: 796 GPGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGG 831 >AE013599-2521|AAF57825.3| 702|Drosophila melanogaster CG11423-PA protein. Length = 702 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P PP PP P PPP PP P P Sbjct: 211 PAGSPPPKNVSAPPTGGSPPAKSGAPPPPKGPPPGTPPP 249 >X62638-1|CAA44504.1| 345|Drosophila melanogaster hrp40.2 protein. Length = 345 Score = 29.9 bits (64), Expect = 5.8 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G GG GG GGG G GGG G GG Sbjct: 292 GGFEGNGYGGGGGGGNMGGGRGGPRGGGGPKGGGGFNGGKQRGGG 336 >U18130-1|AAC46512.1| 1047|Drosophila melanogaster masquerade protein. Length = 1047 Score = 29.9 bits (64), Expect = 5.8 Identities = 18/63 (28%), Positives = 19/63 (30%), Gaps = 8/63 (12%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPP--------XXXPPXXP 955 PP P +P PP PP P P PPP PP P Sbjct: 593 PPIGPPQAYPPQTPPYSYMNNPPPQGPPPQMAPHHPNPYQPPPPAPNYADYYPVWPPGLP 652 Query: 956 PXP 964 P P Sbjct: 653 PQP 655 >AY118423-1|AAM48452.1| 263|Drosophila melanogaster RH04014p protein. Length = 263 Score = 29.9 bits (64), Expect = 5.8 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G G G G G G G GGG GG G G Sbjct: 121 GGAGGAGQAGQAGALLGGAGGAGGAGGGGSAGGGGGGGGGGGGG 164 >AY051568-1|AAK92992.1| 263|Drosophila melanogaster GH21518p protein. Length = 263 Score = 29.9 bits (64), Expect = 5.8 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G G G G G G G GGG GG G G Sbjct: 121 GGAGGAGQAGQAGALLGGAGGAGGAGGGGSAGGGGGGGGGGGGG 164 >AM412918-1|CAL85541.1| 178|Drosophila melanogaster CG16743 protein protein. Length = 178 Score = 29.9 bits (64), Expect = 5.8 Identities = 15/47 (31%), Positives = 16/47 (34%), Gaps = 3/47 (6%) Frame = +2 Query: 824 HPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXP---PPXXXPPXXP 955 +P PP P PP PP P P P PP P P Sbjct: 87 YPYNPYMPPPPPPPPHPQQAPPPSMYPPGPSGYPGGYPPQGAPEQNP 133 >AM294881-1|CAL26867.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 29.9 bits (64), Expect = 5.8 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 GG GG G G G G G G GG GG Sbjct: 55 GGGGGGGGGGSGGGGGGGSGSGGGSGSGDGGGGAIGG 91 Score = 29.9 bits (64), Expect = 5.8 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXG 856 G GG GG GGG G G G G G G Sbjct: 55 GGGGGGGGGGSGGGGGGGSGSGGGSGSGDGGGGAIG 90 >AM294880-1|CAL26866.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 29.9 bits (64), Expect = 5.8 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 GG GG G G G G G G GG GG Sbjct: 55 GGGGGGGGGGSGGGGGGGSGSGGGSGSGDGGGGAIGG 91 Score = 29.9 bits (64), Expect = 5.8 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXG 856 G GG GG GGG G G G G G G Sbjct: 55 GGGGGGGGGGSGGGGGGGSGSGGGSGSGDGGGGAIG 90 >AM294879-1|CAL26865.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 29.9 bits (64), Expect = 5.8 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 GG GG G G G G G G GG GG Sbjct: 55 GGGGGGGGGGSGGGGGGGSGSGGGSGSGDGGGGAIGG 91 Score = 29.9 bits (64), Expect = 5.8 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXG 856 G GG GG GGG G G G G G G Sbjct: 55 GGGGGGGGGGSGGGGGGGSGSGGGSGSGDGGGGAIG 90 >AM294876-1|CAL26862.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 29.9 bits (64), Expect = 5.8 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 GG GG G G G G G G GG GG Sbjct: 55 GGGGGGGGGGSGGGSGGGSGSGGGSGSGDGGGGAIGG 91 Score = 29.9 bits (64), Expect = 5.8 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXG 856 G GG GG GGG G G G G G G Sbjct: 55 GGGGGGGGGGSGGGSGGGSGSGGGSGSGDGGGGAIG 90 >AM294875-1|CAL26861.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 29.9 bits (64), Expect = 5.8 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 GG GG G G G G G G GG GG Sbjct: 55 GGGGGGGGGGSGGGGGGGSGSGGGSGSGDGGGGAIGG 91 Score = 29.9 bits (64), Expect = 5.8 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXG 856 G GG GG GGG G G G G G G Sbjct: 55 GGGGGGGGGGSGGGGGGGSGSGGGSGSGDGGGGAIG 90 >AM294874-1|CAL26860.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 29.9 bits (64), Expect = 5.8 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 GG GG G G G G G G GG GG Sbjct: 55 GGGGGGGGGGSGGGGGGGSGSGGGSGSGDGGGGAIGG 91 Score = 29.9 bits (64), Expect = 5.8 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXG 856 G GG GG GGG G G G G G G Sbjct: 55 GGGGGGGGGGSGGGGGGGSGSGGGSGSGDGGGGAIG 90 >AE014298-1529|AAF47983.2| 2602|Drosophila melanogaster CG2174-PA, isoform A protein. Length = 2602 Score = 29.9 bits (64), Expect = 5.8 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 4/42 (9%) Frame = +2 Query: 851 PXPXPPXXXXP----PPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P PP P PP P PP PP PP P Sbjct: 1417 PPPAPPSGGWPGVLLPPAPSVPAPPPPIRPPSMAPPAPPPAP 1458 Score = 29.5 bits (63), Expect = 7.7 Identities = 16/54 (29%), Positives = 16/54 (29%), Gaps = 1/54 (1%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPX-PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 PP P P P P PP PP P P PP P P Sbjct: 1418 PPAPPSGGWPGVLLPPAPSVPAPPPPIRPPSMAPPAPPPAPQSPPTARSPEPEP 1471 >AE014298-1528|ABI30975.1| 2693|Drosophila melanogaster CG2174-PB, isoform B protein. Length = 2693 Score = 29.9 bits (64), Expect = 5.8 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 4/42 (9%) Frame = +2 Query: 851 PXPXPPXXXXP----PPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P PP P PP P PP PP PP P Sbjct: 1508 PPPAPPSGGWPGVLLPPAPSVPAPPPPIRPPSMAPPAPPPAP 1549 Score = 29.5 bits (63), Expect = 7.7 Identities = 16/54 (29%), Positives = 16/54 (29%), Gaps = 1/54 (1%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPX-PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 PP P P P P PP PP P P PP P P Sbjct: 1509 PPAPPSGGWPGVLLPPAPSVPAPPPPIRPPSMAPPAPPPAPQSPPTARSPEPEP 1562 >AE014297-2841|AAF55795.1| 263|Drosophila melanogaster CG4000-PA protein. Length = 263 Score = 29.9 bits (64), Expect = 5.8 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G G G G G G G GGG GG G G Sbjct: 121 GGAGGAGQAGQAGALLGGAGGAGGAGGGGSAGGGGGGGGGGGGG 164 >AE013599-2048|AAF58145.1| 532|Drosophila melanogaster CG16801-PA, isoform A protein. Length = 532 Score = 29.9 bits (64), Expect = 5.8 Identities = 14/48 (29%), Positives = 14/48 (29%) Frame = +2 Query: 812 PXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXP 955 P H P P P PPP P PPP P P Sbjct: 132 PKKLHSPQRHCYTPPPAPMHGQAPPPTSTGVAPPTQPPPPHPAAPNVP 179 >AE013599-2047|AAM68536.1| 744|Drosophila melanogaster CG16801-PB, isoform B protein. Length = 744 Score = 29.9 bits (64), Expect = 5.8 Identities = 14/48 (29%), Positives = 14/48 (29%) Frame = +2 Query: 812 PXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXP 955 P H P P P PPP P PPP P P Sbjct: 132 PKKLHSPQRHCYTPPPAPMHGQAPPPTSTGVAPPTQPPPPHPAAPNVP 179 >X71976-1|CAA50796.1| 188|Drosophila melanogaster GCR 1 protein protein. Length = 188 Score = 29.5 bits (63), Expect = 7.7 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 930 GGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 GGG G G GGG GG G GG Sbjct: 32 GGGGGFGGGFGGGFGGGLGGGGGGGGGG 59 >U54982-2|AAC16666.1| 1262|Drosophila melanogaster stn-B protein. Length = 1262 Score = 29.5 bits (63), Expect = 7.7 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P PP P PP P P P PPP P P Sbjct: 228 PATPIKQPPRPPPPRPAPPRPAPPGQAAPQRPPPPLAAVNPPPAAP 273 >BT021242-1|AAX33390.1| 1011|Drosophila melanogaster RE67944p protein. Length = 1011 Score = 29.5 bits (63), Expect = 7.7 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 851 PXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P PP PP PPP P PP P Sbjct: 586 PPPAPPMLKAIPPPPPPMAPSMMPPPPPPCPGAPPPPP 623 >BT011172-1|AAR88533.1| 1262|Drosophila melanogaster RH38069p protein. Length = 1262 Score = 29.5 bits (63), Expect = 7.7 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P PP P PP P P P PPP P P Sbjct: 228 PATPIKQPPRPPPPRPAPPRPAPPGQAAPQRPPPPLAAVNPPPAAP 273 >BT003283-1|AAO25040.1| 178|Drosophila melanogaster HL05737p protein. Length = 178 Score = 29.5 bits (63), Expect = 7.7 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G G GGG G G GGG GG GG Sbjct: 125 GGGFEGNGYGGGGGGNMGGGRGGPRGGGGPKGGGGFNGG 163 >BT001384-1|AAN71139.1| 178|Drosophila melanogaster GH03391p protein. Length = 178 Score = 29.5 bits (63), Expect = 7.7 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G G GGG G G GGG GG GG Sbjct: 125 GGGFEGNGYGGGGGGNMGGGRGGPRGGGGPKGGGGFNGG 163 >AY119164-1|AAM51024.1| 192|Drosophila melanogaster RH23514p protein. Length = 192 Score = 29.5 bits (63), Expect = 7.7 Identities = 15/47 (31%), Positives = 16/47 (34%), Gaps = 3/47 (6%) Frame = +2 Query: 824 HPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXP---PPXXXPPXXP 955 +P PP P PP PP P P P PP P P Sbjct: 90 YPYNLYMPPPPPPPPHPQQAPPPSMYPPDPSGYPGGYPPQGAPGQNP 136 >AY119132-1|AAM50992.1| 188|Drosophila melanogaster RE35358p protein. Length = 188 Score = 29.5 bits (63), Expect = 7.7 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 930 GGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 GGG G G GGG GG G GG Sbjct: 32 GGGGGFGGGFGGGFGGGLGGGGGGGGGG 59 >AY118439-1|AAM48468.1| 1114|Drosophila melanogaster RH61354p protein. Length = 1114 Score = 29.5 bits (63), Expect = 7.7 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 851 PXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P PP PP PPP P PP P Sbjct: 547 PPPAPPMLKAIPPPPPPMAPSMMPPPPPPCPGAPPPPP 584 >AY118420-1|AAM48449.1| 250|Drosophila melanogaster RE74758p protein. Length = 250 Score = 29.5 bits (63), Expect = 7.7 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -3 Query: 993 AXXXGXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXG 856 A G G G GG GGG G GGG GG G Sbjct: 16 AGFIGGGGGGGGGYGGGGSSHGGGGDGGYSYGGGGGGGSDHHGGGG 61 >AY094783-1|AAM11136.1| 118|Drosophila melanogaster LD12750p protein. Length = 118 Score = 29.5 bits (63), Expect = 7.7 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGG 880 G GG GG GGG G G GGG Sbjct: 67 GGGGGGGGGGGGGGGGGGGGGSGYRGGG 94 >AY089614-1|AAL90352.1| 417|Drosophila melanogaster RE28792p protein. Length = 417 Score = 29.5 bits (63), Expect = 7.7 Identities = 21/91 (23%), Positives = 22/91 (24%), Gaps = 2/91 (2%) Frame = +3 Query: 735 PLXHPPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXP 914 P PPP P P P PP PP P P Sbjct: 322 PGTQAPPPMPPPLMPWMSAPQPPPPATEPLNPPIPGTLPPLIPPPPGTSAPPMPPWGGGA 381 Query: 915 PXXXXXXXXPPXXXP--XXPPXXXXXRPPRP 1001 PP P PP +PP P Sbjct: 382 YSGWGGGYAPPPPPPCAPPPPALSLSQPPPP 412 >AY075564-1|AAL68371.1| 161|Drosophila melanogaster RH68528p protein. Length = 161 Score = 29.5 bits (63), Expect = 7.7 Identities = 20/63 (31%), Positives = 20/63 (31%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGGXXXXXXX 778 GG G GGG G G GGG G G GG G G G Sbjct: 36 GGLGGRPGFGGGPGFGGGP--GFGGGPGFGGRPGFGGGPGFGGGPGFGGGQGFGGRPGFG 93 Query: 777 GXP 769 G P Sbjct: 94 GGP 96 >AY075468-1|AAL68280.1| 127|Drosophila melanogaster RE28280p protein. Length = 127 Score = 29.5 bits (63), Expect = 7.7 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G GG G GGG G GGG G G GG G G Sbjct: 33 GGPYGGGFGGGPYGGGFGGGPYGGGFGGGPYGGGFGNPYGGGFGGGRRHGGGRGGGG 89 >AY071607-1|AAL49229.1| 174|Drosophila melanogaster RE65554p protein. Length = 174 Score = 29.5 bits (63), Expect = 7.7 Identities = 20/63 (31%), Positives = 20/63 (31%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGGXXXXXXX 778 GG G GGG G G GGG G G GG G G G Sbjct: 36 GGLGGRPGFGGGPGFGGGP--GFGGGPGFGGRPGFGGGPGFGGGPGFGGGQGFGGRPGFG 93 Query: 777 GXP 769 G P Sbjct: 94 GGP 96 >AY060989-1|AAL28537.1| 222|Drosophila melanogaster GM14833p protein. Length = 222 Score = 29.5 bits (63), Expect = 7.7 Identities = 21/91 (23%), Positives = 22/91 (24%), Gaps = 2/91 (2%) Frame = +3 Query: 735 PLXHPPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXP 914 P PPP P P P PP PP P P Sbjct: 127 PGTQAPPPMPPPLMPWMSAPQPPPPATEPLNPPIPGTLPPLIPPPPGTSAPPMPPWGGGA 186 Query: 915 PXXXXXXXXPPXXXP--XXPPXXXXXRPPRP 1001 PP P PP +PP P Sbjct: 187 YSGWGGGYAPPPPPPCAPPPPALSLSQPPPP 217 >AM412919-1|CAL85542.1| 181|Drosophila melanogaster CG16743 protein protein. Length = 181 Score = 29.5 bits (63), Expect = 7.7 Identities = 15/47 (31%), Positives = 16/47 (34%), Gaps = 3/47 (6%) Frame = +2 Query: 824 HPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXP---PPXXXPPXXP 955 +P PP P PP PP P P P PP P P Sbjct: 90 YPYNPYMPPPPPPPPHPQQAPPPSMYPPGPSGYPGGYPPQGAPGQNP 136 >AM412917-1|CAL85540.1| 181|Drosophila melanogaster CG16743 protein protein. Length = 181 Score = 29.5 bits (63), Expect = 7.7 Identities = 15/47 (31%), Positives = 16/47 (34%), Gaps = 3/47 (6%) Frame = +2 Query: 824 HPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXP---PPXXXPPXXP 955 +P PP P PP PP P P P PP P P Sbjct: 90 YPYNPYMPPPPPPPPHPQQAPPPSMYPPGPSGYPGGYPPQGAPGQNP 136 >AL031640-2|CAA21052.1| 979|Drosophila melanogaster EG:114D9.2 protein. Length = 979 Score = 29.5 bits (63), Expect = 7.7 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 851 PXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P PP PP PPP P PP P Sbjct: 392 PPPAPPMLKAIPPPPPPMAPSMMPPPPPPCPGAPPPPP 429 >AF314193-1|AAK00302.1| 3109|Drosophila melanogaster Toutatis protein. Length = 3109 Score = 29.5 bits (63), Expect = 7.7 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G GG GG GGG G G GGG G G G Sbjct: 164 GMGGGAGGAGAGGG---GAGVLGQGGGGNGGSGNGGGG 198 >AE014298-3231|ABI31012.1| 1260|Drosophila melanogaster CG12473-PB, isoform B protein. Length = 1260 Score = 29.5 bits (63), Expect = 7.7 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P PP P PP P P P PPP P P Sbjct: 228 PATPIKQPPRPPPPRPAPPRPAPPGQAAPQRPPPPLAAVNPPPAAP 273 >AE014298-3230|EAA46059.2| 1260|Drosophila melanogaster CG12473-PA, isoform A protein. Length = 1260 Score = 29.5 bits (63), Expect = 7.7 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P PP P PP P P P PPP P P Sbjct: 228 PATPIKQPPRPPPPRPAPPRPAPPGQAAPQRPPPPLAAVNPPPAAP 273 >AE014298-1712|AAF48112.1| 118|Drosophila melanogaster CG1840-PA protein. Length = 118 Score = 29.5 bits (63), Expect = 7.7 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGG 880 G GG GG GGG G G GGG Sbjct: 67 GGGGGGGGGGGGGGGGGGGGGSGYRGGG 94 >AE014298-174|AAF45600.2| 1114|Drosophila melanogaster CG14622-PA, isoform A protein. Length = 1114 Score = 29.5 bits (63), Expect = 7.7 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 851 PXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P PP PP PPP P PP P Sbjct: 547 PPPAPPMLKAIPPPPPPMAPSMMPPPPPPCPGAPPPPP 584 >AE014298-173|AAN09040.1| 1153|Drosophila melanogaster CG14622-PB, isoform B protein. Length = 1153 Score = 29.5 bits (63), Expect = 7.7 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 851 PXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P PP PP PPP P PP P Sbjct: 586 PPPAPPMLKAIPPPPPPMAPSMMPPPPPPCPGAPPPPP 623 >AE014298-172|AAF45601.2| 1455|Drosophila melanogaster CG14622-PC, isoform C protein. Length = 1455 Score = 29.5 bits (63), Expect = 7.7 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 851 PXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P PP PP PPP P PP P Sbjct: 888 PPPAPPMLKAIPPPPPPMAPSMMPPPPPPCPGAPPPPP 925 >AE014297-4805|AAF57194.1| 188|Drosophila melanogaster CG2150-PA protein. Length = 188 Score = 29.5 bits (63), Expect = 7.7 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 930 GGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 GGG G G GGG GG G GG Sbjct: 32 GGGGGFGGGFGGGFGGGLGGGGGGGGGG 59 >AE014297-2366|AAF55430.3| 787|Drosophila melanogaster CG5836-PA protein. Length = 787 Score = 29.5 bits (63), Expect = 7.7 Identities = 21/91 (23%), Positives = 22/91 (24%), Gaps = 2/91 (2%) Frame = +3 Query: 735 PLXHPPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXP 914 P PPP P P P PP PP P P Sbjct: 692 PGTQAPPPMPPPLMPWMSAPQPPPPATEPLNPPIPGTLPPLIPPPPGTSAPPMPPWGGGA 751 Query: 915 PXXXXXXXXPPXXXP--XXPPXXXXXRPPRP 1001 PP P PP +PP P Sbjct: 752 YSGWGGGYAPPPPPPCAPPPPALSLSQPPPP 782 >AE014297-1707|AAS65146.1| 178|Drosophila melanogaster CG16901-PD, isoform D protein. Length = 178 Score = 29.5 bits (63), Expect = 7.7 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G G GGG G G GGG GG GG Sbjct: 125 GGGFEGNGYGGGGGGNMGGGRGGPRGGGGPKGGGGFNGG 163 >AE014297-1706|AAF54963.2| 344|Drosophila melanogaster CG16901-PB, isoform B protein. Length = 344 Score = 29.5 bits (63), Expect = 7.7 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G G GGG G G GGG GG GG Sbjct: 291 GGGFEGNGYGGGGGGNMGGGRGGPRGGGGPKGGGGFNGG 329 >AE014296-1850|AAF50135.2| 250|Drosophila melanogaster CG12523-PA protein. Length = 250 Score = 29.5 bits (63), Expect = 7.7 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -3 Query: 993 AXXXGXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXG 856 A G G G GG GGG G GGG GG G Sbjct: 16 AGFIGGGGGGGGGYGGGGSSHGGGGDGGYSYGGGGGGGSDHHGGGG 61 >AE014134-1996|AAF53039.1| 192|Drosophila melanogaster CG16743-PA protein. Length = 192 Score = 29.5 bits (63), Expect = 7.7 Identities = 15/47 (31%), Positives = 16/47 (34%), Gaps = 3/47 (6%) Frame = +2 Query: 824 HPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXP---PPXXXPPXXP 955 +P PP P PP PP P P P PP P P Sbjct: 90 YPYNLYMPPPPPPPPHPQQAPPPSMYPPDPSGYPGGYPPQGAPGQNP 136 >AE014134-1931|AAF52991.1| 127|Drosophila melanogaster CG7294-PA protein. Length = 127 Score = 29.5 bits (63), Expect = 7.7 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G GG G GGG G GGG G G GG G G Sbjct: 33 GGPYGGGFGGGPYGGGFGGGPYGGGFGGGPYGGGFGNPYGGGFGGGRRHGGGRGGGG 89 >AE014134-1930|AAF52990.2| 161|Drosophila melanogaster CG7296-PA protein. Length = 161 Score = 29.5 bits (63), Expect = 7.7 Identities = 20/63 (31%), Positives = 20/63 (31%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGGXXXXXXX 778 GG G GGG G G GGG G G GG G G G Sbjct: 36 GGLGGRPGFGGGPGFGGGP--GFGGGPGFGGRPGFGGGPGFGGGPGFGGGQGFGGRPGFG 93 Query: 777 GXP 769 G P Sbjct: 94 GGP 96 >AE013599-1322|AAF58638.2| 3080|Drosophila melanogaster CG10897-PA, isoform A protein. Length = 3080 Score = 29.5 bits (63), Expect = 7.7 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G GG GG GGG G G GGG G G G Sbjct: 164 GMGGGAGGAGAGGG---GAGVLGQGGGGNGGSGNGGGG 198 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,224,828 Number of Sequences: 53049 Number of extensions: 679817 Number of successful extensions: 8438 Number of sequences better than 10.0: 228 Number of HSP's better than 10.0 without gapping: 2314 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5456 length of database: 24,988,368 effective HSP length: 85 effective length of database: 20,479,203 effective search space used: 5140279953 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -