BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_H16 (1010 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 48 8e-06 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 46 4e-05 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 46 4e-05 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 43 4e-04 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 42 7e-04 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 41 0.001 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 41 0.001 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 41 0.001 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 41 0.002 At5g46730.1 68418.m05757 glycine-rich protein 40 0.003 At4g01985.1 68417.m00265 expressed protein 40 0.003 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 40 0.003 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 40 0.003 At1g61080.1 68414.m06877 proline-rich family protein 40 0.003 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 40 0.003 At2g05440.2 68415.m00575 glycine-rich protein 40 0.003 At4g38770.1 68417.m05490 proline-rich family protein (PRP4) simi... 39 0.005 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 39 0.005 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 39 0.006 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 38 0.014 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 38 0.014 At1g10620.1 68414.m01204 protein kinase family protein contains ... 38 0.014 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 37 0.019 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 37 0.019 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 37 0.024 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 37 0.024 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 37 0.024 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 37 0.024 At2g30560.1 68415.m03722 glycine-rich protein 37 0.024 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 37 0.024 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 36 0.032 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 36 0.043 At1g75550.1 68414.m08780 glycine-rich protein 36 0.043 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 36 0.043 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 36 0.043 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 36 0.057 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 36 0.057 At5g59170.1 68418.m07416 proline-rich family protein contains pr... 35 0.075 At1g26150.1 68414.m03192 protein kinase family protein similar t... 35 0.075 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 35 0.099 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 35 0.099 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 35 0.099 At4g30460.1 68417.m04325 glycine-rich protein 35 0.099 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 35 0.099 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 35 0.099 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 35 0.099 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 35 0.099 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 34 0.13 At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin fa... 34 0.13 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 34 0.13 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 34 0.13 At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar... 34 0.13 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 34 0.13 At5g38560.1 68418.m04662 protein kinase family protein contains ... 34 0.17 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 34 0.17 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 33 0.23 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 33 0.23 At2g05380.1 68415.m00566 glycine-rich protein (GRP3S) identical ... 33 0.23 At1g29380.1 68414.m03592 hypothetical protein 33 0.23 At1g27750.1 68414.m03391 ubiquitin system component Cue domain-c... 33 0.23 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 33 0.23 At5g43770.1 68418.m05353 proline-rich family protein contains pr... 33 0.30 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 33 0.30 At2g05440.1 68415.m00574 glycine-rich protein 33 0.30 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 33 0.40 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 33 0.40 At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identica... 32 0.53 At4g08380.1 68417.m01384 proline-rich extensin-like family prote... 32 0.53 At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to... 32 0.53 At2g05510.1 68415.m00583 glycine-rich protein 32 0.53 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 32 0.53 At1g27710.1 68414.m03387 glycine-rich protein 32 0.53 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 32 0.70 At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; g... 32 0.70 At2g28490.1 68415.m03462 cupin family protein similar to preproM... 32 0.70 At1g04660.1 68414.m00463 glycine-rich protein 32 0.70 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 31 0.92 At4g18570.1 68417.m02749 proline-rich family protein common fami... 31 0.92 At3g04640.1 68416.m00497 glycine-rich protein predicted proteins... 31 0.92 At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein ... 31 0.92 At2g43150.1 68415.m05358 proline-rich extensin-like family prote... 31 0.92 At1g31750.1 68414.m03895 proline-rich family protein contains pr... 31 0.92 At1g02710.1 68414.m00222 glycine-rich protein 31 0.92 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 31 1.2 At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protei... 31 1.2 At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protei... 31 1.2 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 31 1.2 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 31 1.2 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 31 1.2 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 31 1.2 At1g11850.2 68414.m01364 expressed protein 31 1.2 At1g11130.1 68414.m01274 leucine-rich repeat family protein / pr... 31 1.2 At5g62760.2 68418.m07879 nuclear protein ZAP-related similar to ... 31 1.6 At5g62760.1 68418.m07878 nuclear protein ZAP-related similar to ... 31 1.6 At4g33660.1 68417.m04781 expressed protein 31 1.6 At4g29020.1 68417.m04149 glycine-rich protein supporting cDNA gi... 30 2.1 At4g08370.1 68417.m01382 proline-rich extensin-like family prote... 30 2.1 At3g50140.1 68416.m05481 expressed protein contains Pfam profile... 30 2.1 At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PL... 30 2.1 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 30 2.1 At5g61660.1 68418.m07736 glycine-rich protein 30 2.8 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 30 2.8 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 30 2.8 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 30 2.8 At3g24550.1 68416.m03083 protein kinase family protein contains ... 30 2.8 At3g22070.1 68416.m02785 proline-rich family protein contains pr... 30 2.8 At2g11005.1 68415.m01177 glycine-rich protein 30 2.8 At1g70990.1 68414.m08190 proline-rich family protein 30 2.8 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 30 2.8 At5g65390.1 68418.m08224 arabinogalactan-protein (AGP7) 29 3.7 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 29 3.7 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 29 3.7 At1g53625.1 68414.m06096 expressed protein 29 3.7 At5g19090.2 68418.m02270 heavy-metal-associated domain-containin... 29 4.9 At5g19090.1 68418.m02269 heavy-metal-associated domain-containin... 29 4.9 At5g13760.1 68418.m01604 expressed protein similar to unknown pr... 29 4.9 At5g08230.1 68418.m00965 PWWP domain-containing protein putative... 29 4.9 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 29 4.9 At4g15460.1 68417.m02363 glycine-rich protein 29 4.9 At1g04800.1 68414.m00476 glycine-rich protein 29 4.9 At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ b... 29 6.5 At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family... 28 8.6 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 28 8.6 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 28 8.6 At3g60900.1 68416.m06813 fasciclin-like arabinogalactan-protein ... 28 8.6 At3g06130.1 68416.m00704 heavy-metal-associated domain-containin... 28 8.6 At2g26410.1 68415.m03169 calmodulin-binding family protein simil... 28 8.6 At2g16630.1 68415.m01909 proline-rich family protein contains pr... 28 8.6 At1g79480.1 68414.m09263 hypothetical protein low similarity to ... 28 8.6 At1g62240.1 68414.m07021 expressed protein 28 8.6 At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containi... 28 8.6 At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin fa... 28 8.6 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 48.4 bits (110), Expect = 8e-06 Identities = 20/53 (37%), Positives = 21/53 (39%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 PP P + PP P PP PPP P P PPP PP PP Sbjct: 456 PPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPP 508 Score = 47.2 bits (107), Expect = 2e-05 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 P P P PP P PP PPP P P PPP PP PP Sbjct: 426 PPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPP 477 Score = 46.0 bits (104), Expect = 4e-05 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P P PP P PP PP P P PPP PP PP P Sbjct: 451 PPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPP 504 Score = 45.6 bits (103), Expect = 5e-05 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P PP P PP PPP P P PP PP PP P Sbjct: 427 PPPSPP---PPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPP 483 Query: 980 P 982 P Sbjct: 484 P 484 Score = 45.2 bits (102), Expect = 7e-05 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P PP P PPP P P PPP PP PP P Sbjct: 404 PPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPP 458 Score = 44.8 bits (101), Expect = 9e-05 Identities = 19/53 (35%), Positives = 20/53 (37%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 PP P + PP P P PPP P P PPP PP PP Sbjct: 441 PPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPP 493 Score = 41.9 bits (94), Expect = 7e-04 Identities = 21/64 (32%), Positives = 22/64 (34%), Gaps = 3/64 (4%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPX---PPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXX 970 PP P + PP P PP PPP P P PPP P PP P Sbjct: 428 PPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSP 487 Query: 971 XXXP 982 P Sbjct: 488 PPPP 491 Score = 41.9 bits (94), Expect = 7e-04 Identities = 23/87 (26%), Positives = 24/87 (27%) Frame = +3 Query: 735 PLXHPPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXP 914 P PPPP + P P P PP PP P P P Sbjct: 438 PPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSP 497 Query: 915 PXXXXXXXXPPXXXPXXPPXXXXXRPP 995 P PP P PP PP Sbjct: 498 PPPPPPPPPPPVYSPPPPPVYSSPPPP 524 Score = 41.9 bits (94), Expect = 7e-04 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P PP P PP PPP P P PPP PP P Sbjct: 473 PPPPPPVYSPPPPS--PPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPT 530 Query: 980 P 982 P Sbjct: 531 P 531 Score = 41.5 bits (93), Expect = 9e-04 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 PP P PP P PP PPP P P PPP PP PP Sbjct: 412 PPAPIFSTPPTLTSPPPPSPPPPVYSPPPP--PPPPPPVYSPPPPPPPPPPPP 462 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXP 955 PP P P PP PP PPP P PPP PP P Sbjct: 411 PPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPP 462 Score = 39.1 bits (87), Expect = 0.005 Identities = 28/123 (22%), Positives = 29/123 (23%) Frame = +3 Query: 633 PXPXPXXPXXXXXXXGPXSPXXEGXXXQTX*NXXPLXHPPPPXXXXAXXXXXXRXXPXPX 812 P P P P P T + P PPP P Sbjct: 394 PRPPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPP 453 Query: 813 XXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXPPXXXXXXXXPPXXXPXXPPXXXXXRP 992 P PP PP P P PP PP P PP P Sbjct: 454 PPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPP 513 Query: 993 PRP 1001 P P Sbjct: 514 PPP 516 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Frame = +2 Query: 812 PXXXHPXXXXXXPPXPXPPXXXXPPP--XXXXXPXPXXXPPPXXXPPXXPPXP 964 P P PP PP PPP P P PPP PP PP P Sbjct: 421 PTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPP 473 Score = 38.3 bits (85), Expect = 0.008 Identities = 28/125 (22%), Positives = 29/125 (23%), Gaps = 2/125 (1%) Frame = +3 Query: 633 PXPXPXXPXXXXXXXGPXSPXXEGXXXQTX*NXXPLX--HPPPPXXXXAXXXXXXRXXPX 806 P P P P P P P+ PPPP P Sbjct: 497 PPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPE 556 Query: 807 PXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXPPXXXXXXXXPPXXXPXXPPXXXXX 986 P PP PP P P PP PP PP Sbjct: 557 PYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCI 616 Query: 987 RPPRP 1001 PP P Sbjct: 617 EPPPP 621 Score = 37.9 bits (84), Expect = 0.011 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 851 PXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P P PP P P P PPP PP PP P P Sbjct: 408 PSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSP 451 Score = 37.5 bits (83), Expect = 0.014 Identities = 22/89 (24%), Positives = 23/89 (25%) Frame = +3 Query: 735 PLXHPPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXP 914 P PPPP + P P PP PP P P P Sbjct: 453 PPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSP 512 Query: 915 PXXXXXXXXPPXXXPXXPPXXXXXRPPRP 1001 P PP P P PP P Sbjct: 513 PPPPVYSSPPPPPSPAPTPVYCTRPPPPP 541 Score = 35.5 bits (78), Expect = 0.057 Identities = 20/68 (29%), Positives = 21/68 (30%), Gaps = 7/68 (10%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPP-------PXXXPPXXPP 958 PP P + PP P P PPP P P P P PP PP Sbjct: 487 PPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPP 546 Query: 959 XPXXXXXP 982 P P Sbjct: 547 PPQFSPPP 554 Score = 35.1 bits (77), Expect = 0.075 Identities = 17/57 (29%), Positives = 17/57 (29%) Frame = +2 Query: 812 PXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P P P P P PP P P PP PP PP P P Sbjct: 396 PPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPP 452 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P PP P P PPP P PPP PP P Sbjct: 593 PPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPP--PPPPVVHYSSPPPPPVYYSS 650 Query: 980 P 982 P Sbjct: 651 P 651 Score = 31.9 bits (69), Expect = 0.70 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P P P PP PP PPP PP P Sbjct: 601 PPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSS 660 Query: 980 P 982 P Sbjct: 661 P 661 Score = 31.5 bits (68), Expect = 0.92 Identities = 26/124 (20%), Positives = 27/124 (21%), Gaps = 1/124 (0%) Frame = +3 Query: 633 PXPXPXXPXXXXXXXGPXSPXXEGXXXQTX*NXXPLXHPPPPXXXXAXXXXXXRXXPXPX 812 P P P P P P + PPP P P Sbjct: 443 PPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPP 502 Query: 813 XXPXTPPXXXXXPPXXXXPXXXXXP-XXXXXXXXPPXXXXXXXXPPXXXPXXPPXXXXXR 989 P P PP P P PP PP P P Sbjct: 503 PPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSS 562 Query: 990 PPRP 1001 PP P Sbjct: 563 PPPP 566 Score = 31.5 bits (68), Expect = 0.92 Identities = 22/92 (23%), Positives = 23/92 (25%), Gaps = 3/92 (3%) Frame = +3 Query: 735 PLXHPPPPXXXXAXXXXXXRXXPXPXXX---PXTPPXXXXXPPXXXXPXXXXXPXXXXXX 905 P PPPP P P P +PP PP P Sbjct: 541 PPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSS 600 Query: 906 XXPPXXXXXXXXPPXXXPXXPPXXXXXRPPRP 1001 P PP P PP PP P Sbjct: 601 PPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPP 632 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P P P PPP P P PPP PP P Sbjct: 583 PPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPP---PPPCIEYSPPPPPP 634 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/52 (28%), Positives = 15/52 (28%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P PP P P PPP P P PP P P P Sbjct: 654 PPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEESPP 705 Score = 29.1 bits (62), Expect = 4.9 Identities = 29/129 (22%), Positives = 30/129 (23%), Gaps = 6/129 (4%) Frame = +3 Query: 633 PXPXPXXPXXXXXXXGPXSPXXEGXXXQTX*NXXPLXHPPPPXXXXAXXXXXXRXXPXP- 809 P P P P P P + P PPPP P P Sbjct: 538 PPPPPHSPPPPQFSPPPPEPYYYSSPPPPH-SSPPPHSPPPPHSPPPPIYPYLSPPPPPT 596 Query: 810 --XXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXPPXXXXXXXXPP---XXXPXXPPX 974 P TP PP P PP PP P PP Sbjct: 597 PVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPV 656 Query: 975 XXXXRPPRP 1001 PP P Sbjct: 657 YYSSPPPPP 665 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 46.0 bits (104), Expect = 4e-05 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P PP P PP PPP P P PPP P PP P Sbjct: 518 PPPAPVNS-PPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPP 576 Query: 980 P 982 P Sbjct: 577 P 577 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 3/63 (4%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPP---XXPPXPXXX 973 P P P PP P PP PPP P PPP PP PP P Sbjct: 543 PPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPV 602 Query: 974 XXP 982 P Sbjct: 603 HSP 605 Score = 37.5 bits (83), Expect = 0.014 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P PP P PPP P P PPP P PP P Sbjct: 534 PPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPP---PVYSPPPPVHSPP 590 Query: 980 P 982 P Sbjct: 591 P 591 Score = 37.5 bits (83), Expect = 0.014 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 3/63 (4%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPX---PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXX 973 P P P PP P PP PPP P P PP P PP P Sbjct: 568 PPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFS 627 Query: 974 XXP 982 P Sbjct: 628 PPP 630 Score = 35.9 bits (79), Expect = 0.043 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P H P P P PPP P P PP PP P P Sbjct: 533 PPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPP---PPVYSPPPPVHSP 589 Query: 980 P 982 P Sbjct: 590 P 590 Score = 35.9 bits (79), Expect = 0.043 Identities = 22/87 (25%), Positives = 23/87 (26%) Frame = +3 Query: 735 PLXHPPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXP 914 P+ PPPP P P PP PP P P P Sbjct: 539 PVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPP 598 Query: 915 PXXXXXXXXPPXXXPXXPPXXXXXRPP 995 P PP P PP PP Sbjct: 599 PAPVHSPP-PPVHSPPPPPPVYSPPPP 624 Score = 35.1 bits (77), Expect = 0.075 Identities = 22/87 (25%), Positives = 22/87 (25%) Frame = +3 Query: 735 PLXHPPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXP 914 P H PPP P P P PP PP P P P Sbjct: 584 PPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSP---PVVYSP 640 Query: 915 PXXXXXXXXPPXXXPXXPPXXXXXRPP 995 P PP P P PP Sbjct: 641 PPRPPKINSPPVQSPPPAPVEKKETPP 667 Score = 33.5 bits (73), Expect = 0.23 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 P P H P P PP PP P P PP PP PP Sbjct: 596 PPPPAPVHSPPPPVHSPPPPPP--VYSPPPPVFSPPPSQSPPVVYSPPPRPP 645 Score = 32.3 bits (70), Expect = 0.53 Identities = 23/91 (25%), Positives = 24/91 (26%), Gaps = 2/91 (2%) Frame = +3 Query: 735 PLXHPPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXP 914 P+ PPPP P P P PP PP P P P Sbjct: 522 PVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPP----PPPVHSPPPPVFSPPP 577 Query: 915 P--XXXXXXXXPPXXXPXXPPXXXXXRPPRP 1001 P PP PP PP P Sbjct: 578 PVYSPPPPVHSPPPPVHSPPPPAPVHSPPPP 608 Score = 32.3 bits (70), Expect = 0.53 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P PP P P PP P P PPP P P Sbjct: 582 PP--PPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYS 639 Query: 980 P 982 P Sbjct: 640 P 640 Score = 31.9 bits (69), Expect = 0.70 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXP 955 PP P P PP PP PPP P PP PP P Sbjct: 613 PPPPPVYSPPPPVFSPPPSQSPPVVYSPPPR-----PPKINSPPVQSPPPAP 659 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 5/57 (8%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPX-----PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 P P P PP P PP PPP P P PPP P PP Sbjct: 503 PDDPYDQSPVTKRRSPPPAPVNSPPPPVYSPPPP-----PPPVHSPPPPVHSPPPPP 554 Score = 29.1 bits (62), Expect = 4.9 Identities = 15/57 (26%), Positives = 15/57 (26%) Frame = +2 Query: 812 PXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P P P PP P P PPP P PP P P Sbjct: 496 PPKESPQPDDPYDQSPVTKRRSPPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPP 552 Score = 28.7 bits (61), Expect = 6.5 Identities = 27/127 (21%), Positives = 28/127 (22%), Gaps = 4/127 (3%) Frame = +3 Query: 633 PXPXPXX-PXXXXXXXGPXSPXXEGXXXQTX*NXXPLXHPPPPXXXXAXXXXXXRXXPXP 809 P P P P P P P + PPP P P Sbjct: 518 PPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPP 577 Query: 810 XXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXPPXXXXXXXXPP---XXXPXXPPXXX 980 PP PP P PP PP P P Sbjct: 578 PVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVV 637 Query: 981 XXRPPRP 1001 PPRP Sbjct: 638 YSPPPRP 644 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 46.0 bits (104), Expect = 4e-05 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 PP P P PP P PP PP P P PPP PP PP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPP 431 Score = 45.2 bits (102), Expect = 7e-05 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P PP P PP PPP P P PPP P PP P Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSP-PPPPPSPPPYVYPPPPPPYVY 434 Query: 980 P 982 P Sbjct: 435 P 435 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P PP P PP PP P P PPP P PP P Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPP-PPPYVYPPPP 438 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P P P PP PP P P PPP P PP P Sbjct: 394 PPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPP 448 Score = 37.5 bits (83), Expect = 0.014 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P PP P P PPP P PPP PP P Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYP 445 Query: 980 P 982 P Sbjct: 446 P 446 Score = 37.5 bits (83), Expect = 0.014 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P P P PP PPP P P PP PP P P Sbjct: 395 PPPPPPPPPPPPPYVYPSPPPPP--PSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQ 452 Query: 980 P 982 P Sbjct: 453 P 453 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/67 (26%), Positives = 18/67 (26%) Frame = +3 Query: 801 PXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXPPXXXXXXXXPPXXXPXXPPXXX 980 P P P PP PP P P PP PP P P Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPY 442 Query: 981 XXRPPRP 1001 PP P Sbjct: 443 VYPPPPP 449 Score = 31.1 bits (67), Expect = 1.2 Identities = 23/89 (25%), Positives = 23/89 (25%) Frame = +3 Query: 735 PLXHPPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXP 914 P PPPP P P P PP PP P P P Sbjct: 376 PPSPPPPPPPPPPPPPPPP-PPPPPPPPPPPPPYVYPSPP----PPPPSPPPYVYPPPPP 430 Query: 915 PXXXXXXXXPPXXXPXXPPXXXXXRPPRP 1001 P PP P PP P P Sbjct: 431 PYVYPPPPSPPYVYPPPPPSPQPYMYPSP 459 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 42.7 bits (96), Expect = 4e-04 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P PP P PP PPP P P PPP PP PP P Sbjct: 64 PPPPPPCPPPPSPPPCP-PPPSPPPSPPPPQLPPPPQLPPPAPPKP 108 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P PP P PP PPP P PPP PP PP P Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPP--PCPPPPSPPPCPPPPSPPPSPPPPQLPPPP 98 Score = 39.5 bits (88), Expect = 0.003 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 4/59 (6%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXP-PPXXXXXPXPXXXPPPXXXPP---XXPPXP 964 PP P PP P PP P PP P P PPP PP PP P Sbjct: 47 PPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAP 105 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P PP P PP PP P P PP P PP P Sbjct: 63 PPPPPPPCPPPPSP--PPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTP 115 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +2 Query: 824 HPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 +P P P P PPP P P PPP PP PP P P Sbjct: 45 NPPPSPSPEPEPEPADCPPPPPPPPCPPPP--SPPPCPPPPSPPPSPPPPQLP 95 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 1/49 (2%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPX-PPXXXXPPPXXXXXPXPXXXPPPXXXP 943 PP P P PP P PP PPP P P PP P Sbjct: 73 PPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAP---PKPQPSPPTPDLP 118 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/51 (27%), Positives = 15/51 (29%) Frame = +3 Query: 735 PLXHPPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXP 887 P PPPP P P P +PP PP P P Sbjct: 58 PADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKP 108 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 41.9 bits (94), Expect = 7e-04 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P PP P PP PPP P P PPP P PP P Sbjct: 568 PPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPP-PSPVYSPPPPSHSPP 626 Query: 980 P 982 P Sbjct: 627 P 627 Score = 39.5 bits (88), Expect = 0.003 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P PP PP PPP P P PPP P PP P Sbjct: 561 PPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSP-PPPSPVYSPP 619 Query: 980 P 982 P Sbjct: 620 P 620 Score = 35.9 bits (79), Expect = 0.043 Identities = 21/65 (32%), Positives = 21/65 (32%), Gaps = 5/65 (7%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPX---PXPPXXXXPPPXXXXXPXPXXX--PPPXXXPPXXPPXPX 967 P P P PP P PP PPP P P PPP PP P P Sbjct: 538 PPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPP 597 Query: 968 XXXXP 982 P Sbjct: 598 PVFSP 602 Score = 33.9 bits (74), Expect = 0.17 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXP--XXXPPPXXXPPXXPPXPXXX 973 PP P P P PP PPP P P PPP PP P P Sbjct: 534 PPPQPPMPSPSPPSPIYSPP-PPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVH 592 Query: 974 XXP 982 P Sbjct: 593 SPP 595 Score = 33.9 bits (74), Expect = 0.17 Identities = 21/67 (31%), Positives = 21/67 (31%), Gaps = 7/67 (10%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXP----XPPXXXXPPPXXXXXPXPXXXPPPXXXPP---XXPPX 961 P P P PP P PP PPP P PPP PP PP Sbjct: 552 PPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPP 611 Query: 962 PXXXXXP 982 P P Sbjct: 612 PSPVYSP 618 Score = 32.3 bits (70), Expect = 0.53 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 3/63 (4%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPX--PXPPXXXXPPPXXXXXPXPX-XXPPPXXXPPXXPPXPXXX 973 P P P PP P PP PPP P P PPP P PP P Sbjct: 582 PPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPP---PVYSPPPPTFS 638 Query: 974 XXP 982 P Sbjct: 639 PPP 641 Score = 30.7 bits (66), Expect = 1.6 Identities = 19/62 (30%), Positives = 19/62 (30%), Gaps = 1/62 (1%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPP-XXXXXPXPXXXPPPXXXPPXXPPXPXXXX 976 PP P P PP PPP P P PPP P PP P Sbjct: 576 PPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPP---PSHSPPPPVYSP 632 Query: 977 XP 982 P Sbjct: 633 PP 634 Score = 28.7 bits (61), Expect = 6.5 Identities = 19/64 (29%), Positives = 19/64 (29%), Gaps = 4/64 (6%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPP----XXXXXPXPXXXPPPXXXPPXXPPXPXX 970 P P P PP P PPP P P PPP P PP P Sbjct: 508 PDDPYDASPVKNRRSPPPPKVEDTRVPPPQPPMPSPSPPSPIYSPPP---PVHSPPPPVY 564 Query: 971 XXXP 982 P Sbjct: 565 SSPP 568 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P PP PP PP P P PPP PP P P Sbjct: 54 PPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPPTPISP 108 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P P P PP P PPP P P PPP PP P P P Sbjct: 42 PPPPPYRSPVTIPPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSP 101 Score = 34.7 bits (76), Expect = 0.099 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +2 Query: 857 PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P PP PPP P PPP PP P P P Sbjct: 68 PPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPPTPISPP 109 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPP 946 PP P P PP PP PP P PPP P Sbjct: 67 PPPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPPTPISPPPKVHHP 115 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P P P PP PPP P PPP PP PP P Sbjct: 64 PPEPPLP--PRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPPP 116 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 3/58 (5%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXP---PPXXXPPXXPPXP 964 P P P P P PP PPP P P P PP PP PP P Sbjct: 49 PSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPP 106 Score = 35.1 bits (77), Expect = 0.075 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 2/63 (3%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPP--PXXXPPXXPPXPXXX 973 PP P P PP P PPP P P PP P PP PP P Sbjct: 56 PPPFPALFPPEPPL--PPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEP 113 Query: 974 XXP 982 P Sbjct: 114 PPP 116 Score = 31.5 bits (68), Expect = 0.92 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 PP P P PP P P P PP PP P P Sbjct: 46 PPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPPPPLPRLPP 90 Score = 29.1 bits (62), Expect = 4.9 Identities = 17/55 (30%), Positives = 17/55 (30%), Gaps = 2/55 (3%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPP--PXXXPPXXPP 958 PP P PP P P P P P PP P PP PP Sbjct: 41 PPPSPPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLLPP 95 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 3/56 (5%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPX---PPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 PP P P PP P PP PPP P P PPP P PP Sbjct: 536 PPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPP 591 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 3/64 (4%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPP---XXPPXPXX 970 PP P P P P PP PPP P PPP PP PP P Sbjct: 519 PPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVH 578 Query: 971 XXXP 982 P Sbjct: 579 SPPP 582 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P P P PP PPP P P PP PP P P Sbjct: 510 PPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPP---PPVHSPPPPVHSP 566 Query: 980 P 982 P Sbjct: 567 P 567 Score = 38.3 bits (85), Expect = 0.008 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 3/64 (4%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPP---XXPPXPXX 970 PP P P PP P PP PPP P P PPP PP PP P Sbjct: 502 PPPSPIHSPPPPPVYSPPPP-PPVYSPPPPPPVYSPPP---PPPVHSPPPPVHSPPPPVH 557 Query: 971 XXXP 982 P Sbjct: 558 SPPP 561 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P P PP PPP P P PPP P PP P Sbjct: 518 PPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPP---PVHSPPPPVHSPP 574 Query: 980 P 982 P Sbjct: 575 P 575 Score = 36.7 bits (81), Expect = 0.024 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P PP P P PPP P P PP P PP P P Sbjct: 494 PPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSP 545 Score = 36.7 bits (81), Expect = 0.024 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 3/63 (4%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPX---PPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXX 973 P P P PP P PP PPP P P PPP P PP P Sbjct: 573 PPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPP-PVHSPPPPVFS 631 Query: 974 XXP 982 P Sbjct: 632 PPP 634 Score = 36.3 bits (80), Expect = 0.032 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 3/60 (5%) Frame = +2 Query: 812 PXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPP---XXPPXPXXXXXP 982 P H P P PP PPP P PPP PP PP P P Sbjct: 603 PPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPP 662 Score = 35.9 bits (79), Expect = 0.043 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P P P P PPP P P P PP P P Sbjct: 493 PPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSP 552 Query: 980 P 982 P Sbjct: 553 P 553 Score = 35.9 bits (79), Expect = 0.043 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 3/64 (4%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPX---PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXX 970 PP P P PP P PP PPP P P PP PP P P Sbjct: 587 PPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPP---PPVHSPPPPV 643 Query: 971 XXXP 982 P Sbjct: 644 YSPP 647 Score = 35.5 bits (78), Expect = 0.057 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 3/64 (4%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPX---PPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXX 970 PP P PP P PP PPP P P PPP PP P P Sbjct: 609 PPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPP---PPVKSPPPPP 665 Query: 971 XXXP 982 P Sbjct: 666 VYSP 669 Score = 35.1 bits (77), Expect = 0.075 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P PP P PPP P P PP P PP P Sbjct: 494 PPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPP 553 Query: 980 P 982 P Sbjct: 554 P 554 Score = 35.1 bits (77), Expect = 0.075 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 3/64 (4%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPX---PPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXX 970 PP P PP P PP PPP P P PPP P PP P Sbjct: 529 PPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP---PVHSPPPPVY 585 Query: 971 XXXP 982 P Sbjct: 586 SPPP 589 Score = 35.1 bits (77), Expect = 0.075 Identities = 22/64 (34%), Positives = 22/64 (34%), Gaps = 3/64 (4%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPX---PPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXX 970 PP P P PP P PP PPP P P PPP PP P P Sbjct: 545 PP--PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPP---PPVHSPPPPV 599 Query: 971 XXXP 982 P Sbjct: 600 HSPP 603 Score = 35.1 bits (77), Expect = 0.075 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 6/59 (10%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPX--PPXXXXPPPXXXXXPXP----XXXPPPXXXPPXXPP 958 PP P P PP P PP PP P P PPP PP PP Sbjct: 616 PPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPPLLPP 674 Score = 32.7 bits (71), Expect = 0.40 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P P P PP P P P P P PPP P PP P P Sbjct: 478 PNDPYDQSPVKFRRSPPPPPVHSPPPPSPIHSPPPPPVYSPPP-PPPVYSPPPPPPVYSP 536 Score = 32.3 bits (70), Expect = 0.53 Identities = 23/92 (25%), Positives = 25/92 (27%), Gaps = 3/92 (3%) Frame = +3 Query: 735 PLXHPPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXP 914 P+ PPPP + P P PP PP P P P Sbjct: 523 PVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSP--PPPVHSP 580 Query: 915 PXXXXXXXXPPXXXPXXP---PXXXXXRPPRP 1001 P PP P P P PP P Sbjct: 581 PPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPP 612 Score = 32.3 bits (70), Expect = 0.53 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 4/57 (7%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPX---PPXX-XXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 PP P P PP P PP PPP P P PPP P PP Sbjct: 566 PP--PPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPP 620 Score = 31.9 bits (69), Expect = 0.70 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 3/64 (4%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPX---PPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXX 970 PP P P PP P PP PPP P P PP PP P P Sbjct: 552 PP--PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPP---PPVHSPPPPV 606 Query: 971 XXXP 982 P Sbjct: 607 HSPP 610 Score = 31.9 bits (69), Expect = 0.70 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 3/64 (4%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPX---PPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXX 970 PP P P PP P PP PPP P P PP PP P P Sbjct: 559 PP--PPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPP---PPVHSPPPPV 613 Query: 971 XXXP 982 P Sbjct: 614 YSPP 617 Score = 31.5 bits (68), Expect = 0.92 Identities = 20/64 (31%), Positives = 20/64 (31%), Gaps = 3/64 (4%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPP---XXPPXPXX 970 PP P PP PP PP P P PPP PP PP P Sbjct: 581 PPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPP---PPPVHSPPPPVFSPPPPVH 637 Query: 971 XXXP 982 P Sbjct: 638 SPPP 641 Score = 31.5 bits (68), Expect = 0.92 Identities = 20/64 (31%), Positives = 20/64 (31%), Gaps = 3/64 (4%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXX---XPPPXXXXXPXPXXXPPPXXXPPXXPPXPXX 970 PP P PP PP PPP P P PPP P PP P Sbjct: 588 PPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPP---PVHSPPPPVY 644 Query: 971 XXXP 982 P Sbjct: 645 SPPP 648 Score = 30.7 bits (66), Expect = 1.6 Identities = 22/85 (25%), Positives = 22/85 (25%) Frame = +3 Query: 747 PPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXPPXXX 926 PPPP P P PP PP P P PP Sbjct: 520 PPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP--- 576 Query: 927 XXXXXPPXXXPXXPPXXXXXRPPRP 1001 PP P PP PP P Sbjct: 577 VHSPPPPVYSPPPPP---VHSPPPP 598 Score = 30.3 bits (65), Expect = 2.1 Identities = 19/79 (24%), Positives = 21/79 (26%) Frame = +3 Query: 735 PLXHPPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXP 914 P+ PPPP + P P PP PP P P P Sbjct: 598 PVHSPPPPVH--SPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPP 655 Query: 915 PXXXXXXXXPPXXXPXXPP 971 P P P PP Sbjct: 656 PPVKSPPPPPVYSPPLLPP 674 Score = 29.5 bits (63), Expect = 3.7 Identities = 20/88 (22%), Positives = 22/88 (25%) Frame = +3 Query: 735 PLXHPPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXP 914 P+ PPPP P P P PP PP P P Sbjct: 591 PVHSPPPPVHSPPPPV---HSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPP 647 Query: 915 PXXXXXXXXPPXXXPXXPPXXXXXRPPR 998 P P P P PP+ Sbjct: 648 PPVYSPPPPPVKSPPPPPVYSPPLLPPK 675 Score = 29.1 bits (62), Expect = 4.9 Identities = 20/85 (23%), Positives = 20/85 (23%) Frame = +3 Query: 747 PPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXPPXXX 926 PPPP P P P PP PP P P PP Sbjct: 494 PPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPP--PVYSPPPPPPVHSPPPPVHS 551 Query: 927 XXXXXPPXXXPXXPPXXXXXRPPRP 1001 P P PP P Sbjct: 552 PPPPVHSPPPPVHSPPPPVHSPPPP 576 Score = 29.1 bits (62), Expect = 4.9 Identities = 27/126 (21%), Positives = 28/126 (22%), Gaps = 3/126 (2%) Frame = +3 Query: 633 PXPXPXXPXXXXXXXGPXSPXXEGXXXQTX*NXXPLXHPPPPXXXXAXXXXXXRXXPXPX 812 P P P P P P+ PPPP P P Sbjct: 521 PPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHS----PPPP 576 Query: 813 XXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXPPXXXXXXXXPPXXXPXXP---PXXXX 983 PP PP P PP PP P P P Sbjct: 577 VHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPV 636 Query: 984 XRPPRP 1001 PP P Sbjct: 637 HSPPPP 642 Score = 28.7 bits (61), Expect = 6.5 Identities = 15/57 (26%), Positives = 15/57 (26%) Frame = +2 Query: 812 PXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P H P P P P P P PP P PP P P Sbjct: 463 PSPVHKPQPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPPPSPIHSPPPPPVYSPP 519 Score = 28.7 bits (61), Expect = 6.5 Identities = 20/87 (22%), Positives = 20/87 (22%) Frame = +3 Query: 735 PLXHPPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXP 914 P H PPP P P P PP PP P P P Sbjct: 604 PPVHSPPPPVYSPPPPPPVHSPPPPVFSP-PPPVHSPPPPVYSPPPPVYSPPPPPVKSPP 662 Query: 915 PXXXXXXXXPPXXXPXXPPXXXXXRPP 995 P P P PP Sbjct: 663 PPPVYSPPLLPPKMSSPPTQTPVNSPP 689 Score = 28.3 bits (60), Expect = 8.6 Identities = 20/87 (22%), Positives = 22/87 (25%) Frame = +3 Query: 735 PLXHPPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXP 914 P+ P PP + P PP PP P P P Sbjct: 465 PVHKPQPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPPPS---PIHSPPPPPVYSPPPP 521 Query: 915 PXXXXXXXXPPXXXPXXPPXXXXXRPP 995 P PP P PP PP Sbjct: 522 PPVYSPPPPPPVYSPPPPPPVHSPPPP 548 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPP 946 PP P P PP P PP PPP P P PPP PP Sbjct: 579 PPPLPSRSIPPPLAQPPP-PRPPPPPPPPPSSRSIPSPSAPPPPPPPPP 626 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P PP P PPP P P P PP PP P Sbjct: 572 PPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPP 626 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXPXXXA 994 PP P PP PP P P PPP PP PP P P A Sbjct: 572 PPPPPPPP---PPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSA 617 Score = 33.1 bits (72), Expect = 0.30 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 PP P PP P P P PPP PP P P Sbjct: 575 PPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPP 619 Score = 31.5 bits (68), Expect = 0.92 Identities = 18/60 (30%), Positives = 18/60 (30%), Gaps = 5/60 (8%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXX-----PPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P P PP PPP P PPP P PP P Sbjct: 684 PPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVPPPPP 743 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/62 (29%), Positives = 18/62 (29%), Gaps = 7/62 (11%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPP-------XXXPPXXPP 958 PP P H PP PP PP PPP PP PP Sbjct: 660 PPPPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPP 719 Query: 959 XP 964 P Sbjct: 720 PP 721 Score = 29.9 bits (64), Expect = 2.8 Identities = 18/62 (29%), Positives = 18/62 (29%), Gaps = 7/62 (11%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPP-------XXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 PP P PP P PP PP P P P PP PP Sbjct: 604 PPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPP 663 Query: 959 XP 964 P Sbjct: 664 PP 665 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/53 (28%), Positives = 15/53 (28%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 PP P P P P P PPP P PP PP Sbjct: 596 PPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPPP 648 Score = 29.1 bits (62), Expect = 4.9 Identities = 16/61 (26%), Positives = 16/61 (26%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 P P P P PP PP P PPP PP P Sbjct: 677 PSTPPPPPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKT 736 Query: 980 P 982 P Sbjct: 737 P 737 Score = 28.3 bits (60), Expect = 8.6 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P PP P PP PP PPP PP P Sbjct: 602 PPPPPPSSRSIPSPSAPPPPPPP----PPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCA 657 Query: 980 P 982 P Sbjct: 658 P 658 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 39.9 bits (89), Expect = 0.003 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 1/62 (1%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXX-GGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXX 805 G G GG GG GGG G G GGG GG G GG G G Sbjct: 192 GEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGY 251 Query: 804 GG 799 GG Sbjct: 252 GG 253 Score = 37.9 bits (84), Expect = 0.011 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G GG GG GGG G G GGG GG GG G G G Sbjct: 182 GAHGGSGYGGGEGGGAGGGGSHGGAG-GYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEG 240 Query: 801 G 799 G Sbjct: 241 G 241 Score = 35.5 bits (78), Expect = 0.057 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G GG GG G G G G GG GG G GG G G Sbjct: 169 GGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGG 225 Score = 35.5 bits (78), Expect = 0.057 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G GG GG G G G GGG GG G GG G G G Sbjct: 199 GGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEG-GGYGGGAAGGYGGGGGG 257 Query: 801 G 799 G Sbjct: 258 G 258 Score = 33.9 bits (74), Expect = 0.17 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G GG G GGG G G GGG G G G G G Sbjct: 144 GYGNGAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSH 203 Query: 801 G 799 G Sbjct: 204 G 204 Score = 33.5 bits (73), Expect = 0.23 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G GG G GG G G GG G G GG G G G Sbjct: 66 GEGAGGGYGGAEGYASGGGSGHGGGGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGG 125 Query: 801 G 799 G Sbjct: 126 G 126 Score = 33.5 bits (73), Expect = 0.23 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -3 Query: 993 AXXXGXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXX 814 A G G GG GG GGG G G G G G G G G Sbjct: 101 ASGAGEGGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGY 160 Query: 813 G 811 G Sbjct: 161 G 161 Score = 32.3 bits (70), Expect = 0.53 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 GG G GGG G GGG GG GG G G G Sbjct: 231 GGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGGGG 282 Score = 32.3 bits (70), Expect = 0.53 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G GG GGG G GGG GG G GG Sbjct: 249 GGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGGGGHGGGG 287 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G GG GG GG G G GGG G G GG G G G Sbjct: 35 GGGGHGGGGGSGGVSSGGYGGES--GGGYGGGSGEGAGGGYGGAEGYASGGGSG 86 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G G GG GGG G G G G G GG G GG Sbjct: 161 GGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGG 215 Score = 30.7 bits (66), Expect = 1.6 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G G GG GG G G GGG GG G G G G G Sbjct: 163 GAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGG---AGGGGSHGGAGGYGGGGGGGSGG 219 Query: 801 G 799 G Sbjct: 220 G 220 Score = 30.7 bits (66), Expect = 1.6 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG GG GGG G G G G G G GG G G GG Sbjct: 211 GGGGGG--SGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGG 261 Score = 30.3 bits (65), Expect = 2.1 Identities = 19/62 (30%), Positives = 19/62 (30%), Gaps = 1/62 (1%) Frame = -3 Query: 981 GXXXXXGXGGXXG-GXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXX 805 G G GG G G G G G GG GG G GG G Sbjct: 130 GGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGY 189 Query: 804 GG 799 GG Sbjct: 190 GG 191 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG GG G G G GGG GG G G GG Sbjct: 59 GGYGGGSGEGAGGGYGGAEGYASGGGSGHGGGGGGAASSGGYASGAGEGGGGG 111 Score = 28.7 bits (61), Expect = 6.5 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -3 Query: 993 AXXXGXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXX 814 A G G GG GG GG G G GG G G GG G Sbjct: 228 AHGGGYGSGGGEGGGYGGGA-AGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGGGGHGGG 286 Query: 813 G 811 G Sbjct: 287 G 287 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 39.9 bits (89), Expect = 0.003 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 1/62 (1%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXG-GGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXX 805 G G GG GG G GG G G GGG GG G GG G G Sbjct: 449 GGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGV 508 Query: 804 GG 799 GG Sbjct: 509 GG 510 Score = 35.1 bits (77), Expect = 0.075 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GG GGG G G GG GG G GG G G G Sbjct: 162 GRGGKSGG-GAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASG 215 Score = 34.7 bits (76), Expect = 0.099 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G G GG GGG G G G G G GG G G G Sbjct: 232 GGVGVGGGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVG 291 Query: 801 G 799 G Sbjct: 292 G 292 Score = 34.7 bits (76), Expect = 0.099 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GG GG G G GGG G G GG G G GG Sbjct: 466 GSGGAGGGT--GGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRGAVGG 518 Score = 33.9 bits (74), Expect = 0.17 Identities = 22/65 (33%), Positives = 22/65 (33%) Frame = -3 Query: 993 AXXXGXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXX 814 A G G GG G GGG G G GGG G G GG G Sbjct: 92 AIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAG-GGIGGGAGGAIGG 150 Query: 813 GXXGG 799 G GG Sbjct: 151 GASGG 155 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG G G G G G GGG G G G G G GG Sbjct: 69 GGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGG 123 Score = 33.5 bits (73), Expect = 0.23 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G GG GG GG G G GGG G G G G G Sbjct: 82 GGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIG 141 Query: 801 G 799 G Sbjct: 142 G 142 Score = 33.5 bits (73), Expect = 0.23 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 1/62 (1%) Frame = -3 Query: 981 GXXXXXGXG-GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXX 805 G G G G GG GGG G G GG GG G GG G G Sbjct: 99 GGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIG-GGAGGAIGGGASGGVG 157 Query: 804 GG 799 GG Sbjct: 158 GG 159 Score = 33.5 bits (73), Expect = 0.23 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GG GG G G GGG G G GG G G GG Sbjct: 316 GSGGASGGA--SGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVGGAVGG 368 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG GG GG G GGG G G GG G G GG Sbjct: 406 GGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGG 458 Score = 33.1 bits (72), Expect = 0.30 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 2/63 (3%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGG--GXXXXGGXGXGGXXXXXXGXXXXGX 808 G G GG GG GG G G GG G GG G GG G G Sbjct: 59 GGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGG 118 Query: 807 XGG 799 G Sbjct: 119 GVG 121 Score = 33.1 bits (72), Expect = 0.30 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G G GG G G G G GGG GG GG G G G Sbjct: 132 GSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAG 186 Score = 33.1 bits (72), Expect = 0.30 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G GG GG G G G G G G GG GG G G G Sbjct: 174 GVGGGVGAGGGAGG-SVGAGGGIGSGGGGTVGAGGRGSGGASGGGGTVGAGGRGSGGASG 232 Query: 801 G 799 G Sbjct: 233 G 233 Score = 33.1 bits (72), Expect = 0.30 Identities = 20/65 (30%), Positives = 20/65 (30%) Frame = -3 Query: 993 AXXXGXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXX 814 A G G G GG GG G GGG G G GG G Sbjct: 240 AGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVGGAVGGAVG 299 Query: 813 GXXGG 799 G GG Sbjct: 300 GAVGG 304 Score = 32.7 bits (71), Expect = 0.40 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G G GG G G G G GGG G G GG G G Sbjct: 71 GGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGA 130 Query: 801 G 799 G Sbjct: 131 G 131 Score = 32.7 bits (71), Expect = 0.40 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 1/62 (1%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXG-GGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXX 805 G G GG GG G GG G G G G G GG G G Sbjct: 299 GGAVGGGGGGSVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGV 358 Query: 804 GG 799 GG Sbjct: 359 GG 360 Score = 32.7 bits (71), Expect = 0.40 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Frame = -3 Query: 957 GGXXGGXXXGGGX-XXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG GG GGG G G G G G G GG G G GG Sbjct: 445 GGAVGGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGG 498 Score = 32.3 bits (70), Expect = 0.53 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G GG G GG G GGG GG G GG Sbjct: 168 GGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGG 212 Score = 32.3 bits (70), Expect = 0.53 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G G GG GGG G G GGG G G GG G G GG Sbjct: 476 GSVGAGGGVGVGGGGGIGGGAGGGVGGGV----GGGVGGGVRGAVGGAVGGGVGG 526 Score = 31.9 bits (69), Expect = 0.70 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 2/62 (3%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGG--GXXXXGGXGXGGXXXXXXGXXXXGX 808 G G GG GG GG G GG G GG G GG G G Sbjct: 119 GVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGG 178 Query: 807 XG 802 G Sbjct: 179 VG 180 Score = 31.5 bits (68), Expect = 0.92 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG GG GG G G GGG G G GG G G GG Sbjct: 326 GGASGGA--GGSVGAGGGVGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGG 376 Score = 31.5 bits (68), Expect = 0.92 Identities = 24/86 (27%), Positives = 24/86 (27%), Gaps = 1/86 (1%) Frame = -2 Query: 1000 GRGGRXXXXXGGXXGXXXGGXXXXXXXXGGXXXXXXXXGXXXXXGXXXXGGXXXXXGG-V 824 G GGR GG G G GG G G GG GG V Sbjct: 461 GGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRGAVGGAV 520 Query: 823 XGXXXGXGXXRXXXXXXAXXXXGGGG 746 G G G A G GG Sbjct: 521 GGGVGGAGRGSGGASGGAGAGGGAGG 546 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG G GG G G GGG G GG G G GG Sbjct: 410 GGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGG 462 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GG G G GGG G GG G G GG Sbjct: 254 GSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVGGAVGGAVGGAVGGGGGG 308 Score = 30.3 bits (65), Expect = 2.1 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 2/57 (3%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXX--XGGXGXGGXXXXXXGXXXXGXXGG 799 G G G GGG G G GGG GG G GG G G G Sbjct: 43 GRGSVGVGAGAGGGASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASG 99 Score = 30.3 bits (65), Expect = 2.1 Identities = 19/62 (30%), Positives = 19/62 (30%), Gaps = 1/62 (1%) Frame = -3 Query: 981 GXXXXXGXGGXXG-GXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXX 805 G G GG G G GG G G GG G GG G G Sbjct: 113 GGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAG 172 Query: 804 GG 799 GG Sbjct: 173 GG 174 Score = 30.3 bits (65), Expect = 2.1 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 1/66 (1%) Frame = -3 Query: 993 AXXXGXXXXXGXGGXXGGXXXG-GGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXX 817 A G G GG G G GG G G GGG GG GG G Sbjct: 205 AGGRGSGGASGGGGTVGAGGRGSGGASGGVG----VGGGAGGSGGGSVGGGGRGSGGVGA 260 Query: 816 XGXXGG 799 G GG Sbjct: 261 SGGAGG 266 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G GG GG G G G GG G GG G G Sbjct: 367 GGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGG 426 Query: 801 G 799 G Sbjct: 427 G 427 Score = 29.5 bits (63), Expect = 3.7 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G GG GG GG G GGG G G G G G G Sbjct: 129 GAGGSVGAGGGIGGG--AGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAG 186 Query: 801 G 799 G Sbjct: 187 G 187 Score = 29.1 bits (62), Expect = 4.9 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG G GGG G G GGG G GG G G GG Sbjct: 262 GGAGGNVGAGGGLGGGVGG--GVGGGVGGSVGGAVGGAVGGAVGGGGGGSVGG 312 Score = 29.1 bits (62), Expect = 4.9 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG G GGG G G GGG G GG G G GG Sbjct: 330 GGAGGSVGAGGGVGGGVGG--GVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGG 380 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 GG GG GGG G GG G GG G G G Sbjct: 363 GGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASGGVGG 414 Score = 28.3 bits (60), Expect = 8.6 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGG--GXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG GG GGG G GG G G G G G G GG Sbjct: 295 GGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGG 349 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P P PP PP PP P P PPP PP P P Sbjct: 31 PAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPP 84 Score = 36.3 bits (80), Expect = 0.032 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 3/64 (4%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPP---PXXXXXPXPXXXPPPXXXPPXXPPXPXX 970 PP P P PP PP PP P P P PPP PP P P Sbjct: 58 PP--PVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAP 115 Query: 971 XXXP 982 P Sbjct: 116 LASP 119 Score = 35.1 bits (77), Expect = 0.075 Identities = 20/67 (29%), Positives = 20/67 (29%), Gaps = 2/67 (2%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPP--PXXXXXPXPXXXPPPXXXPPXXPPXPXXX 973 PP P P P PP PP P P PPP PP P P Sbjct: 51 PPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVAT 110 Query: 974 XXPXXXA 994 P A Sbjct: 111 PPPAPLA 117 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P PP PP PPP P PPP PP P P Sbjct: 33 PPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPP 84 Score = 33.9 bits (74), Expect = 0.17 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 P P P PP P P P P PPP PP PP Sbjct: 36 PTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPP 88 Score = 33.1 bits (72), Expect = 0.30 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 3/58 (5%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPP---PXXXPPXXPPXP 964 PP P P PP P PPP P P PP P P P P Sbjct: 78 PPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSP 135 Score = 32.7 bits (71), Expect = 0.40 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 1/53 (1%) Frame = +2 Query: 827 PXXXXXXPPXPX-PPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P PP P PP PPP P PP PP P P P Sbjct: 26 PPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPP 78 Score = 31.5 bits (68), Expect = 0.92 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P PP P PPP P P PP P PP P Sbjct: 45 PP--PVSAPPPVTTSPPPVTTAPPPANPPPPVS-SPPPASPPPATPPPVASPPPPVASPP 101 Query: 980 P 982 P Sbjct: 102 P 102 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 PP PP PP P P P PP P P P Sbjct: 88 PPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKP 132 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/55 (29%), Positives = 16/55 (29%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P PP PP PP P P P P P P Sbjct: 87 PP--PVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPSP 139 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/36 (33%), Positives = 12/36 (33%) Frame = +2 Query: 857 PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P P P P P PPP PP P Sbjct: 23 PTSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSP 58 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P P PP PP PP P P PPP PP P P Sbjct: 31 PAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPP 84 Score = 36.3 bits (80), Expect = 0.032 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 3/64 (4%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPP---PXXXXXPXPXXXPPPXXXPPXXPPXPXX 970 PP P P PP PP PP P P P PPP PP P P Sbjct: 58 PP--PVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAP 115 Query: 971 XXXP 982 P Sbjct: 116 LASP 119 Score = 35.1 bits (77), Expect = 0.075 Identities = 20/67 (29%), Positives = 20/67 (29%), Gaps = 2/67 (2%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPP--PXXXXXPXPXXXPPPXXXPPXXPPXPXXX 973 PP P P P PP PP P P PPP PP P P Sbjct: 51 PPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVAT 110 Query: 974 XXPXXXA 994 P A Sbjct: 111 PPPAPLA 117 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P PP PP PPP P PPP PP P P Sbjct: 33 PPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPP 84 Score = 33.9 bits (74), Expect = 0.17 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 P P P PP P P P P PPP PP PP Sbjct: 36 PTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPP 88 Score = 33.1 bits (72), Expect = 0.30 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 3/58 (5%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPP---PXXXPPXXPPXP 964 PP P P PP P PPP P P PP P P P P Sbjct: 78 PPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSP 135 Score = 32.7 bits (71), Expect = 0.40 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 1/53 (1%) Frame = +2 Query: 827 PXXXXXXPPXPX-PPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P PP P PP PPP P PP PP P P P Sbjct: 26 PPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPP 78 Score = 31.5 bits (68), Expect = 0.92 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P PP P PPP P P PP P PP P Sbjct: 45 PP--PVSAPPPVTTSPPPVTTAPPPANPPPPVS-SPPPASPPPATPPPVASPPPPVASPP 101 Query: 980 P 982 P Sbjct: 102 P 102 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 PP PP PP P P P PP P P P Sbjct: 88 PPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKP 132 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/55 (29%), Positives = 16/55 (29%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P PP PP PP P P P P P P Sbjct: 87 PP--PVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPSP 139 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/36 (33%), Positives = 12/36 (33%) Frame = +2 Query: 857 PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P P P P P PPP PP P Sbjct: 23 PTSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSP 58 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P PP P PP PP P PPP PP P Sbjct: 508 PPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPP 567 Query: 980 P 982 P Sbjct: 568 P 568 Score = 35.9 bits (79), Expect = 0.043 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 8/63 (12%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXP--------PXXXXPPPXXXXXPXPXXXPPPXXXPPXXP 955 PP P P PP P P P PPP P P PP P P Sbjct: 493 PPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPP 552 Query: 956 PXP 964 P P Sbjct: 553 PPP 555 Score = 35.5 bits (78), Expect = 0.057 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P PP P PP PP P PPP PP P Sbjct: 523 PPPPPPP--PRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPM 580 Query: 980 P 982 P Sbjct: 581 P 581 Score = 33.5 bits (73), Expect = 0.23 Identities = 30/134 (22%), Positives = 32/134 (23%) Frame = +3 Query: 600 NKSYIFIXXXXPXPXPXXPXXXXXXXGPXSPXXEGXXXQTX*NXXPLXHPPPPXXXXAXX 779 N S +F P P P SP + P PPPP Sbjct: 410 NSSQLFPPPPPPPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPP-PPPPPPPPPAVMP 468 Query: 780 XXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXPPXXXXXXXXPPXXXP 959 P P P P PP P PP PP P Sbjct: 469 LKHFAPPPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPP---P 525 Query: 960 XXPPXXXXXRPPRP 1001 PP PP P Sbjct: 526 PPPPPRAAVAPPPP 539 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 PP P P PP P PP P P PPP PP PP Sbjct: 1076 PPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPPP 1128 Score = 37.5 bits (83), Expect = 0.014 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 5/60 (8%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPP-----XXXXXPXPXXXPPPXXXPPXXPPXP 964 P P P PP P P PPP P P PPP PP PP P Sbjct: 1065 PQESPPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPP 1124 Score = 35.9 bits (79), Expect = 0.043 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P PP P PP PP P P PP PP PP P P Sbjct: 1069 PPPLPPLPPSPPPPSPPLPPSSLPPPP-PAALFPPLPPPPSQPPPPPLSPPP 1119 Score = 32.7 bits (71), Expect = 0.40 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = +2 Query: 812 PXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P P PP P P PPP P PPP P PP P P Sbjct: 1058 PEDSPPLPQESPPPLPPLPPSP-PPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPP 1113 Score = 28.7 bits (61), Expect = 6.5 Identities = 17/65 (26%), Positives = 18/65 (27%) Frame = +3 Query: 807 PXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXPPXXXXXXXXPPXXXPXXPPXXXXX 986 P +PP PP P P PP PP P PP Sbjct: 1062 PPLPQESPPPLPPLPPSPPPPSPPLPPSSLPPP--PPAALFPPLPPPPSQPPPPPLSPPP 1119 Query: 987 RPPRP 1001 PP P Sbjct: 1120 SPPPP 1124 >At2g05440.2 68415.m00575 glycine-rich protein Length = 154 Score = 39.5 bits (88), Expect = 0.003 Identities = 23/61 (37%), Positives = 23/61 (37%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G GG GG GGG G G GGG GG G GG G G G Sbjct: 78 GGGHYGGGGGHYGG---GGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGG 134 Query: 801 G 799 G Sbjct: 135 G 135 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G GG G GGG G G GGG GG GG G G G Sbjct: 68 GGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGG 127 Query: 801 G 799 G Sbjct: 128 G 128 Score = 33.9 bits (74), Expect = 0.17 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G GG GGG G G GGG GG G G G G G Sbjct: 60 GHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGG 119 Query: 801 G 799 G Sbjct: 120 G 120 Score = 33.9 bits (74), Expect = 0.17 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G G GG GGG G G GGG GG GG G GG Sbjct: 87 GHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGGGG 141 Score = 31.5 bits (68), Expect = 0.92 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G G G GGG G G GGG GG GG G GG Sbjct: 67 GGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGG 121 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXG 856 G G GG GGG G G GGG GG G Sbjct: 108 GHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGGGGHG 143 Score = 28.7 bits (61), Expect = 6.5 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G GG GGG G G GGG GG G G G G Sbjct: 94 GHYGGGGGHYGGGGGHYGGGGGGHGGGGHY-GGGGGGYGGGGGHHGGGGHG 143 >At4g38770.1 68417.m05490 proline-rich family protein (PRP4) similar to proline-rich protein [Arabidopsis thaliana] gi|6782442|gb|AAF28388; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 448 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P PP P P PP P P PPP P PP P Sbjct: 223 PPPVPVYKPPPKVELPPPIPKKPCPPKPPKIEHPPPVPVYKPPPKIEKP--PPVPVYKPP 280 Query: 980 P 982 P Sbjct: 281 P 281 Score = 36.7 bits (81), Expect = 0.024 Identities = 20/64 (31%), Positives = 20/64 (31%), Gaps = 3/64 (4%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPX---PPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXX 970 PP P P PP P PP PPP P P PP PP P Sbjct: 193 PPPVPVYEPPPKKEIPPPVPVYDPPPKKEVPPPVPVYKPPPKVELPPPIPKKPCPPKPPK 252 Query: 971 XXXP 982 P Sbjct: 253 IEHP 256 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P HP P PP PPP P P PP P P Sbjct: 247 PPKPPKIEHPPPVPVYKP---PPKIEKPPPVPVYKPPPKIEHPPPVPVHKLPKKP 298 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P P PP PPP P PP P PP P Sbjct: 279 PPPKIEHPPPVPVHKLPKKPCPPKKVDPPPVPVHKPPTKKPCPPKKVDP--PPVPVHKPP 336 Query: 980 P 982 P Sbjct: 337 P 337 Score = 30.3 bits (65), Expect = 2.1 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P P P PP P P PPP P PP P Sbjct: 238 PPPIPKKPCPPKPPKIEHPPPVPVYKPPPKIEKPPPVPVYKPPPKIEHP--PPVP 290 Score = 29.1 bits (62), Expect = 4.9 Identities = 16/52 (30%), Positives = 16/52 (30%), Gaps = 4/52 (7%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPX----PPXXXXPPPXXXXXPXPXXXPPPXXXPP 946 P P P P P PP PPP P P PP PP Sbjct: 319 PCPPKKVDPPPVPVHKPPPKIVIPPPKIEHPPPVPVYKPPPKIEHPPIYIPP 370 Score = 28.3 bits (60), Expect = 8.6 Identities = 18/60 (30%), Positives = 18/60 (30%), Gaps = 3/60 (5%) Frame = +2 Query: 812 PXXXHPXXXXXXPPXPXPPXXXX---PPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P P PP PP PP P P PPP P PP P P Sbjct: 176 PFLKKPCPPKYSPPVEVPPPVPVYEPPPKKEIPPPVPVYDPPPKKEVP--PPVPVYKPPP 233 Score = 28.3 bits (60), Expect = 8.6 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 1/62 (1%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXP-XXXPPPXXXPPXXPPXPXXXX 976 PP P P P PP PPP P P PPP P PP P Sbjct: 306 PPPVPVHKPP------TKKPCPPKKVDPPPVPVHKPPPKIVIPPPKIEHP--PPVPVYKP 357 Query: 977 XP 982 P Sbjct: 358 PP 359 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 39.1 bits (87), Expect = 0.005 Identities = 23/89 (25%), Positives = 26/89 (29%) Frame = +3 Query: 735 PLXHPPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXP 914 P+ PPPP + P P P PP PP P P P Sbjct: 738 PVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 797 Query: 915 PXXXXXXXXPPXXXPXXPPXXXXXRPPRP 1001 P PP PP PP+P Sbjct: 798 P----VHSPPPPSPIYSPPPPVFSPPPKP 822 Score = 38.7 bits (86), Expect = 0.006 Identities = 22/64 (34%), Positives = 22/64 (34%), Gaps = 3/64 (4%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPX---PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXX 970 PP P P PP P PP PPP P P PPP P PP P Sbjct: 648 PPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPP---PVHSPPPPVH 704 Query: 971 XXXP 982 P Sbjct: 705 SPPP 708 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 3/55 (5%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPX---PPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 P P P PP P PP PPP P P PPP P PP Sbjct: 684 PPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPP 738 Score = 37.5 bits (83), Expect = 0.014 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P P P PP PPP P P PPP P PP P Sbjct: 734 PPPPPVFSPPPPAPIYSPPP-PPVHSPPPPVHSPPPPPVHSPPP---PVHSPPPPVHSPP 789 Query: 980 P 982 P Sbjct: 790 P 790 Score = 36.3 bits (80), Expect = 0.032 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 3/63 (4%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPX---PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXX 973 P P P PP P PP PPP P P PPP P PP P Sbjct: 699 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPP-PAPIYSPPPPPVH 757 Query: 974 XXP 982 P Sbjct: 758 SPP 760 Score = 36.3 bits (80), Expect = 0.032 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 3/63 (4%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPX---PPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXX 973 P P P PP P PP PPP P P PPP P PP P Sbjct: 759 PPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPS-PIYSPPPPVFS 817 Query: 974 XXP 982 P Sbjct: 818 PPP 820 Score = 35.9 bits (79), Expect = 0.043 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 3/63 (4%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPX---PPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXX 973 P P P PP P PP PPP P P PPP P PP P Sbjct: 677 PPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP---PVHSPPPPVQS 733 Query: 974 XXP 982 P Sbjct: 734 PPP 736 Score = 35.5 bits (78), Expect = 0.057 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 3/64 (4%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPX---PPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXX 970 PP P P PP P PP PPP P P PPP PP P Sbjct: 692 PP--PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIY 749 Query: 971 XXXP 982 P Sbjct: 750 SPPP 753 Score = 35.1 bits (77), Expect = 0.075 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 3/47 (6%) Frame = +2 Query: 827 PXXXXXXPPXPX---PPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 P PP P PP PPP P P PPP P PP Sbjct: 642 PPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPP 688 Score = 35.1 bits (77), Expect = 0.075 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P P P PP P P PPP P P PPP PP P P P Sbjct: 727 PPPPVQSPPPPPVFSPPPPAP-IYSPPPPPVHSPPPPVHSPPP---PPVHSPPPPVHSPP 782 Score = 34.7 bits (76), Expect = 0.099 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 P P P P PP PPP P P PPP PP P P Sbjct: 643 PVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPP---PPVHSPPPPVHSP 699 Query: 980 P 982 P Sbjct: 700 P 700 Score = 34.3 bits (75), Expect = 0.13 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 6/60 (10%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPX---PPXXXXPPPXXXXXPXP---XXXPPPXXXPPXXPPXP 964 P P P PP P PP PPP P P PPP PP P P Sbjct: 766 PPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPPPKPVTP 825 Score = 32.7 bits (71), Expect = 0.40 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 1/62 (1%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXX-XPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXX 976 PP P PP PP PPP P P PPP P PP P Sbjct: 671 PPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP---PVHSPPPPVHSP 727 Query: 977 XP 982 P Sbjct: 728 PP 729 Score = 31.9 bits (69), Expect = 0.70 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 3/64 (4%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPX---PPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXX 970 PP P P PP P PP PPP P P PP PP P P Sbjct: 656 PP--PPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPP---PPVHSPPPPV 710 Query: 971 XXXP 982 P Sbjct: 711 HSPP 714 Score = 31.9 bits (69), Expect = 0.70 Identities = 21/87 (24%), Positives = 22/87 (25%) Frame = +3 Query: 735 PLXHPPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXP 914 P+ PPPP P P PP PP P P P Sbjct: 688 PVHSPPPPVHSPPPPVHS----PPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPP 743 Query: 915 PXXXXXXXXPPXXXPXXPPXXXXXRPP 995 P PP PP PP Sbjct: 744 PPAPIYSPPPPPVHSPPPPVHSPPPPP 770 Score = 31.9 bits (69), Expect = 0.70 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 6/58 (10%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPX----PXPPXXXXPPPXXXXXPXPX--XXPPPXXXPPXXPP 958 P P P PP P PP PPP P P PPP P PP Sbjct: 713 PPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPP 770 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/51 (29%), Positives = 15/51 (29%) Frame = +2 Query: 812 PXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P H P P P PPP P P PP P P P Sbjct: 789 PPPVHSPPPPVHSPPPPSPIYSPPPPVFSPPPKPVTPLPPATSPMANAPTP 839 Score = 30.3 bits (65), Expect = 2.1 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 4/65 (6%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPX---PPXX-XXPPPXXXXXPXPXXXPPPXXXPPXXPPXPX 967 PP P P PP P PP PPP P P PPP P PP P Sbjct: 663 PP--PPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPP---PVHSPPPPV 717 Query: 968 XXXXP 982 P Sbjct: 718 HSPPP 722 Score = 30.3 bits (65), Expect = 2.1 Identities = 21/89 (23%), Positives = 22/89 (24%) Frame = +3 Query: 735 PLXHPPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXP 914 P+ PPPP P P PP PP P P Sbjct: 730 PVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPP 789 Query: 915 PXXXXXXXXPPXXXPXXPPXXXXXRPPRP 1001 P PP PP PP P Sbjct: 790 P----PVHSPPPPVHSPPPPSPIYSPPPP 814 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 PP PP PPP P P PPP P PP P P Sbjct: 642 PPVHSPP----PPPPVHSPPPPVFSPPP---PMHSPPPPVYSPPP 679 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 1/62 (1%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPP-PXXXXXPXPXXXPPPXXXPPXXPPXPXXXX 976 PP P P PP P P PP P P PPP PP P P Sbjct: 105 PPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPC 164 Query: 977 XP 982 P Sbjct: 165 PP 166 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 3/58 (5%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPX---PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P PP P PP PPP P PPP PP PP P Sbjct: 123 PPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPP--PPKP 178 Score = 37.5 bits (83), Expect = 0.014 Identities = 20/64 (31%), Positives = 20/64 (31%), Gaps = 4/64 (6%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPX----PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXX 970 P P P PP P PP PPP P P PP P PP P Sbjct: 76 PPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTP 135 Query: 971 XXXP 982 P Sbjct: 136 YTPP 139 Score = 37.1 bits (82), Expect = 0.019 Identities = 20/64 (31%), Positives = 20/64 (31%), Gaps = 3/64 (4%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXP---XXXPPPXXXPPXXPPXPXX 970 PP P P P PP PPP P P PPP P PP P Sbjct: 70 PPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYT 129 Query: 971 XXXP 982 P Sbjct: 130 PPPP 133 Score = 35.9 bits (79), Expect = 0.043 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPP-PXXXXXPXPXXXPPPXXXPPXXP 955 PP P P PP P PP P P P PPP PP P Sbjct: 97 PPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPP 149 Score = 35.1 bits (77), Expect = 0.075 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPX--PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXP 955 PP P P PP P PP PPP P P PP PP P Sbjct: 41 PPKHPAKP-PKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPP 93 Score = 35.1 bits (77), Expect = 0.075 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P P P PP PPP P P PP P P P Sbjct: 113 PPPPPTVKPPPPPT--PYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPT 170 Query: 980 P 982 P Sbjct: 171 P 171 Score = 34.7 bits (76), Expect = 0.099 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 PP P P PP P P PPP P P PP P PP Sbjct: 89 PPPPPYVKPPPPPTVKPPPP-PYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPP 140 Score = 33.9 bits (74), Expect = 0.17 Identities = 22/91 (24%), Positives = 23/91 (25%), Gaps = 4/91 (4%) Frame = +3 Query: 735 PLXHPPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPP----XXXXPXXXXXPXXXXX 902 P PPPP + P P P PP PP P P Sbjct: 85 PTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVK 144 Query: 903 XXXPPXXXXXXXXPPXXXPXXPPXXXXXRPP 995 PP P P PP PP Sbjct: 145 PPPPPVVTPPPPTPTPEAPCPPPPPTPYPPP 175 Score = 33.5 bits (73), Expect = 0.23 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 2/62 (3%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPX--PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXX 976 P P P PP P PP PPP P P PPP PP P P Sbjct: 48 PPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKP-PTVKPPP---PPYVKPPPPPTV 103 Query: 977 XP 982 P Sbjct: 104 KP 105 Score = 33.5 bits (73), Expect = 0.23 Identities = 19/68 (27%), Positives = 19/68 (27%), Gaps = 1/68 (1%) Frame = +3 Query: 801 PXPXXXPXTPPXXXXXPPXXXXPXXXXX-PXXXXXXXXPPXXXXXXXXPPXXXPXXPPXX 977 P P P PP PP P P PP PP P PP Sbjct: 68 PPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTP 127 Query: 978 XXXRPPRP 1001 PP P Sbjct: 128 YTPPPPTP 135 Score = 31.5 bits (68), Expect = 0.92 Identities = 17/67 (25%), Positives = 17/67 (25%) Frame = +3 Query: 801 PXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXPPXXXXXXXXPPXXXPXXPPXXX 980 P P PP PP P PP PP P PP Sbjct: 61 PKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVK 120 Query: 981 XXRPPRP 1001 PP P Sbjct: 121 PPPPPTP 127 Score = 31.5 bits (68), Expect = 0.92 Identities = 23/87 (26%), Positives = 24/87 (27%), Gaps = 2/87 (2%) Frame = +3 Query: 747 PPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPP--XXXXPXXXXXPXXXXXXXXPPX 920 PPPP + P P P PP PP P P PP Sbjct: 76 PPPPY---TPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPP 132 Query: 921 XXXXXXXPPXXXPXXPPXXXXXRPPRP 1001 PP P PP PP P Sbjct: 133 PTPYTPPPPTVKPPPPPVVTPP-PPTP 158 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/52 (28%), Positives = 15/52 (28%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXP 955 PP P P PP P P P P P PP P P Sbjct: 131 PPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPPKPETCP 182 Score = 29.1 bits (62), Expect = 4.9 Identities = 23/87 (26%), Positives = 23/87 (26%) Frame = +3 Query: 735 PLXHPPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXP 914 P HP P A P P P PP PP P P P Sbjct: 34 PSPHPVKPPKHPAKPPKPPTVKP-PTHTPK-PPTVKPPPPYIPCPPPPYTP-KPPTVKPP 90 Query: 915 PXXXXXXXXPPXXXPXXPPXXXXXRPP 995 P PP P PP PP Sbjct: 91 PPPYVKPPPPPTVKPPPPPYVKPPPPP 117 Score = 29.1 bits (62), Expect = 4.9 Identities = 16/55 (29%), Positives = 16/55 (29%), Gaps = 2/55 (3%) Frame = +2 Query: 824 HPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPP--PXXXPPXXPPXPXXXXXP 982 HP P P P PP P PP P PP P P P Sbjct: 37 HPVKPPKHPAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPP 91 Score = 28.7 bits (61), Expect = 6.5 Identities = 23/89 (25%), Positives = 25/89 (28%) Frame = +3 Query: 735 PLXHPPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXP 914 P PPPP + P P P TPP P P P P Sbjct: 101 PTVKPPPPPYVKPPPPPTVKPPPPPT--PYTPP---PPTPYTPPPPTVKPPPPPVVTPPP 155 Query: 915 PXXXXXXXXPPXXXPXXPPXXXXXRPPRP 1001 P PP PP PP+P Sbjct: 156 PTPTPEAPCPPPPPTPYPP------PPKP 178 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 37.5 bits (83), Expect = 0.014 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 PP PP PPP P P PPP P PP Sbjct: 254 PPLKLPPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPP 290 Score = 34.7 bits (76), Expect = 0.099 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +2 Query: 857 PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P PP PPP P P PPP PP P P Sbjct: 265 PPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPPKGAAP 306 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +2 Query: 812 PXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 P P PP P PPP P P PP PP PP Sbjct: 254 PPLKLPPGRSAPPPPPAAAPPPQPPPPPPPKPQP-PPPPKIARPPPAPP 301 Score = 29.1 bits (62), Expect = 4.9 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 P PP P PP PPP P P PP P P Sbjct: 267 PPPAAAPPPQPPPP----PPPKPQPPPPPKIARPPPAPPKGAAP 306 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 37.5 bits (83), Expect = 0.014 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 824 HPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 HP PP P PP P P P PP PP PP Sbjct: 91 HPKPPTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPP 135 Score = 35.5 bits (78), Expect = 0.057 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXP-PXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 PP P P PP P P PPP P P PP P PP Sbjct: 130 PPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPP 183 Score = 35.1 bits (77), Expect = 0.075 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P HP PP PP PP P P PP PP P P Sbjct: 104 PPTKPHP-HPKPPIVKPPTKPPPSTPKPPTK----PPPSTPKPPTTKPPPSTPKPPHHKP 158 Query: 980 P 982 P Sbjct: 159 P 159 Score = 34.7 bits (76), Expect = 0.099 Identities = 19/63 (30%), Positives = 19/63 (30%), Gaps = 2/63 (3%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPP--XXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXX 973 PP P P PP P PP PP P P P P PP P Sbjct: 46 PPKPPAVKPPKPPAVKPPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPPHPKPP 105 Query: 974 XXP 982 P Sbjct: 106 TKP 108 Score = 34.7 bits (76), Expect = 0.099 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 1/62 (1%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXP-PXPXXXX 976 PP P P PP P PPP P PPP PP P P P Sbjct: 119 PPTKPPPSTPKPPTKPPPSTPKPPTTKPPP--STPKPPHHKPPPTPCPPPTPTPTPPVVT 176 Query: 977 XP 982 P Sbjct: 177 PP 178 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P PP P PP P P P PP P PP P P Sbjct: 200 PTPPVITPPTPTPPVITPPTPTPPVVTPPTPTPPVVTPPTPTPPTPIPETCP 251 Score = 33.9 bits (74), Expect = 0.17 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 P P P PP P PP P P P PP P PP Sbjct: 162 PCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVITPPTPTPP 213 Score = 33.1 bits (72), Expect = 0.30 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Frame = +2 Query: 824 HPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPP-XXXPPXXPPXPXXXXXP 982 HP P P PP P P P PPP PP P P P Sbjct: 101 HPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPP 154 Score = 31.9 bits (69), Expect = 0.70 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 3/58 (5%) Frame = +2 Query: 800 PPXXPXXXH--PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPP-XXPPXP 964 PP P H P PP P P PP P P PP PP PP P Sbjct: 147 PPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPP----TPTPPVITPPTPTPPVVTPPTP 200 Score = 31.5 bits (68), Expect = 0.92 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 3/47 (6%) Frame = +2 Query: 851 PXPXPPXXXXPPPXXXXXPXPXXXPP---PXXXPPXXPPXPXXXXXP 982 P P PP P P P P PP P PP P P P Sbjct: 90 PHPKPPTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPP 136 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 P PP P PP P P P PP P PP Sbjct: 180 PTPPVITPPTPTPPVVTPPTPTPPVITPPTPTPPVITPPTPTPP 223 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 P PP P PP P P P PP P PP Sbjct: 190 PTPPVVTPPTPTPPVITPPTPTPPVITPPTPTPPVVTPPTPTPP 233 Score = 28.7 bits (61), Expect = 6.5 Identities = 20/90 (22%), Positives = 21/90 (23%), Gaps = 4/90 (4%) Frame = +3 Query: 744 HPPPPXXXXAXXXXXXRXXPXPXXX----PXTPPXXXXXPPXXXXPXXXXXPXXXXXXXX 911 HP PP + P P P PP PP P P Sbjct: 91 HPKPPTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPST 150 Query: 912 PPXXXXXXXXPPXXXPXXPPXXXXXRPPRP 1001 P P P P PP P Sbjct: 151 PKPPHHKPPPTPCPPPTPTPTPPVVTPPTP 180 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 37.5 bits (83), Expect = 0.014 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 PP P P P P PPP P P PPP P PP Sbjct: 51 PPSPDTQTSPPPATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPSPPQPQPPP 103 Score = 35.1 bits (77), Expect = 0.075 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +2 Query: 812 PXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P PP PP P P PPP PP PP P Sbjct: 49 PSPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPSPPQP 99 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 PP P P PP P PP PP P P P Sbjct: 48 PPSPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTPPSSPPPSITP 92 Score = 28.3 bits (60), Expect = 8.6 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXX-PPPXXXPPXXPP 958 PP P P P PP PPP P P PPP P P Sbjct: 61 PPATAAQPPPNQPPNTTPPPTPPSS--PPPSITPPPSPPQPQPPPQSTPTGDSP 112 Score = 28.3 bits (60), Expect = 8.6 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 4/53 (7%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXX-PPXPXPPXXXXPP---PXXXXXPXPXXXPPPXXXPP 946 PP P P PP P PP P P P P PP PP Sbjct: 79 PPTPPSSPPPSITPPPSPPQPQPPPQSTPTGDSPVVIPFPKPQLPPPSLFPPP 131 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 2/57 (3%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPP--XPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP HP PP P P PP P P PPP P PP P Sbjct: 35 PPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPPPHVLPPPPPTP 91 Score = 35.1 bits (77), Expect = 0.075 Identities = 19/62 (30%), Positives = 19/62 (30%), Gaps = 2/62 (3%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPP--PXXXXXPXPXXXPPPXXXPPXXPPXPXXXX 976 P P P PP PP PP P P P PP P PP P Sbjct: 25 PPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPPPHVL 84 Query: 977 XP 982 P Sbjct: 85 PP 86 Score = 33.5 bits (73), Expect = 0.23 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 851 PXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 P P PP PPP P PPP PP PP Sbjct: 23 PVPPPPSHISPPPPPFSPPH--HPPPPHFSPPHQPP 56 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 37.1 bits (82), Expect = 0.019 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +2 Query: 848 PPXPXPPXXXX--PPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P PP PPP P P PPP P PP P Sbjct: 9 PPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPP 49 Score = 33.9 bits (74), Expect = 0.17 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPP 946 PP P P PP P PP P P P PPP PP Sbjct: 6 PPYPPLPQPPSQNSLAPPPP-PPSLPPPVPPPPPSHQPYSYPPPPPPPP 53 Score = 29.5 bits (63), Expect = 3.7 Identities = 17/59 (28%), Positives = 17/59 (28%), Gaps = 4/59 (6%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPP----PXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P PP P PP P P PPP PP P P Sbjct: 31 PPVPPPPPSHQPYSYPPPPPPPPHAYYQQGPHYPQFNQLQAPPPPPPPSAPPPLVPDPP 89 Score = 29.1 bits (62), Expect = 4.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 857 PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P PP PP P P PPP PP PP P Sbjct: 7 PYPPLP-QPPSQNSLAPPP---PPPSLPPPVPPPPP 38 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 36.7 bits (81), Expect = 0.024 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GG GG G GGG G G GG G G GG Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGG 140 Score = 28.3 bits (60), Expect = 8.6 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 5/58 (8%) Frame = -3 Query: 957 GGXXGGXXXGGG---XXXGXGXXXXXGGGXXXXGGXG--XGGXXXXXXGXXXXGXXGG 799 GG GG GGG G GGG GG G GG G G GG Sbjct: 111 GGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGRREGGGYGGGDGGSYGGGGGG 168 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 36.7 bits (81), Expect = 0.024 Identities = 24/77 (31%), Positives = 24/77 (31%), Gaps = 2/77 (2%) Frame = +2 Query: 770 GXPXXXXXXXPPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPX--PXXXPPPXXXP 943 G P PP P P P P PP PPP P P PPP P Sbjct: 43 GPPPPQPDPQPPTPPTF-QPAPPANDQPPP-PPQSTSPPPVATTPPALPPKPLPPPLSPP 100 Query: 944 PXXPPXPXXXXXPXXXA 994 PP P P A Sbjct: 101 QTTPPPPPAITPPPPPA 117 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 PP P PP P P PPP PP PP P P Sbjct: 89 PPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPP 133 Score = 34.7 bits (76), Expect = 0.099 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 PP P P P PP PPP P P PPP PP PP Sbjct: 85 PPALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITP-PLSPPPPAITPP--PP 134 Score = 33.5 bits (73), Expect = 0.23 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 PP P PPP P P PP PP P P P Sbjct: 95 PPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTP 139 Score = 32.3 bits (70), Expect = 0.53 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 851 PXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 P P PP PPP P PPP PP PP Sbjct: 262 PPPLPPQTLKPPPPQTTPP-----PPPAITPPLSPP 292 Score = 31.9 bits (69), Expect = 0.70 Identities = 21/89 (23%), Positives = 22/89 (24%) Frame = +3 Query: 735 PLXHPPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXP 914 P P PP P P +PP PP P P P Sbjct: 47 PQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALP-PKPLPPPLSPPQTTPP 105 Query: 915 PXXXXXXXXPPXXXPXXPPXXXXXRPPRP 1001 P PP P P PP P Sbjct: 106 PPPAITPPPPPAITPPLSPPPPAITPPPP 134 Score = 31.9 bits (69), Expect = 0.70 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 PP P PP PP PPP P P PP P PP Sbjct: 99 PPQTTPPPPPAITPPPPPAITPPLS--PPPPAITPPPPLATTPPALPPKPLPP 149 Score = 31.5 bits (68), Expect = 0.92 Identities = 15/51 (29%), Positives = 15/51 (29%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXP 955 P P P P PP PP P P PP PP P Sbjct: 112 PPPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPPPLSPPQTTPPPPP 162 Score = 30.7 bits (66), Expect = 1.6 Identities = 19/61 (31%), Positives = 19/61 (31%), Gaps = 6/61 (9%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPP----XXXXXPXPXXXPPP--XXXPPXXPPX 961 P P P P PP PPP P P PPP PP PP Sbjct: 86 PALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPK 145 Query: 962 P 964 P Sbjct: 146 P 146 Score = 30.3 bits (65), Expect = 2.1 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 4/57 (7%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPX---PPXXXXPP-PXXXXXPXPXXXPPPXXXPPXXPP 958 PP P PP P PP P P P PPP PP PP Sbjct: 115 PPAITPPLSPPPPAITPPPPLATTPPALPPKPLPPPLSPPQTTPPPPPAITPPLSPP 171 Score = 29.9 bits (64), Expect = 2.8 Identities = 21/72 (29%), Positives = 21/72 (29%), Gaps = 11/72 (15%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXP--------XPPXXXXPPPXXXXXP---XPXXXPPPXXXPP 946 P P P PP P PP PPP P P PPP P Sbjct: 96 PLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPPPLSPPQ 155 Query: 947 XXPPXPXXXXXP 982 PP P P Sbjct: 156 TTPPPPPAITPP 167 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 36.7 bits (81), Expect = 0.024 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +2 Query: 851 PXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P PP PPP P P PP P PP P Sbjct: 411 PPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPP 448 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P P P P PP PPP P PPP PP P Sbjct: 419 PLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSP--PPPPVHHSSPPPPSP 471 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 857 PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P PP PPP P P P PP P P Sbjct: 403 PSPPIVALPPPPPPSPPLPPPVYSPPPSPPVFSPPP 438 Score = 28.3 bits (60), Expect = 8.6 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 3/57 (5%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXP-PPXXXXXPXPX--XXPPPXXXPPXXPPXP 964 P P P PP P P P PP P P PPP PP P Sbjct: 403 PSPPIVALPPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPP 459 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 36.7 bits (81), Expect = 0.024 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P P P P P P P PPP PP P P Sbjct: 136 PPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSP 195 Query: 980 P 982 P Sbjct: 196 P 196 Score = 36.3 bits (80), Expect = 0.032 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXP-PXPXXXXXP 982 PP P PP PP P P PPP P P P P P Sbjct: 74 PPAPVPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPP 119 Score = 33.9 bits (74), Expect = 0.17 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P P P P P P P PPP P P P Sbjct: 95 PPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPP 154 Query: 980 P 982 P Sbjct: 155 P 155 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 2/57 (3%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPP--PXXXPPXXPPXP 964 PP P P P P P P P P P P P PP PP P Sbjct: 100 PPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPP 156 Score = 33.9 bits (74), Expect = 0.17 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P P P P P P P PPP P P P Sbjct: 113 PPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTD 172 Query: 980 P 982 P Sbjct: 173 P 173 Score = 33.1 bits (72), Expect = 0.30 Identities = 16/55 (29%), Positives = 16/55 (29%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P PP P P P P P PP PP P Sbjct: 84 PPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPP 138 Score = 32.7 bits (71), Expect = 0.40 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P PP PP P P P PPP P P P Sbjct: 79 PPVSPPPPTPSVPSPTPPVSPPPPT--PTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPP 136 Query: 980 P 982 P Sbjct: 137 P 137 Score = 32.7 bits (71), Expect = 0.40 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 P P P PP P P PP P P P P PP PP Sbjct: 202 PPTPSVPSPPDVTPTPPTPSVPS---PPDVTPTPPTPPSVPTPSGSPPYVPP 250 Score = 31.9 bits (69), Expect = 0.70 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P P P P P PP PPP P PP P PP P P Sbjct: 129 PTPPVSPPPPTPTPSVPSPTPP--VSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPP 186 Score = 31.9 bits (69), Expect = 0.70 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 1/56 (1%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPP-PXXXPPXXPPXP 964 PP P P P P P P P P P P PP PP P Sbjct: 131 PPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPP 186 Score = 31.9 bits (69), Expect = 0.70 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P PP P P PPP P P P PP P Sbjct: 154 PPPTPT---PSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTPPTPSVPSP 210 Query: 980 P 982 P Sbjct: 211 P 211 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P P P P P P P P P PP P P Sbjct: 149 PPVSPPPPTPTPSVPSPTPPVPTDP-MPSPPPPVSPPPPTPTPSVPSPPDVTPTPPTPSV 207 Query: 980 P 982 P Sbjct: 208 P 208 Score = 29.9 bits (64), Expect = 2.8 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 3/58 (5%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPX--PXPPXXXXP-PPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P PP P PP P PP P P P P P P Sbjct: 179 PPVSPPPPTPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPP 236 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 36.7 bits (81), Expect = 0.024 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXX--GXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGX 808 G G GG GG GGG G G GGG G G GG G G Sbjct: 75 GGSGGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGGGS 134 Query: 807 XGG 799 GG Sbjct: 135 GGG 137 Score = 32.3 bits (70), Expect = 0.53 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G GG GGG G G GGG GG G GG Sbjct: 5 GGSGSGGGGKGGGG--GGSGGGRGGGGGGGAKGGCGGGG 41 Score = 31.5 bits (68), Expect = 0.92 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GGG G G GG GG G GG G G GG Sbjct: 2 GGKGGSGSGGGGKGGGG-----GGSGGGRGGGGGGGAKGGCGGGGKSGGGGG 48 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGG 862 GG GG GGG G G GG GG Sbjct: 107 GGGGGGGKNGGGCGGGGGGKGGKSGGGSGGGG 138 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 36.7 bits (81), Expect = 0.024 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P P P P P PP P P P P P P P PP P P Sbjct: 22 PVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAP 81 Score = 35.5 bits (78), Expect = 0.057 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P P P PPP P P P P PP PP P Sbjct: 54 PPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPP-KPPAPTPKPV 112 Query: 980 P 982 P Sbjct: 113 P 113 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 P P P PP P P P P P P P PP PP Sbjct: 66 PACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPP 118 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/60 (28%), Positives = 17/60 (28%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P P P P P P PP P P P P P PP P P Sbjct: 87 PAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPPKPENKTIP 146 Score = 33.9 bits (74), Expect = 0.17 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P PP P P PPP P P PP P P P P Sbjct: 36 PKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKP 87 Score = 32.3 bits (70), Expect = 0.53 Identities = 18/62 (29%), Positives = 18/62 (29%), Gaps = 1/62 (1%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXP-PXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXX 976 PP P P P P P P P P P P P PP P P Sbjct: 34 PPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAP 93 Query: 977 XP 982 P Sbjct: 94 KP 95 Score = 32.3 bits (70), Expect = 0.53 Identities = 16/55 (29%), Positives = 16/55 (29%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P P P P PP P P P P PP P P P Sbjct: 60 PKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPP 114 Score = 31.5 bits (68), Expect = 0.92 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPP 946 PP P P P P PPP P P P P PP Sbjct: 90 PPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPP 138 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/60 (26%), Positives = 16/60 (26%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P P P P P P P P P PP P PP P P Sbjct: 32 PSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPP 91 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 3/55 (5%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPP--PXXXXXPXPXXXPPPXXXP-PXXPPXPXXXXXP 982 P PP P P PP P P P PPP P P P P P Sbjct: 83 PEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSP 137 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 2/57 (3%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXP-PXPXPPXXXXPPPXXXXXPXPXXXPPPXXXP-PXXPPXP 964 PP P P P P P P P P P P P P P P P P Sbjct: 81 PPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSP 137 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/61 (26%), Positives = 16/61 (26%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P P P P P P P P PP P P Sbjct: 25 PPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPE 84 Query: 980 P 982 P Sbjct: 85 P 85 Score = 30.3 bits (65), Expect = 2.1 Identities = 18/68 (26%), Positives = 18/68 (26%), Gaps = 1/68 (1%) Frame = +3 Query: 801 PXPXXXPXTPPXXXXXPPXXXXP-XXXXXPXXXXXXXXPPXXXXXXXXPPXXXPXXPPXX 977 P P P PP PP P P PP P P PP Sbjct: 26 PGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEP 85 Query: 978 XXXRPPRP 1001 PP P Sbjct: 86 KPAPPPAP 93 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/46 (32%), Positives = 15/46 (32%), Gaps = 1/46 (2%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXP-PXPXXXXXP 982 PP P P PP P P P PP P P P P Sbjct: 3 PPTPDPSPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSP 48 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P P P P P P P PP PP P P Sbjct: 72 PPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPV-PPHGPPPKPAPAPTPAPS 130 Query: 980 P 982 P Sbjct: 131 P 131 Score = 29.1 bits (62), Expect = 4.9 Identities = 17/62 (27%), Positives = 17/62 (27%), Gaps = 1/62 (1%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXP-PXXPPXPXXXX 976 PP P P P P P P P P P P P PP P Sbjct: 3 PPTPDPSPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKP 62 Query: 977 XP 982 P Sbjct: 63 VP 64 Score = 28.3 bits (60), Expect = 8.6 Identities = 21/91 (23%), Positives = 22/91 (24%), Gaps = 2/91 (2%) Frame = +3 Query: 735 PLXHPPP-PXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXX 911 P PPP P P P P PP PP P P Sbjct: 50 PCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTP 109 Query: 912 PPXXXXXXXXPPXXXP-XXPPXXXXXRPPRP 1001 P P P P PP+P Sbjct: 110 KPVPPHGPPPKPAPAPTPAPSPKPAPSPPKP 140 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 36.3 bits (80), Expect = 0.032 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P P PP PP P P P P PP P P Sbjct: 118 PPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPPVQAPSPISLPPAPAPAP 172 Score = 34.3 bits (75), Expect = 0.13 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 1/62 (1%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPP-XXXXXPXPXXXPPPXXXPPXXPPXPXXXX 976 PP P P PP PP PPP P P PP PP P P Sbjct: 100 PPQSPPASAPTVSP--PPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPPVQ 157 Query: 977 XP 982 P Sbjct: 158 AP 159 Score = 33.1 bits (72), Expect = 0.30 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P P P PP PP P P PP PP P P Sbjct: 93 PATPPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASP 146 Score = 31.9 bits (69), Expect = 0.70 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P PP PP PP P P PP P PP P Sbjct: 97 PPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPP-PAPASPPPAP 150 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/57 (29%), Positives = 17/57 (29%), Gaps = 2/57 (3%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPP--PXXXPPXXPPXP 964 P P P P PP PPP P PP P PP P P Sbjct: 105 PASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPPVQAPSP 161 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 4/55 (7%) Frame = +2 Query: 812 PXXXHPXXXXXXPPXPX--PPXXXXPPPXXXXXPXPXXXPPPXXXPP--XXPPXP 964 P P PP P PP PPP P PPP P PP P Sbjct: 114 PPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPPVQAPSPISLPPAP 168 Score = 28.7 bits (61), Expect = 6.5 Identities = 18/67 (26%), Positives = 18/67 (26%), Gaps = 6/67 (8%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXP------XPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPX 961 PP P P PP P P PP P PPP PP Sbjct: 66 PPASPVTPPPAVTPTSPPAPKVAPVISPATPPPQPPQSPPASAPTVSPPPVSPPPAPTSP 125 Query: 962 PXXXXXP 982 P P Sbjct: 126 PPTPASP 132 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 35.9 bits (79), Expect = 0.043 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 PP P PP P P PPP P PP PP PP Sbjct: 64 PPPQTPPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPPPPP 116 Score = 33.5 bits (73), Expect = 0.23 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 851 PXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 P P PP PPP P P P P PP PP Sbjct: 61 PLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPP--PP 94 Score = 31.9 bits (69), Expect = 0.70 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 4/65 (6%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPP----XXXPPXXPPXPX 967 P P P P P PP PPP P P PPP P PP P Sbjct: 52 PSPEPEDYLPLPPPPQTPPPPPPPQSLPPP--SPSPEPEHYPPPPYHHYITPSPPPPRPL 109 Query: 968 XXXXP 982 P Sbjct: 110 PPPPP 114 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 35.9 bits (79), Expect = 0.043 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G GG GG GGG G G GGG G G GG Sbjct: 75 GGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGG 113 Score = 35.5 bits (78), Expect = 0.057 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G GG GGG G G GGG GG G GG G G Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKG 115 Score = 32.3 bits (70), Expect = 0.53 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G GG GG GGG G G GGG G GG Sbjct: 73 GGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGG 111 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G GG GG GGG G GGG G G G Sbjct: 79 GGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKGKGREGRG 122 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G G GGG G G GGG G G GG Sbjct: 61 GSGSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGG 99 Score = 29.1 bits (62), Expect = 4.9 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -3 Query: 942 GXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GGG G G GGG G G GG G G G Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKGKG 117 Score = 28.7 bits (61), Expect = 6.5 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -3 Query: 930 GGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG G GGG GG G GG G G GG Sbjct: 60 GGSGSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGG 103 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 35.9 bits (79), Expect = 0.043 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 PP P PP PP PPP P P PPP PP Sbjct: 69 PPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPPPESTNSPPPP 121 Score = 35.1 bits (77), Expect = 0.075 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 P P P PP P P PPP P P PPP PP P Sbjct: 52 PSLPPAVFSPPPTVSSPPPP--PLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDS 109 Query: 980 P 982 P Sbjct: 110 P 110 Score = 34.7 bits (76), Expect = 0.099 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 851 PXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 P P PP PPP P PPP P PP Sbjct: 37 PPPSPPADSSPPPALPSLPPAVFSPPPTVSSPPPPP 72 Score = 32.3 bits (70), Expect = 0.53 Identities = 25/107 (23%), Positives = 27/107 (25%) Frame = +3 Query: 681 PXSPXXEGXXXQTX*NXXPLXHPPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXX 860 P SP + + P PPP P P TPP PP Sbjct: 38 PPSPPADSSPPPALPSLPPAVFSPPPTVSSPPPPPLDSSPPPPPDL--TPPPSSPPPPDA 95 Query: 861 XXPXXXXXPXXXXXXXXPPXXXXXXXXPPXXXPXXPPXXXXXRPPRP 1001 P P PP P P PP PP P Sbjct: 96 PPPIPIVFPPPIDSP--PPESTNSPPPPEVFEPPPPPADEDESPPAP 140 Score = 31.9 bits (69), Expect = 0.70 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 PP P P P P P PPP P PPP PP Sbjct: 77 PPPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPPPESTNSPPPPEVFEPPPP 129 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/53 (30%), Positives = 16/53 (30%), Gaps = 4/53 (7%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPX----PXPPXXXXPPPXXXXXPXPXXXPPPXXXPP 946 PP P P P P P PPP P PPP PP Sbjct: 96 PPPIPIVFPPPIDSPPPESTNSPPPPEVFEPPPPPADEDESPPAPPPPEQLPP 148 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 35.9 bits (79), Expect = 0.043 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P PP PP P PP PP PP P Sbjct: 52 PPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPP 90 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 3/49 (6%) Frame = +2 Query: 827 PXXXXXXPPXPXPP---XXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P PP P PP PPP P PP PP PP P Sbjct: 43 PCLQNQPPPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPPP 91 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Frame = +2 Query: 863 PPXXXXPPPXXXXXPXPXXXPPP--XXXPPXXPPXPXXXXXP 982 PP PPP P P PPP PP P P P Sbjct: 50 PPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPPP 91 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXP 943 PP P P PP P PP PP P P PPP P Sbjct: 49 PPPPPSPPPPSCTPSPPP-PSPP----PPKKSSCPPSPLPPPPPPPPP 91 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 35.5 bits (78), Expect = 0.057 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPP 946 PP P H PP P P P P P PPP PP Sbjct: 692 PPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPP 740 Score = 35.1 bits (77), Expect = 0.075 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P PP P P P P P PPP PP PP P Sbjct: 691 PPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPP---PPPAPPTP 742 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P PP P PP PPP P PP P P Sbjct: 711 PPAPPAPPTPIVHTSSPPPPPPP----PPPPAPPTPQSNGISAMKSSPPAPPAPP 761 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 35.5 bits (78), Expect = 0.057 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXP 943 PP P PP P PP PPP P PPP P Sbjct: 75 PPPPPPVTDMIKPLSSPPPPQPPPRSQPPPKPPQKNLPRRHPPPPRSP 122 Score = 35.1 bits (77), Expect = 0.075 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 8/63 (12%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXX--------PPPXXXXXPXPXXXPPPXXXPPXXP 955 PP P P PP P PP PPP P PPP PP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPRSQ 101 Query: 956 PXP 964 P P Sbjct: 102 PPP 104 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPP 931 PP P P PP P PP PPP PPP Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPP 78 Score = 32.3 bits (70), Expect = 0.53 Identities = 19/67 (28%), Positives = 20/67 (29%), Gaps = 6/67 (8%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXP------PXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPX 961 PP P + PP P P P PPP P PP P PP Sbjct: 59 PPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPRSQPPPKPPQKNLPRRHPPP 118 Query: 962 PXXXXXP 982 P P Sbjct: 119 PRSPEKP 125 Score = 31.9 bits (69), Expect = 0.70 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 884 PPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P PPP PP PP P Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPP 61 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 881 PPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P PPP PP PP P Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPP 62 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 863 PPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP PP P P PPP PP PP P Sbjct: 35 PPLFPQSPPP----PPPPPPPPPPPPPPPPPPPP 64 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 P PP P PP PPP P P P PP Sbjct: 36 PLFPQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPP 79 >At5g59170.1 68418.m07416 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 288 Score = 35.1 bits (77), Expect = 0.075 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P PP PPP P PPP PP P P Sbjct: 53 PPKP-PPIEKYPPPVQYPPPIKKYPPPPYEHPPVKYPPP 90 Score = 33.1 bits (72), Expect = 0.30 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP HP P PP PPP P PP PP P Sbjct: 88 PPPIKTYPHPPVKYPPPEQYPPPIKKYPPPEQYPPPIKKYPPPEQYSPPFKKYPPPEQYP 147 Query: 980 P 982 P Sbjct: 148 P 148 Score = 32.3 bits (70), Expect = 0.53 Identities = 17/58 (29%), Positives = 18/58 (31%), Gaps = 1/58 (1%) Frame = +2 Query: 812 PXXXHPXXXXXXPPXPXP-PXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P +P PP P P PPP P PPP PP P P Sbjct: 64 PPVQYPPPIKKYPPPPYEHPPVKYPPPIKTYPHPPVKYPPPEQYPPPIKKYPPPEQYP 121 Score = 31.5 bits (68), Expect = 0.92 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 1/56 (1%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPX-PPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P +P PP PP PPP P PPP PP P Sbjct: 173 PP--PIKKYPPPEKYPPPIKKYPPPEQYPPPIKKYPPPIKKYPPPEEYPPPIKTYP 226 Score = 31.5 bits (68), Expect = 0.92 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXP 955 PP P P PP PP PP P P PPP P P Sbjct: 180 PP--PEKYPPPIKKYPPPEQYPPPIKKYPPPIKKYPPPEEYPPPIKTYPHPP 229 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 5/66 (7%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPX---PXPPXXXXPPPXXXXXPXPXXXPPP--XXXPPXXPPXP 964 PP HP PP P PP PPP P PP PP P P Sbjct: 219 PPPIKTYPHPPVKYPPPPYKTYPHPPIKTYPPPKECPPPPEHYPWPPKKKYPPPVEYPSP 278 Query: 965 XXXXXP 982 P Sbjct: 279 PYKKYP 284 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P PP PP PP P PPP PP P Sbjct: 102 PP--PEQYPPPIKKYPPPEQYPPPIKKYPPPEQYSPPFKKYPPPEQYPPPIKKYPPPEHY 159 Query: 980 P 982 P Sbjct: 160 P 160 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P PP PP PP P PPP PP P Sbjct: 141 PP--PEQYPPPIKKYPPPEHYPPPIKKYPPQEQYPPPIKKYPPPEKYPPPIKKYPPPEQY 198 Query: 980 P 982 P Sbjct: 199 P 199 Score = 29.5 bits (63), Expect = 3.7 Identities = 21/64 (32%), Positives = 22/64 (34%), Gaps = 3/64 (4%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPX-PPXXXXPPPXXXXXPXPXXXPPP--XXXPPXXPPXPXX 970 PP P +P PP PP PPP P P PPP PP P P Sbjct: 147 PP--PIKKYPPPEHYPPPIKKYPPQEQYPPP-IKKYPPPEKYPPPIKKYPPPEQYPPPIK 203 Query: 971 XXXP 982 P Sbjct: 204 KYPP 207 Score = 29.1 bits (62), Expect = 4.9 Identities = 18/62 (29%), Positives = 19/62 (30%), Gaps = 1/62 (1%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPX-PPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXX 976 PP P +P PP PP PPP P PP PP P Sbjct: 160 PP--PIKKYPPQEQYPPPIKKYPPPEKYPPPIKKYPPPEQYPPPIKKYPPPIKKYPPPEE 217 Query: 977 XP 982 P Sbjct: 218 YP 219 Score = 28.3 bits (60), Expect = 8.6 Identities = 16/60 (26%), Positives = 16/60 (26%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P P P P PP PPP P PP PP P P Sbjct: 95 PHPPVKYPPPEQYPPPIKKYPPPEQYPPPIKKYPPPEQYSPPFKKYPPPEQYPPPIKKYP 154 Score = 28.3 bits (60), Expect = 8.6 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P PP PP PP P PP PP P Sbjct: 128 PP--PEQYSPPFKKYPPPEQYPPPIKKYPPPEHYPPPIKKYPPQEQYPPPIKKYPPPEKY 185 Query: 980 P 982 P Sbjct: 186 P 186 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 35.1 bits (77), Expect = 0.075 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 6/59 (10%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXP---PXPXPPXXXXPPPXXXXXPXPXXX---PPPXXXPPXXPP 958 PP P P P P PP PPP P P PPP PP PP Sbjct: 71 PPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPP 129 Score = 33.5 bits (73), Expect = 0.23 Identities = 22/77 (28%), Positives = 22/77 (28%), Gaps = 6/77 (7%) Frame = +2 Query: 770 GXPXXXXXXXPPXXPXXXHPXXXXXXPPX-----PXPPXXXXPPPXXXXXPX-PXXXPPP 931 G P PP P P PP P P PPP P P P P Sbjct: 84 GPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSP 143 Query: 932 XXXPPXXPPXPXXXXXP 982 PP P P P Sbjct: 144 PTNPPPPPESPPSLPAP 160 Score = 33.5 bits (73), Expect = 0.23 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P PP PP P P P P PP P P P Sbjct: 133 PPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPPKLVPPSHSPPRHLPSPPASEIP 192 Query: 980 P 982 P Sbjct: 193 P 193 Score = 32.7 bits (71), Expect = 0.40 Identities = 19/65 (29%), Positives = 19/65 (29%), Gaps = 4/65 (6%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPX----PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPX 967 PP P PP P PP PP P P PPP P P P Sbjct: 102 PPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPD 161 Query: 968 XXXXP 982 P Sbjct: 162 PPSNP 166 Score = 30.3 bits (65), Expect = 2.1 Identities = 28/127 (22%), Positives = 31/127 (24%), Gaps = 5/127 (3%) Frame = +3 Query: 633 PXPXPXXPXXXXXXXGPXSPXXEGXXXQTX*NXXPLXHPPPPXXXXAXXXXXXRXXPXPX 812 P P P P P + + P PPP + P P Sbjct: 71 PPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPT 130 Query: 813 XXPXT-----PPXXXXXPPXXXXPXXXXXPXXXXXXXXPPXXXXXXXXPPXXXPXXPPXX 977 P T P PP P P PP PP P PP Sbjct: 131 EAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPPKLVPPSHSPPRHLP-SPPAS 189 Query: 978 XXXRPPR 998 PPR Sbjct: 190 EIPPPPR 196 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 PP P P P PP PP P PPP PP P Sbjct: 128 PPTEAPPTTPITSPSPPTNP-PPPPESPPSLPAPDPPSNPLPPPKLVPPSHSP 179 Score = 29.5 bits (63), Expect = 3.7 Identities = 16/63 (25%), Positives = 16/63 (25%) Frame = +2 Query: 770 GXPXXXXXXXPPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPX 949 G P P P P P P PPP P PP P Sbjct: 48 GNPPETTNTPAQSSPPPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTE 107 Query: 950 XPP 958 PP Sbjct: 108 APP 110 Score = 29.5 bits (63), Expect = 3.7 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 4/43 (9%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXP-XXXPPPXXXPP---XXPPXP 964 P P PP PPP P P PP PP PP P Sbjct: 255 PSPPSPPEETLPPPKPSPDPLPSNSSSPPTLLPPSSVVSPPSP 297 Score = 29.1 bits (62), Expect = 4.9 Identities = 22/89 (24%), Positives = 24/89 (26%) Frame = +3 Query: 735 PLXHPPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXP 914 PL PPP + P P P +PP PP P P P Sbjct: 67 PLSSPPPEPSPPSPSLTG----PPPTTIPVSPPPEPSPPP----PLPTEAPPPANPVSSP 118 Query: 915 PXXXXXXXXPPXXXPXXPPXXXXXRPPRP 1001 P PP P P P P Sbjct: 119 PPESSPPPPPPTEAPPTTPITSPSPPTNP 147 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 1/38 (2%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXP-PPXXXPPXXPP 958 PP PP PP P P P PP P PP Sbjct: 174 PPSHSPPRHLPSPPASEIPPPPRHLPSPPASERPSTPP 211 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 34.7 bits (76), Expect = 0.099 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P P P PP PPP P PPP PP P Sbjct: 200 PPLPPLP--PTTGLTLPHSPFPPPPPGPPPKEQDFVRPPLPPPPQLPQSSQPPPP 252 Score = 31.5 bits (68), Expect = 0.92 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 4/51 (7%) Frame = +2 Query: 824 HPXXXXXXPPXPXPPXXXXPPPXXXXX----PXPXXXPPPXXXPPXXPPXP 964 HP P P PP PP P P PPP P PP P Sbjct: 347 HPPPGMLRFPPPPPPLDMHPPHPGMFVGHLIPRPPYGPPPGPPPMMRPPLP 397 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 34.7 bits (76), Expect = 0.099 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GG GGG G G G GG G GG G G GG Sbjct: 360 GMGGAGGGGYRGGG-GYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGGRGGYGGG 413 Score = 32.3 bits (70), Expect = 0.53 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G GG G GG G G GGG GG G G Sbjct: 373 GGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGGRGGYGGGGSG 416 Score = 31.9 bits (69), Expect = 0.70 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G G GG GGG G G GG GG G GG G G Sbjct: 297 GRYGGGGGGYNRGGYSMGGGGGYGGGPGDMYGGSYGEPGG-GYGGPSGSYGGGYGSSGIG 355 Query: 801 G 799 G Sbjct: 356 G 356 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G GG G GGG GGG GG G GG Sbjct: 365 GGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGGRGG 409 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 34.7 bits (76), Expect = 0.099 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = -3 Query: 963 GXGGXXGG-XXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G GG GG GGG G G GGG GG G GG Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGG 125 >At4g30460.1 68417.m04325 glycine-rich protein Length = 162 Score = 34.7 bits (76), Expect = 0.099 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G G G G G G GGG GG G GG G G GG Sbjct: 104 GSGSGGRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGG 155 Score = 31.1 bits (67), Expect = 1.2 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 1/62 (1%) Frame = -3 Query: 981 GXXXXXGXGGXXG-GXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXX 805 G G GG G G G G G G GGG GG G G G G Sbjct: 100 GSHAGSGSGGRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSG-NGEGYGEGGGYGGGYG 158 Query: 804 GG 799 GG Sbjct: 159 GG 160 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 34.7 bits (76), Expect = 0.099 Identities = 22/85 (25%), Positives = 22/85 (25%) Frame = +3 Query: 747 PPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXPPXXX 926 PPPP P P PP PP P PP Sbjct: 167 PPPPFGGQGPPMGRG---PPPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPP 223 Query: 927 XXXXXPPXXXPXXPPXXXXXRPPRP 1001 PP P PP PPRP Sbjct: 224 HGMQGPPPPRPGMPPAPGGFAPPRP 248 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 34.7 bits (76), Expect = 0.099 Identities = 22/85 (25%), Positives = 22/85 (25%) Frame = +3 Query: 747 PPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXPPXXX 926 PPPP P P PP PP P PP Sbjct: 167 PPPPFGGQGPPMGRG---PPPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPP 223 Query: 927 XXXXXPPXXXPXXPPXXXXXRPPRP 1001 PP P PP PPRP Sbjct: 224 HGMQGPPPPRPGMPPAPGGFAPPRP 248 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 34.7 bits (76), Expect = 0.099 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G GG GGG G G GGG GG G GG Sbjct: 122 GGGGGYSGGGGGYGGGGGGYGGGGGGYGGGGDGGGG 157 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 34.7 bits (76), Expect = 0.099 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +2 Query: 800 PPXXPXXXH-PXXXXXXPPXPXPPXXXXPPP--XXXXXPXPXXXPPPXXXPPXXPP 958 PP P H P PP PP P P P P P P PP PP Sbjct: 434 PPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPP 489 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPP--XXXXXPXPXXXPP-PXXXPPXXPP 958 PP P P PP PP P P P P PP P PP PP Sbjct: 182 PPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTPTYSPPVKPP 237 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPP--XXXXXPXPXXXPP-PXXXPPXXPP 958 PP P P PP PP P P P P PP P PP PP Sbjct: 334 PPIKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPP 389 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPP--XXXXXPXPXXXPP-PXXXPPXXPP 958 PP P P PP PP P P P P PP P PP PP Sbjct: 468 PPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPP 523 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPP--XXXXXPXPXXXPP-PXXXPPXXPP 958 PP P P PP PP P P P P PP P PP PP Sbjct: 518 PPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPP 573 Score = 33.5 bits (73), Expect = 0.23 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 4/57 (7%) Frame = +2 Query: 800 PPXXPXXXH-PXXXXXXPPXPXPPXXXXPPP--XXXXXPXPXXXPP-PXXXPPXXPP 958 PP P H P PP PP P P P P PP P PP PP Sbjct: 198 PPIKPPPVHKPPTPIYSPPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPP 254 Score = 33.5 bits (73), Expect = 0.23 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 4/57 (7%) Frame = +2 Query: 800 PPXXPXXXH-PXXXXXXPPXPXPPXXXXPPP--XXXXXPXPXXXPP-PXXXPPXXPP 958 PP P H P PP PP P P P P PP P PP PP Sbjct: 232 PPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKPP 288 Score = 33.5 bits (73), Expect = 0.23 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 4/57 (7%) Frame = +2 Query: 800 PPXXPXXXH-PXXXXXXPPXPXPPXXXXPPP--XXXXXPXPXXXPP-PXXXPPXXPP 958 PP P H P PP PP P P P P PP P PP PP Sbjct: 283 PPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPP 339 Score = 33.5 bits (73), Expect = 0.23 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 4/57 (7%) Frame = +2 Query: 800 PPXXPXXXH-PXXXXXXPPXPXPPXXXXPPP--XXXXXPXPXXXPP-PXXXPPXXPP 958 PP P H P PP PP P P P P PP P PP PP Sbjct: 350 PPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKPP 406 Score = 33.5 bits (73), Expect = 0.23 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 4/57 (7%) Frame = +2 Query: 800 PPXXPXXXH-PXXXXXXPPXPXPPXXXXPPP--XXXXXPXPXXXPP-PXXXPPXXPP 958 PP P H P PP PP P P P P PP P PP PP Sbjct: 534 PPIKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPP 590 Score = 33.5 bits (73), Expect = 0.23 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 4/57 (7%) Frame = +2 Query: 800 PPXXPXXXH-PXXXXXXPPXPXPPXXXXPPP--XXXXXPXPXXXPP-PXXXPPXXPP 958 PP P H P PP PP P P P P PP P PP PP Sbjct: 585 PPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPP 641 Score = 33.5 bits (73), Expect = 0.23 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 4/57 (7%) Frame = +2 Query: 800 PPXXPXXXH-PXXXXXXPPXPXPPXXXXPPP--XXXXXPXPXXXPP-PXXXPPXXPP 958 PP P H P PP PP P P P P PP P PP PP Sbjct: 602 PPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPP 658 Score = 33.5 bits (73), Expect = 0.23 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 4/57 (7%) Frame = +2 Query: 800 PPXXPXXXH-PXXXXXXPPXPXPPXXXXPPP--XXXXXPXPXXXPP-PXXXPPXXPP 958 PP P H P PP PP P P P P PP P PP PP Sbjct: 619 PPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPP 675 Score = 33.5 bits (73), Expect = 0.23 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 4/57 (7%) Frame = +2 Query: 800 PPXXPXXXH-PXXXXXXPPXPXPPXXXXPPP--XXXXXPXPXXXPP-PXXXPPXXPP 958 PP P H P PP PP P P P P PP P PP PP Sbjct: 636 PPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPP 692 Score = 31.9 bits (69), Expect = 0.70 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 9/64 (14%) Frame = +2 Query: 800 PPXXPXXXH-PXXXXXXPPXPXPPXXXXPPPXXXXX--PXPXXXPP------PXXXPPXX 952 PP P H P PP PP P P P P PP P PP Sbjct: 367 PPVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVK 426 Query: 953 PPXP 964 PP P Sbjct: 427 PPTP 430 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +2 Query: 800 PPXXPXXXH-PXXXXXXPPXPXPPXXXXPPP-XXXXXPXPXXXPP-PXXXPPXXPP 958 PP P H P PP PP P P P PP P PP PP Sbjct: 451 PPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPP 506 Score = 30.7 bits (66), Expect = 1.6 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 10/65 (15%) Frame = +2 Query: 800 PPXXPXXXH-PXXXXXXPPXPXPPXXXXP---------PPXXXXXPXPXXXPPPXXXPPX 949 PP P H P PP PP P PP P P PP P Sbjct: 215 PPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQ 274 Query: 950 XPPXP 964 PP P Sbjct: 275 TPPTP 279 Score = 30.7 bits (66), Expect = 1.6 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 10/65 (15%) Frame = +2 Query: 800 PPXXPXXXH-PXXXXXXPPXPXPPXXXXP---------PPXXXXXPXPXXXPPPXXXPPX 949 PP P H P PP PP P PP P P PP P Sbjct: 249 PPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQ 308 Query: 950 XPPXP 964 PP P Sbjct: 309 KPPTP 313 Score = 30.3 bits (65), Expect = 2.1 Identities = 20/67 (29%), Positives = 21/67 (31%), Gaps = 2/67 (2%) Frame = +2 Query: 770 GXPXXXXXXXPPXXPXXXHPXXXXXXPPXPXPPXXXXP--PPXXXXXPXPXXXPPPXXXP 943 G P PP +P PP PP P PP P P PP P Sbjct: 50 GAPPSYTTPPPPIYSPPIYP------PPIQKPPTYSPPIYPPPIQKPPTPTYSPPIYPPP 103 Query: 944 PXXPPXP 964 PP P Sbjct: 104 IQKPPTP 110 Score = 30.3 bits (65), Expect = 2.1 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 3/56 (5%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPP--XXXXXPXPXXXPP-PXXXPPXXPP 958 PP P PP PP P P P P PP P PP PP Sbjct: 418 PPIKLPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPP 473 Score = 30.3 bits (65), Expect = 2.1 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 10/65 (15%) Frame = +2 Query: 800 PPXXPXXXH-PXXXXXXPPXPXPPXXXXP---------PPXXXXXPXPXXXPPPXXXPPX 949 PP P H P PP PP P PP P P PP P Sbjct: 551 PPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVH 610 Query: 950 XPPXP 964 PP P Sbjct: 611 KPPTP 615 Score = 30.3 bits (65), Expect = 2.1 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 10/65 (15%) Frame = +2 Query: 800 PPXXPXXXH-PXXXXXXPPXPXPPXXXXP---------PPXXXXXPXPXXXPPPXXXPPX 949 PP P H P PP PP P PP P P PP P Sbjct: 568 PPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVH 627 Query: 950 XPPXP 964 PP P Sbjct: 628 KPPTP 632 Score = 30.3 bits (65), Expect = 2.1 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 4/57 (7%) Frame = +2 Query: 800 PPXXPXXXH-PXXXXXXPPXPXPPXXXXPPP--XXXXXPXPXXXPP-PXXXPPXXPP 958 PP P P PP PP P P P P PP P PP PP Sbjct: 670 PPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKPP 726 Score = 29.5 bits (63), Expect = 3.7 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 3/56 (5%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPP--XXXXXPXPXXXPP-PXXXPPXXPP 958 P P P PP PP P P P P PP P PP PP Sbjct: 81 PIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPP 136 Score = 29.5 bits (63), Expect = 3.7 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 3/56 (5%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPP--XXXXXPXPXXXPP-PXXXPPXXPP 958 P P P PP PP P P P P PP P PP PP Sbjct: 115 PIYPPPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPP 170 Score = 28.3 bits (60), Expect = 8.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 881 PPPXXXXXPXPXXXPPPXXXPPXXPP 958 PPP P PPP PP PP Sbjct: 45 PPPIYGAPPSYTTPPPPIYSPPIYPP 70 Score = 28.3 bits (60), Expect = 8.6 Identities = 17/55 (30%), Positives = 17/55 (30%), Gaps = 2/55 (3%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXX-PXPXXXPP-PXXXPPXXPP 958 P P P PP PP P P P PP P PP PP Sbjct: 502 PVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPP 556 Score = 28.3 bits (60), Expect = 8.6 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 PP P PPP P P PP P PP P P Sbjct: 697 PPTPTYSPPVKPPPVQV-PPTPTYSPPIKPPPVQVPPTPTTPSPP 740 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 34.3 bits (75), Expect = 0.13 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG GG GGG G G GGG GG G G G G GG Sbjct: 122 GGGFGGGGYGGG-GGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGG 173 Score = 33.5 bits (73), Expect = 0.23 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G G GG G G G G GG G G GG G G G Sbjct: 129 GYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGGSGAGGYG 188 Query: 801 G 799 G Sbjct: 189 G 189 Score = 33.1 bits (72), Expect = 0.30 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G GG G GGG G G GGG GG GG G G Sbjct: 127 GGGYGGGGGGYGGSGGYGGG-AGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGGSGAG 185 Query: 801 G 799 G Sbjct: 186 G 186 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 1/56 (1%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG-GXXXXXXGXXXXGXXGG 799 G G GG GGG G G GG GG G G G G G G Sbjct: 122 GGGFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAG 177 >At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin family protein contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 401 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/62 (30%), Positives = 19/62 (30%), Gaps = 2/62 (3%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPP--PXXXXXPXPXXXPPPXXXPPXXPPXPXXXX 976 P P P P P PP PP P P P P PP PP P Sbjct: 299 PPIPLIPTPPTLPTIPLLPTPPTPTLPPIPTIPTLPPLPVLPPVPIVNPPSLPPPPPSFP 358 Query: 977 XP 982 P Sbjct: 359 VP 360 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = +2 Query: 848 PPXPX-PPXXXXPPPXXXXXPXPXXXPPP-XXXPPXXPPXPXXXXXP 982 PP P PP P P P P P P PP PP P P Sbjct: 262 PPNPLNPPSIIPPNPLIPSIPTPTLPPNPLIPSPPSLPPIPLIPTPP 308 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P PP PPP P P PPP PP P Sbjct: 24 PPPPPPP----PPPMRRRAPLPPPPPPPMRRRAPLPPPP 58 Score = 28.3 bits (60), Expect = 8.6 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 6/61 (9%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXX------PPXXPPX 961 PP P P P P PP PPP P P PP PP PP Sbjct: 24 PPPPPPP--PPPMRRRAPLPPPP----PPPMRRRAPLPPPPPPAMRRRVLPRPPPPPPPL 77 Query: 962 P 964 P Sbjct: 78 P 78 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 812 PXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 P H P PP PPP P P PPP PP PP Sbjct: 49 PTIVHQSAIVVVVDEPPPPPPTSPPP---PSPPPPSPPPPSPPPPSPPP 94 Score = 33.1 bits (72), Expect = 0.30 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 851 PXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPP 946 P P PP PP P P PPP PP Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 881 PPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PPP P P PPP PP PP P Sbjct: 65 PPPPPTSPPPP--SPPPPSPPPPSPPPP 90 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +2 Query: 881 PPPXXXXXP-XPXXXPPPXXXPPXXPPXP 964 PPP P P PPP PP PP P Sbjct: 67 PPPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPP 931 P PP P PP PPP P P PPP Sbjct: 65 PPPPPTSPPPPSPPPPSPPPPS----PPPPSPPPP 95 >At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 633 Score = 34.3 bits (75), Expect = 0.13 Identities = 20/63 (31%), Positives = 20/63 (31%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGGXXXXXXX 778 GG GG G G GGG GG G GG G G GG Sbjct: 566 GGRFGGRDFRREGSFGSGRGGYGGGGGGYGGGGGYGGGGGYGGGGGYGGGYGGASSGGYG 625 Query: 777 GXP 769 G P Sbjct: 626 GEP 628 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G G GGG G G GGG GG G G Sbjct: 578 GSFGSGRGGYGGGGGGYGGGGGYGGGGGYGGGGGYGGG 615 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 34.3 bits (75), Expect = 0.13 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 2/63 (3%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXG--XGGXXXXXXGXXXXGX 808 G G GG GG GGG G G GGG GG G GG G G Sbjct: 107 GGGGYSGGGGSYGG---GGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGE 163 Query: 807 XGG 799 GG Sbjct: 164 GGG 166 Score = 32.3 bits (70), Expect = 0.53 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 GG GG GGG G GGG GG G G Sbjct: 97 GGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSG 133 Score = 31.5 bits (68), Expect = 0.92 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 4/59 (6%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGG----XGXGGXXXXXXGXXXXGXXGG 799 G GG G GGG G GGG GG G GG G G GG Sbjct: 88 GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGG 146 Score = 31.5 bits (68), Expect = 0.92 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 GG G GGG G G GGG GG GG G GG Sbjct: 98 GGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGG 150 Score = 28.7 bits (61), Expect = 6.5 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G GG GG GGG G GGG GG GG G G Sbjct: 121 GGGRREGGGGYSGG---GGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGG 174 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 33.9 bits (74), Expect = 0.17 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXP--XXXPPPXXXPPXXPP 958 PP P P P PP PPP P P PPP PP PP Sbjct: 23 PPLQTQPTTPSAPPPVTPPPSPP--QSPPPVVSSSPPPPVVSSPPPSSSPPPSPP 75 Score = 33.1 bits (72), Expect = 0.30 Identities = 16/55 (29%), Positives = 16/55 (29%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P P P P PPP P PP P P P Sbjct: 106 PPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKPSP 160 Score = 32.7 bits (71), Expect = 0.40 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 2/46 (4%) Frame = +2 Query: 851 PXPXPPXXXXPPPXXXXXPXPXXX--PPPXXXPPXXPPXPXXXXXP 982 P P PP PPP P P PP P PP P P Sbjct: 70 PPPSPPVITSPPPTVASSPPPPVVIASPPPSTPATTPPAPPQTVSP 115 Score = 31.9 bits (69), Expect = 0.70 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 1/53 (1%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPP-XXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 P P P PP PP PPP P P PPP PP Sbjct: 29 PTTPSAPPPVTPPPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPP 81 Score = 31.9 bits (69), Expect = 0.70 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P PP PP PPP P P P PP P Sbjct: 40 PPPSPPQSPPPVVSSSPP---PPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPPVVIAS 96 Query: 980 P 982 P Sbjct: 97 P 97 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/52 (28%), Positives = 15/52 (28%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXP 955 PP P P P P P PP P P P P P P Sbjct: 98 PPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPP 149 Score = 29.1 bits (62), Expect = 4.9 Identities = 16/55 (29%), Positives = 16/55 (29%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P PP PPP P P P PP P P Sbjct: 88 PPPPVVIASPPPSTPATTPPAPPQTVSPPPPPDASPSP-PAPTTTNPPPKPSPSP 141 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 33.9 bits (74), Expect = 0.17 Identities = 20/64 (31%), Positives = 20/64 (31%), Gaps = 3/64 (4%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXX-PXPXXXPPPXXX--PPXXPPXPXX 970 PP P PP P P PPP P PPP PP PP P Sbjct: 486 PPPPSSKMSPSVKAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYI 545 Query: 971 XXXP 982 P Sbjct: 546 YSSP 549 Score = 32.3 bits (70), Expect = 0.53 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 2/46 (4%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPX--PPXXXXPPPXXXXXPXPXXXPPP 931 PP P P PP P PP PPP P PPP Sbjct: 661 PPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPP 706 Score = 32.3 bits (70), Expect = 0.53 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPX--PPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 PP P +P PP P PP PPP P PP P PP Sbjct: 675 PPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYY-LPVTQSPPPPSPVYYPP 728 Score = 31.5 bits (68), Expect = 0.92 Identities = 17/55 (30%), Positives = 17/55 (30%), Gaps = 2/55 (3%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPP--XXXXXPXPXXXPPPXXXPPXXPP 958 PP P PP P P PPP P P PPP PP Sbjct: 513 PPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPP 567 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 4/48 (8%) Frame = +2 Query: 851 PXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPP----XXPPXPXXXXXP 982 P P PP P P P PPP PP PP P P Sbjct: 511 PSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPP 558 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPX---PPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 PP P +P PP P P PPP P PPP P PP Sbjct: 632 PPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPP--PVYYPP 685 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXP 955 PP P P P PP PPP P P PP P P Sbjct: 531 PPLSPPPPSPPPPYIYSSPP-PPSPSPPPPYIYSSPPPVVNCPPTTQSPPPP 581 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/55 (29%), Positives = 16/55 (29%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P P P PP P P PPP PP P Sbjct: 502 PPPPPPEYEPSPPP--PSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSP 554 Score = 28.7 bits (61), Expect = 6.5 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 6/58 (10%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPPPXXXXXPXPX---XXPPP-XXXPP--XXPPXPXXXXXP 982 P PP P PP PP P P PPP PP PP P P Sbjct: 530 PPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPPVVNCPPTTQSPPPPKYEQTP 587 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G G GGG G G GGG GG G GG Sbjct: 87 GGGSSGGRGGFGGGRGGGRGSGGGYGGGGGGYGGRGGGG 125 Score = 33.1 bits (72), Expect = 0.30 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -3 Query: 945 GGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 GG GGG G G GGG GG G GG Sbjct: 148 GGGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGG 180 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXG 856 G G GG GGG G G GGG GG G Sbjct: 148 GGGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGGGG 183 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 945 GGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 GG GGG G G GGG G G GG Sbjct: 149 GGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGG 181 Score = 29.1 bits (62), Expect = 4.9 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -3 Query: 945 GGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 GG GGG G G GGG GG G GG Sbjct: 147 GGGGYGGG-GGGYGGGGGYGGGGGGYGGGGRGG 178 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 33.5 bits (73), Expect = 0.23 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 4/59 (6%) Frame = -3 Query: 963 GXGGXXGG--XXXGGGXXXGXGXXXXXGGGXXXXGGXG--XGGXXXXXXGXXXXGXXGG 799 G GG GG GGG G G GGG GG G GG G G GG Sbjct: 91 GGGGHRGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGG 149 Score = 29.5 bits (63), Expect = 3.7 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGG--XGXGGXXXXXXGXXXXGXXG 802 G GG GGG G G GGG GG GG G G G Sbjct: 88 GSGGGGGHRGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGG 141 Score = 28.7 bits (61), Expect = 6.5 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G GG GG GGG G GGG GG GG G G Sbjct: 104 GGGRREGGGGYSGG---GGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGG 157 >At2g05380.1 68415.m00566 glycine-rich protein (GRP3S) identical to cDNA glycine-rich protein 3 short isoform (GRP3S) GI:4206766 Length = 116 Score = 33.5 bits (73), Expect = 0.23 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXG--XGGXXXXXXGXXXXGXXG 802 G G GG GGG G G GGG GG G GG G G G Sbjct: 43 GFGDNGGGRYQGGGGHGGHGGGGYQGGGGRYQGGGGRQGGGGSYCRHGCCYKGYHG 98 >At1g29380.1 68414.m03592 hypothetical protein Length = 228 Score = 33.5 bits (73), Expect = 0.23 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G GG GG GGG G GGG G G GG Sbjct: 97 GGDVGGGGGGYGGGTPGGGGGGGGDTGAGAGGGGYGGGGDTGAGG 141 >At1g27750.1 68414.m03391 ubiquitin system component Cue domain-containing protein very low similarity to ASC-1 complex subunit P100 [Homo sapiens] GI:12061187; contains Pfam profile PF02845: CUE domain Length = 1973 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXP 955 P PP P PP PPP P P PP PP P Sbjct: 862 PLQPQSQPPEP-PPEMMPPPPQALPPPLPHSHPPLVPPPPFSP 903 Score = 31.5 bits (68), Expect = 0.92 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 1/56 (1%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPP-PXXXPPXXPPXP 964 PP P H PP PPP P PP P PP PP P Sbjct: 847 PP--PPLGHSLPSVLQPPLQPQSQPPEPPPEMMPPPPQALPPPLPHSHPPLVPPPP 900 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 33.5 bits (73), Expect = 0.23 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 2/57 (3%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPX--PPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P PP P PP PPP P P PP PP PP P Sbjct: 553 PPPSPVYYPPVTQSPPPPSPVYYPPVTNSPPP-----PSPVYYPPVTYSPP--PPSP 602 Score = 32.7 bits (71), Expect = 0.40 Identities = 20/85 (23%), Positives = 20/85 (23%) Frame = +3 Query: 747 PPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXPPXXX 926 PPPP P P PP PP P PP Sbjct: 441 PPPPPYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYV 500 Query: 927 XXXXXPPXXXPXXPPXXXXXRPPRP 1001 PP PP PP P Sbjct: 501 YSSPPPPYVYSSPPPPYVYSSPPPP 525 Score = 31.9 bits (69), Expect = 0.70 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P P P PPP P P PP P PP P Sbjct: 487 PPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPPPVVYYA 546 Query: 980 P 982 P Sbjct: 547 P 547 Score = 30.3 bits (65), Expect = 2.1 Identities = 17/55 (30%), Positives = 17/55 (30%), Gaps = 2/55 (3%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPX--PPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 PP P PP P PP PPP P PP P PP Sbjct: 538 PPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSPVYYPPVTNSPPPPSPVYYPP 592 Score = 30.3 bits (65), Expect = 2.1 Identities = 17/55 (30%), Positives = 17/55 (30%), Gaps = 2/55 (3%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPX--PPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 PP P P PP P PP PPP PP P PP Sbjct: 568 PPPSPVYYPPVTNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPP 622 Score = 29.9 bits (64), Expect = 2.8 Identities = 20/85 (23%), Positives = 20/85 (23%) Frame = +3 Query: 747 PPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXPPXXX 926 PPPP P P PP P P PP Sbjct: 458 PPPPPSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPYVYSSPP-PP 516 Query: 927 XXXXXPPXXXPXXPPXXXXXRPPRP 1001 PP P PP PP P Sbjct: 517 YVYSSPPPPPPSPPPPCPESSPPPP 541 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 3/56 (5%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPX---PPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 PP P P PP P P PPP P PP P PP Sbjct: 522 PPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSPVYYPP 577 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/51 (29%), Positives = 15/51 (29%) Frame = +2 Query: 812 PXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P P P PP PP P P P P PP P Sbjct: 597 PPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPPSPVYYPPVTPSPPPPSP 647 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/51 (29%), Positives = 15/51 (29%) Frame = +2 Query: 812 PXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P P P PP PP P P P P PP P Sbjct: 612 PPPPSPLYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPPSP 662 Score = 28.7 bits (61), Expect = 6.5 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 4/65 (6%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPP--PXXXPP--XXPPXPX 967 PP P PP P P PPP P PP P PP PP P Sbjct: 513 PPPPYVYSSPPPPPPSPPPPC-PESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPS 571 Query: 968 XXXXP 982 P Sbjct: 572 PVYYP 576 Score = 28.3 bits (60), Expect = 8.6 Identities = 15/46 (32%), Positives = 15/46 (32%), Gaps = 2/46 (4%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPX--PPXXXXPPPXXXXXPXPXXXPPP 931 PP P P PP P P PPP P PPP Sbjct: 643 PPPSPVYYPPVTPSPPPPSPVYYPSETQSPPPPTEYYYSPSQSPPP 688 >At5g43770.1 68418.m05353 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 187 Score = 33.1 bits (72), Expect = 0.30 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 6/61 (9%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPP---XPXPPXXXXPP---PXXXXXPXPXXXPPPXXXPPXXPPX 961 PP P P PP P PP PP P P P PP PP P Sbjct: 120 PPQTPGPEFPVPPSPSPPMPDTPNPPTPKTPPDVVPPIWEPPRPPDIFPPESPPPGIDPP 179 Query: 962 P 964 P Sbjct: 180 P 180 Score = 31.5 bits (68), Expect = 0.92 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P P PP P P PP P P PP P PP P Sbjct: 129 PVPPSPSPPMPDTPNPPTPKTPPDVVPPIWEPPRP-PDIFPPESPPPGIDPPPP 181 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 6/59 (10%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXP------PPXXXPPXXPP 958 PP P P PP P PP P P P P PP PP PP Sbjct: 116 PPLGPPQT-PGPEFPVPPSPSPPMPDTPNPPTPKTPPDVVPPIWEPPRPPDIFPPESPP 173 Score = 29.1 bits (62), Expect = 4.9 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P P PP P P P P PP P PP P P Sbjct: 126 PEFPVPPSPSPPMPDTPNPPTPKT-PPDVVPPIWEPPRPPDIFPP 169 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 33.1 bits (72), Expect = 0.30 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 851 PXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P PP PP P PPP PP PP P Sbjct: 668 PSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPPP 705 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPP 928 P PP P PP PPP P P PP Sbjct: 672 PPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPPP 705 Score = 31.5 bits (68), Expect = 0.92 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 812 PXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPP 931 P P PP P PP PPP P P PPP Sbjct: 668 PSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPP--PPPP 705 >At2g05440.1 68415.m00574 glycine-rich protein Length = 127 Score = 33.1 bits (72), Expect = 0.30 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G G GGG G G GGG GG G GG Sbjct: 67 GGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGGYGG 105 Score = 33.1 bits (72), Expect = 0.30 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G GG G GGG G G GGG GG GG Sbjct: 68 GGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGGYGGGGGHHGG 112 Score = 29.9 bits (64), Expect = 2.8 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXG 811 G G GG GGG G G GGG GG G G G G Sbjct: 60 GHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGGYGGGGGHHGGGGHG 116 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 32.7 bits (71), Expect = 0.40 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP PP PPP P PPP PP P Sbjct: 147 PPPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPPPP 185 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 P PP PP P P P P PP PP PP Sbjct: 146 PPPPESPPPESLPP----PSPESPSPPSPEPPPPSSLEPPPPPP 185 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P PP P P PP PP P Sbjct: 146 PPPPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPPP 184 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 32.7 bits (71), Expect = 0.40 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P PP PPP P PPP PP P Sbjct: 59 PPPPSPPPP-SPPPPACPPPPALPPPPPKKVSSYCPPPP 96 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 887 PXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P P P PPP PP PP P P Sbjct: 53 PSCIQNPPPPSPPPPSPPPPACPPPPALPPPP 84 >At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identical to gi_3883126_gb_AAC77826 Length = 135 Score = 32.3 bits (70), Expect = 0.53 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP PP PPP P P P P PP P P Sbjct: 32 PPPATPPPVATPPP--VATPPPAATPAPATPPPAATPAP 68 Score = 31.5 bits (68), Expect = 0.92 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P P PP PP P P P P P P PP P P Sbjct: 28 PTATPPPATPPPVATPPPVATPPPAATPAPAT---PPPAATPAPATTPPSVAPSP 79 >At4g08380.1 68417.m01384 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 437 Score = 32.3 bits (70), Expect = 0.53 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXP 955 PP P P PP P P PPP P P PP PP P Sbjct: 377 PP--PYTYSPPPYAYSPPPPCPDVYK-PPPYVYSSPPPYVYNPPPSSPPPSP 425 >At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to glycine-rich protein; atGRP (GI:259447) [Arabidopsis thaliana] Length = 145 Score = 32.3 bits (70), Expect = 0.53 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 3/58 (5%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGG---XGXGGXXXXXXGXXXXGXXGG 799 G G G GGG G G GGG GG G GG G G GG Sbjct: 56 GYQGGGGNYQGGGGNYQGGGGNYQGGGGRYQGGGGRYQGGGGRYQGGGGRQGGGGSGG 113 Score = 29.5 bits (63), Expect = 3.7 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G G G GGG G G GG GG GG G GG Sbjct: 43 GYGDNGGNYNNGGGYQGGGGNYQGGGGNYQGGGGNYQGGGGRYQGGGGRYQGGGG 97 Score = 28.3 bits (60), Expect = 8.6 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 3/60 (5%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGG---XGXGGXXXXXXGXXXXG 811 G G GG GGG G G GGG GG G GG G G Sbjct: 43 GYGDNGGNYNNGGGYQGGGGNYQGGGGNYQGGGGNYQGGGGRYQGGGGRYQGGGGRYQGG 102 >At2g05510.1 68415.m00583 glycine-rich protein Length = 127 Score = 32.3 bits (70), Expect = 0.53 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G GG GG GGG G G GGG GG GG Sbjct: 70 GGHGLDGYGGGHGGHYGGGGGHYGGGGGHG-GGGHYGGGGHHGGG 113 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 32.3 bits (70), Expect = 0.53 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 6/43 (13%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPP------XXXPPXXPP 958 PP P PP PPP P PPP PP PP Sbjct: 384 PPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPP 426 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P P PPP PPP P PP P Sbjct: 373 PAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPP 411 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/53 (28%), Positives = 15/53 (28%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 PP P PP P PPP P PP P PP Sbjct: 384 PPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPP 436 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 32.3 bits (70), Expect = 0.53 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G GG GG GGG G G GG GG G GG Sbjct: 162 GGGGIGGGGGIGGGVIIGGG---GGGCGGSCSGGGGGGGGYGHGG 203 Score = 31.1 bits (67), Expect = 1.2 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Frame = -3 Query: 981 GXXXXXGXGGXXG--GXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGX 808 G G GG G G GGG G G GGG GG GG G G Sbjct: 135 GGGAGYGSGGGLGWDGGNGGGGPGYGSG-GGGIGGGGGIGGGVIIGGGGGGCGGSCSGGG 193 Query: 807 XGG 799 GG Sbjct: 194 GGG 196 Score = 29.1 bits (62), Expect = 4.9 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 5/60 (8%) Frame = -3 Query: 963 GXGGXXGGXXXGG---GXXXGXGXXXXXGGG--XXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G G GG GG G G G GGG GG G GG G G GG Sbjct: 125 GGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGG 184 Score = 28.7 bits (61), Expect = 6.5 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXG--XXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G G GGG G G GGG GG G G G G GG Sbjct: 100 GELTAGGYGGGGPGYGGGGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGG 154 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 31.9 bits (69), Expect = 0.70 Identities = 23/88 (26%), Positives = 24/88 (27%), Gaps = 3/88 (3%) Frame = +3 Query: 747 PPPPXXXXAXXXXXXRXXPXP---XXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXPP 917 PPPP + P P P PP PP P P PP Sbjct: 89 PPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPP----PPVLLSPPPPPVNLSPP 144 Query: 918 XXXXXXXXPPXXXPXXPPXXXXXRPPRP 1001 PP PP RPP P Sbjct: 145 PPPVLLSPPPPPVLFSPPPPTVTRPPPP 172 Score = 31.5 bits (68), Expect = 0.92 Identities = 20/88 (22%), Positives = 22/88 (25%) Frame = +3 Query: 738 LXHPPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXPP 917 L PPPP + P P +PP P P PP Sbjct: 95 LLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPP 154 Query: 918 XXXXXXXXPPXXXPXXPPXXXXXRPPRP 1001 PP PP PP P Sbjct: 155 PPVLFSPPPPTVTRPPPPPTITRSPPPP 182 Score = 30.7 bits (66), Expect = 1.6 Identities = 19/85 (22%), Positives = 21/85 (24%) Frame = +3 Query: 747 PPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXPPXXX 926 PPPP + P P +PP P P PP Sbjct: 44 PPPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPV 103 Query: 927 XXXXXPPXXXPXXPPXXXXXRPPRP 1001 PP PP PP P Sbjct: 104 NLSPPPPPVNLSPPPPPVLLSPPPP 128 Score = 30.7 bits (66), Expect = 1.6 Identities = 19/85 (22%), Positives = 21/85 (24%) Frame = +3 Query: 747 PPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXPPXXX 926 PPPP + P P +PP P P PP Sbjct: 62 PPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPV 121 Query: 927 XXXXXPPXXXPXXPPXXXXXRPPRP 1001 PP PP PP P Sbjct: 122 LLSPPPPPVLLSPPPPPVNLSPPPP 146 Score = 30.3 bits (65), Expect = 2.1 Identities = 19/85 (22%), Positives = 21/85 (24%) Frame = +3 Query: 747 PPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXPPXXX 926 PPPP + P P +PP P P PP Sbjct: 71 PPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPV 130 Query: 927 XXXXXPPXXXPXXPPXXXXXRPPRP 1001 PP PP PP P Sbjct: 131 LLSPPPPPVNLSPPPPPVLLSPPPP 155 Score = 29.9 bits (64), Expect = 2.8 Identities = 19/85 (22%), Positives = 21/85 (24%) Frame = +3 Query: 747 PPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXPPXXX 926 PPPP + P P +PP P P PP Sbjct: 80 PPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPV 139 Query: 927 XXXXXPPXXXPXXPPXXXXXRPPRP 1001 PP PP PP P Sbjct: 140 NLSPPPPPVLLSPPPPPVLFSPPPP 164 Score = 29.1 bits (62), Expect = 4.9 Identities = 22/87 (25%), Positives = 22/87 (25%), Gaps = 2/87 (2%) Frame = +3 Query: 747 PPPPXXXXAXXXXXXRXXPXP--XXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXPPX 920 PPPP P P P PP PP P P PP Sbjct: 54 PPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPP---PPVLLSPPPPPVNLSPPPP 110 Query: 921 XXXXXXXPPXXXPXXPPXXXXXRPPRP 1001 PP PP PP P Sbjct: 111 PVNLSPPPPPVLLSPPPPPVLLSPPPP 137 >At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; glycine-rich protein 16 (GRP16) PMID:11431566 Length = 244 Score = 31.9 bits (69), Expect = 0.70 Identities = 20/64 (31%), Positives = 20/64 (31%), Gaps = 1/64 (1%) Frame = -3 Query: 957 GGXXGGXXXGG-GXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGGXXXXXX 781 GG GG G G G G GGG G G GG G G G Sbjct: 161 GGASGGASGGASGGASGGGPGGASGGGPGGASGGGPGGASGGASGDKPEGAPGDKPGGAW 220 Query: 780 XGXP 769 G P Sbjct: 221 GGKP 224 Score = 29.5 bits (63), Expect = 3.7 Identities = 20/67 (29%), Positives = 20/67 (29%), Gaps = 2/67 (2%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXG--GXGXGGXXXXXXGXXXXGXXGGXXX 790 G G G G G G GGG G G G GG G G GG Sbjct: 114 GASGDKPGEMSGAGGPSGDKPGGASGGGDKPGGASGGGPGGASGGASGGASGGASGGASG 173 Query: 789 XXXXGXP 769 G P Sbjct: 174 GASGGGP 180 Score = 29.5 bits (63), Expect = 3.7 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGGXXXXXXX 778 GG GG GG G G GG G GG G G GG Sbjct: 135 GGASGGGDKPGGASGG-GPGGASGGASGGASGGASGGASGGASGGGPGGASGGGPGGASG 193 Query: 777 GXP 769 G P Sbjct: 194 GGP 196 Score = 29.5 bits (63), Expect = 3.7 Identities = 22/72 (30%), Positives = 22/72 (30%), Gaps = 1/72 (1%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGG-GXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXX 805 G G GG GG G G G GGG G G GG G G Sbjct: 145 GGASGGGPGGASGGASGGASGGASGGASGGASGGGPGGASGGGPGGASGGGPG----GAS 200 Query: 804 GGXXXXXXXGXP 769 GG G P Sbjct: 201 GGASGDKPEGAP 212 Score = 29.1 bits (62), Expect = 4.9 Identities = 19/65 (29%), Positives = 19/65 (29%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGGXXXXX 784 G GG G GG G GGG G GG G G GG Sbjct: 125 GAGGP-SGDKPGGASGGGDKPGGASGGGPGGASGGASGGASGGASGGASGGASGGGPGGA 183 Query: 783 XXGXP 769 G P Sbjct: 184 SGGGP 188 >At2g28490.1 68415.m03462 cupin family protein similar to preproMP27-MP32 [Cucurbita cv. Kurokawa Amakuri] GI:691752, allergen Gly m Bd 28K [Glycine max] GI:12697782, vicilin [Matteuccia struthiopteris] GI:1019792; contains Pfam profile PF00190: Cupin Length = 511 Score = 31.9 bits (69), Expect = 0.70 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 GG GG GGG G G GGG GG G GG Sbjct: 48 GGAWGGGGGGGGAWGGEGE----GGGEWGGGGEGGGG 80 Score = 29.5 bits (63), Expect = 3.7 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GG G G GGG GG G GG G G G Sbjct: 35 GGAGGGEWGGA--EGGGAWGGGGGGGGAWGGEGEGGGEWGGGGEGGGGGRRG 84 >At1g04660.1 68414.m00463 glycine-rich protein Length = 212 Score = 31.9 bits (69), Expect = 0.70 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGG-GXXXXGGXGXG-GXXXXXXGXXXXGX 808 G G GG GG GG G G GG G GG G G G G G Sbjct: 115 GVGGLGGVGGGVGGLGGVGGGVGGLGGVGGLGGAGLGGVGGVGGGIGKAGGIGGLGGLGG 174 Query: 807 XGG 799 GG Sbjct: 175 AGG 177 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 31.5 bits (68), Expect = 0.92 Identities = 19/62 (30%), Positives = 19/62 (30%), Gaps = 1/62 (1%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXP-PXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXX 976 P P P P P P PP P P P P PPP P P P Sbjct: 210 PTPGPDSPLPSPGPDSPLPLPGPPPSSSPTPGPDS-PLPSPGPPPSPSPTPGPDSPLPSP 268 Query: 977 XP 982 P Sbjct: 269 GP 270 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/63 (30%), Positives = 19/63 (30%), Gaps = 2/63 (3%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXP-PXXXXP-PPXXXXXPXPXXXPPPXXXPPXXPPXPXXX 973 P P P PP P P P P P P P PPP P P P Sbjct: 189 PLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSSSPTPGPDSPLPS 248 Query: 974 XXP 982 P Sbjct: 249 PGP 251 Score = 30.7 bits (66), Expect = 1.6 Identities = 19/63 (30%), Positives = 19/63 (30%), Gaps = 2/63 (3%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXP-PXXXXP-PPXXXXXPXPXXXPPPXXXPPXXPPXPXXX 973 PP P PP P P P P P P P PPP P P P Sbjct: 161 PPLPPPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPS 220 Query: 974 XXP 982 P Sbjct: 221 PGP 223 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 31.5 bits (68), Expect = 0.92 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPP 931 PP P PP PPP P PPP Sbjct: 313 PPPPPPPLLQQPPPPPSVSKAPPPPPPP 340 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P PP P PP PPP P P P PP PP P Sbjct: 303 PPPQKSIPPPPPPP----PPPLLQQPPPP---PSVSKAPPPPPPPP 341 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P PP PPP P P PP PP P Sbjct: 305 PQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 3/38 (7%) Frame = +2 Query: 827 PXXXXXXPPXPXPP---XXXXPPPXXXXXPXPXXXPPP 931 P PP P PP PPP P P PPP Sbjct: 305 PQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPP 342 Score = 28.7 bits (61), Expect = 6.5 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 P PP P PP PP P P P PP PP Sbjct: 304 PPQKSIPPPPPPPP----PPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +2 Query: 863 PPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 PP PPP P PPP PP P P Sbjct: 304 PPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 >At3g04640.1 68416.m00497 glycine-rich protein predicted proteins, Arabidopsis thaliana Length = 159 Score = 31.5 bits (68), Expect = 0.92 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXG 856 G GG GG GGG G G GGG G G Sbjct: 75 GGGGRGGGGFGGGGRSFGGGGSSSRGGGGSSSRGGG 110 >At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein contains Pfam profile PF04410: Gar1 protein RNA binding region Length = 202 Score = 31.5 bits (68), Expect = 0.92 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G GG GG GGG G G GGG GG GG Sbjct: 7 GGGGFRGRGGRDGG---GGGRFGGGGGRFGGGGGRFGGGGGRFGG 48 >At2g43150.1 68415.m05358 proline-rich extensin-like family protein similar to CRANTZ hydroxyproline-rich glycoprotein [Manihot esculenta] gi|7211797|gb|AAF40442; similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 212 Score = 31.5 bits (68), Expect = 0.92 Identities = 19/65 (29%), Positives = 19/65 (29%), Gaps = 4/65 (6%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPX----PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPX 967 PP P PP P PP PPP P P PP PP P Sbjct: 38 PPYEYKSPPPPVKSPPPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPPPYVYSSPPPPV 97 Query: 968 XXXXP 982 P Sbjct: 98 KSPPP 102 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/65 (29%), Positives = 19/65 (29%), Gaps = 4/65 (6%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPX----PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPX 967 PP P PP P PP PPP P P PP PP P Sbjct: 54 PPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPPPPYYYHSPPPPV 113 Query: 968 XXXXP 982 P Sbjct: 114 KSPPP 118 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/65 (29%), Positives = 19/65 (29%), Gaps = 4/65 (6%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPX----PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPX 967 PP P PP P PP PPP P P PP PP P Sbjct: 70 PPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPV 129 Query: 968 XXXXP 982 P Sbjct: 130 KSPPP 134 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/65 (29%), Positives = 19/65 (29%), Gaps = 4/65 (6%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPX----PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPX 967 PP P PP P PP PPP P P PP PP P Sbjct: 86 PPYVYSSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPV 145 Query: 968 XXXXP 982 P Sbjct: 146 KSPPP 150 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/65 (29%), Positives = 19/65 (29%), Gaps = 4/65 (6%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPX----PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPX 967 PP P PP P PP PPP P P PP PP P Sbjct: 102 PPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPV 161 Query: 968 XXXXP 982 P Sbjct: 162 KSPPP 166 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/65 (29%), Positives = 19/65 (29%), Gaps = 4/65 (6%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPX----PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPX 967 PP P PP P PP PPP P P PP PP P Sbjct: 118 PPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPV 177 Query: 968 XXXXP 982 P Sbjct: 178 KSPPP 182 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/65 (29%), Positives = 19/65 (29%), Gaps = 4/65 (6%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPX----PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPX 967 PP P PP P PP PPP P P PP PP P Sbjct: 134 PPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYLYSSPPPPV 193 Query: 968 XXXXP 982 P Sbjct: 194 KSPPP 198 Score = 29.5 bits (63), Expect = 3.7 Identities = 19/86 (22%), Positives = 19/86 (22%) Frame = +3 Query: 744 HPPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXXPXXXXXXXXPPXX 923 H PPP P P P P PP P P Sbjct: 107 HSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPP 166 Query: 924 XXXXXXPPXXXPXXPPXXXXXRPPRP 1001 PP PP PP P Sbjct: 167 PYYYHSPPPPVKSPPPPYLYSSPPPP 192 Score = 29.1 bits (62), Expect = 4.9 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 5/60 (8%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPX----PXPPXXXXPPP-XXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P PP P PP PPP P P PPP PP P Sbjct: 150 PPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYLYSSPPPPVKSPPPPVYIYASPPPP 209 Score = 28.7 bits (61), Expect = 6.5 Identities = 20/87 (22%), Positives = 20/87 (22%), Gaps = 1/87 (1%) Frame = +3 Query: 744 HPPPPXXXXAXXXXXXRXXPXPXXXPXTPPXXXXXPPXXXXPXXXXX-PXXXXXXXXPPX 920 H PPP P P P P PP P PP Sbjct: 123 HSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPP 182 Query: 921 XXXXXXXPPXXXPXXPPXXXXXRPPRP 1001 PP PP PP P Sbjct: 183 PYLYSSPPPPVKSPPPPVYIYASPPPP 209 >At1g31750.1 68414.m03895 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 176 Score = 31.5 bits (68), Expect = 0.92 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P PP PP PPP P PPP PP P P Sbjct: 32 PPQGAYPPPGGYPPQGYPPPPHGY--PPAAYPPPPGAYPPAGYPGP 75 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +2 Query: 857 PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P PP PPP P PPP PP P P P Sbjct: 30 PPPPQGAYPPPGGY--PPQGYPPPPHGYPPAAYPPPPGAYPP 69 >At1g02710.1 68414.m00222 glycine-rich protein Length = 96 Score = 31.5 bits (68), Expect = 0.92 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 GG GG GGG G G GGG GG G G G Sbjct: 45 GGGEGGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGGGEGDGGGG 96 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = -3 Query: 963 GXGGXXGGXXXGGG--XXXGXGXXXXXGGGXXXXGGXGXGG 847 G GG GG GGG G G GG GG G GG Sbjct: 49 GGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGGG 89 Score = 29.5 bits (63), Expect = 3.7 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGG 862 G GG GG GGG G GGG GG Sbjct: 44 GGGGEGGGGEGGGGEGGGGQKISKGGGGGGSGGG 77 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 857 PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXP 955 P PP PPP P P PPP PP P Sbjct: 365 PVPPPRRSPPPLQTPPPPP---PPPPLAPPPPP 394 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 PP P P P PPP PP PP P P Sbjct: 348 PPPPNRAAFQAITQEKSPVPPPRRSPPPLQTPPPPPPPPPLAPPP 392 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +2 Query: 881 PPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P P P P PPP PP P P P Sbjct: 365 PVPPPRRSPPPLQTPPPPPPPPPLAPPPPPQKRP 398 >At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G G GG GGG G GG GG G GG G G GG Sbjct: 19 GGDGYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYG-GGGGRGNRGGGGGGYQGG 72 Score = 28.3 bits (60), Expect = 8.6 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G G G GGG G G GGG GG G GG G G G Sbjct: 26 GGGYGGGDAGYGGRGASGGGSYGGRGGYGG-GGGRGNRGG-GGGGYQGGDRGGRGSGGGG 83 >At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G G GG GGG G GG GG G GG G G GG Sbjct: 19 GGDGYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYG-GGGGRGNRGGGGGGYQGG 72 Score = 28.3 bits (60), Expect = 8.6 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G G G GGG G G GGG GG G GG G G G Sbjct: 26 GGGYGGGDAGYGGRGASGGGSYGGRGGYGG-GGGRGNRGG-GGGGYQGGDRGGRGSGGGG 83 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 3/56 (5%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPP---XXXXXPXPXXXPPPXXXPPXXPP 958 PP P P PP PP P P P PP PP PP Sbjct: 100 PPVQPPTYKPPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQPP 155 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 5/60 (8%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPP-----PXXXPPXXPPXP 964 PP P P PP PP PP P PP P PP PP P Sbjct: 150 PPVQPPTYKPPTSPVKPPTTTPPVK--PPTTTPPVQPPTYNPPTTPVKPPTAPPVKPPTP 207 Score = 28.3 bits (60), Expect = 8.6 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 PP P P PP PP PP P PP P PP Sbjct: 141 PPTTPPVQSPPVQ---PPTYKPPTSPVKPPTTTPPVKPPTTTPPVQPPTYNPP 190 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P HP P P P PPP P PPP P PP P Sbjct: 111 PSLTPFVPHPTPKKSPSPPPTPSL---PPPAPKKSPSTPSLPPP--TPKKSPPPP 160 Score = 28.7 bits (61), Expect = 6.5 Identities = 15/48 (31%), Positives = 15/48 (31%), Gaps = 2/48 (4%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPP--PXXXXXPXPXXXPPPXXXPPXXPPXP 964 P PP P P PP P P P P P PP P Sbjct: 92 PPAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPPAP 139 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -3 Query: 993 AXXXGXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 A G G G GG GGG G G GGG G G GG Sbjct: 84 APVQGNSGGGGSSGGRGGFGGGGGRGGGRGGGSY-GGGYGGRGSGGRGG 131 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/62 (29%), Positives = 18/62 (29%), Gaps = 1/62 (1%) Frame = +2 Query: 800 PPXXPXXXH-PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXX 976 PP P H P PP P PPP P P P PP P Sbjct: 541 PPPPPCYSHSPKIEYKSPPTPYVYHSPPPPPYYSPSPKPAYKSSPPPYVYSSPPPPYYSP 600 Query: 977 XP 982 P Sbjct: 601 AP 602 Score = 29.5 bits (63), Expect = 3.7 Identities = 17/61 (27%), Positives = 17/61 (27%), Gaps = 1/61 (1%) Frame = +2 Query: 803 PXXPXXXH-PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 P P H P P P P PPP P P P PP P Sbjct: 558 PPTPYVYHSPPPPPYYSPSPKPAYKSSPPPYVYSSPPPPYYSPAPKPVYKSPPPPYVYNS 617 Query: 980 P 982 P Sbjct: 618 P 618 Score = 28.3 bits (60), Expect = 8.6 Identities = 15/60 (25%), Positives = 16/60 (26%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P P + P P P PPP P P P PP P P Sbjct: 332 PPPPYVYNSPPPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSP 391 Score = 28.3 bits (60), Expect = 8.6 Identities = 15/60 (25%), Positives = 16/60 (26%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P P + P P P PPP P P P PP P P Sbjct: 609 PPPPYVYNSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPTPKPTYKSPPPPYVYSSP 668 >At1g11850.2 68414.m01364 expressed protein Length = 108 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXG 802 G G G GG G G G G GGG GG G G G G G Sbjct: 48 GLGLGLGGGAGLGGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLG--GGGFGGGAGGGLG 105 Query: 801 G 799 G Sbjct: 106 G 106 Score = 30.3 bits (65), Expect = 2.1 Identities = 19/65 (29%), Positives = 19/65 (29%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGGXXXXX 784 G G G GG G G G G G G GG G G GG Sbjct: 44 GSGDGLGLGLGGGAGLGGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLGGGGFGGGAGGG 103 Query: 783 XXGXP 769 G P Sbjct: 104 LGGLP 108 Score = 29.1 bits (62), Expect = 4.9 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = -3 Query: 993 AXXXGXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXG-GXGXGG 847 A G G G G GGG G G GGG G G G GG Sbjct: 57 AGLGGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLGGGGFGGGAGGGLGG 106 >At1g11130.1 68414.m01274 leucine-rich repeat family protein / protein kinase family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to leucine-rich repeat transmembrane protein kinase 2 [Zea mays] gi|3360291|gb|AAC27895 Length = 768 Score = 31.1 bits (67), Expect = 1.2 Identities = 21/66 (31%), Positives = 21/66 (31%), Gaps = 3/66 (4%) Frame = +2 Query: 770 GXPXXXXXXXPPXXPXXXHPXXXXXXPPXP-XPPXXXXPP-PXXXXXP-XPXXXPPPXXX 940 G P PP P P PP P PP PP P P P PPP Sbjct: 239 GTPFNTSIITPPPPPVVDPPPATHRAPPVPRIPPVSGVPPAPFAPFAPLQPQQHPPPSPP 298 Query: 941 PPXXPP 958 PP Sbjct: 299 LVWSPP 304 >At5g62760.2 68418.m07879 nuclear protein ZAP-related similar to nuclear protein ZAP, Mus musculus, EMBL:AB033168 this cDNA provides a truncated ORF likely due to a skipped exon. An alternative ORF is provided. Length = 383 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/51 (29%), Positives = 15/51 (29%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXP 955 P P P P P PP P P P PP PP P Sbjct: 39 PFCPPYPPPSSFAYNPNFPPPPHLNSPRPGFDSFTGPPVRPPQNHYPPWQP 89 >At5g62760.1 68418.m07878 nuclear protein ZAP-related similar to nuclear protein ZAP, Mus musculus, EMBL:AB033168 this cDNA provides a truncated ORF likely due to a skipped exon. An alternative ORF is provided. Length = 661 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/51 (29%), Positives = 15/51 (29%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXP 955 P P P P P PP P P P PP PP P Sbjct: 39 PFCPPYPPPSSFAYNPNFPPPPHLNSPRPGFDSFTGPPVRPPQNHYPPWQP 89 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 851 PXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 P P P PP P PPP PP PP Sbjct: 9 PYPAPGNYPQGPPPPVGVPPQYYPPPPPPPPPPPPP 44 >At4g29020.1 68417.m04149 glycine-rich protein supporting cDNA gi|20465684|gb|AY096677.1| Length = 158 Score = 30.3 bits (65), Expect = 2.1 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Frame = -3 Query: 957 GGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGX-GGXXXXXXGXXXXGXXGG 799 GG GG GG G G GGG G G GG G G GG Sbjct: 79 GGVGGGIGGLGGGVGGLGGLGGLGGGSGLGHGVGGIGGDPGIGSGIGGLGGAGG 132 >At4g08370.1 68417.m01382 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 350 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +2 Query: 812 PXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 P P PP P P PPP P P PP PP Sbjct: 32 PQSPPPQPYVYSPPLPSPYVYKSPPPSPYLYSSPPPPPYVYNSPPPPPP 80 >At3g50140.1 68416.m05481 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 508 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P PP PP P P PPP P P P Sbjct: 9 PPPPPPP----PPRLLVLPPLPPPPPPPPPQLPFGPKLP 43 >At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PLDBETA1) identical to SP|P93733 Phospholipase D beta 1 (EC 3.1.4.4) (AtPLDbeta1) (PLD beta 1) (PLDbeta) {Arabidopsis thaliana}; contains Pfam profiles: PF00614 phospholipase D.active site motif, PF00168 C2 domain Length = 1083 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 851 PXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 P P PP P P P PPP PP PP Sbjct: 32 PYPPPPTNQYSAPYYPYPPPPYATPPPYASPP--PP 65 >At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to auxin down regulated GB:X69640 GI:296442 from [Glycine max]; contains Pfam profile PF00234: Protease inhibitor/seed storage/LTP family Length = 297 Score = 30.3 bits (65), Expect = 2.1 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPP-XXXXXPXPXXXPPPXXXPPXXPP 958 PP P P PP PP PPP P PPP PP P Sbjct: 94 PP--PVVVRPPPIIRPPPVVYPPPIVRPPPITRPPIIIPPIQPPPVTTPPGLLP 145 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +2 Query: 812 PXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 P P PP PP PPP P PP PP PP Sbjct: 90 PVVRPPPVVVRPPPIIRPPPVVYPPPIVRPPPITR---PPIIIPPIQPP 135 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/49 (28%), Positives = 14/49 (28%) Frame = +2 Query: 812 PXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 P P PP PP PP P PP PP P Sbjct: 102 PPIIRPPPVVYPPPIVRPPPITRPPIIIPPIQPPPVTTPPGLLPPITTP 150 Score = 28.3 bits (60), Expect = 8.6 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP PP PP P P PPP PP P Sbjct: 89 PPVVRPPPVVVRPP-PIIRPPPVVYPPPIVRPPPITRPP 126 >At5g61660.1 68418.m07736 glycine-rich protein Length = 134 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G G G G G G GGG GG G G G G G Sbjct: 70 GRGSGYGYGSGSGSGTGYGYGSGGGGARGGGYGYGSGNGRSGGGGGGGGFNG 121 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/57 (29%), Positives = 17/57 (29%), Gaps = 2/57 (3%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXX--PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P PP PP P P P PPP P P P Sbjct: 371 PPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPP 427 Score = 28.7 bits (61), Expect = 6.5 Identities = 17/62 (27%), Positives = 17/62 (27%), Gaps = 1/62 (1%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXP-PXXPPXPXXXX 976 PP P P P P P P P PP P P PP P Sbjct: 353 PPEPPKFLKVSSKKASAPPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPR 412 Query: 977 XP 982 P Sbjct: 413 PP 414 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/57 (29%), Positives = 17/57 (29%), Gaps = 2/57 (3%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXX--PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P PP PP P P P PPP P P P Sbjct: 371 PPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPP 427 Score = 28.7 bits (61), Expect = 6.5 Identities = 17/62 (27%), Positives = 17/62 (27%), Gaps = 1/62 (1%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXP-PXXPPXPXXXX 976 PP P P P P P P P PP P P PP P Sbjct: 353 PPEPPKFLKVSSKKASAPPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPR 412 Query: 977 XP 982 P Sbjct: 413 PP 414 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 3/56 (5%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPX---PPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 PP P PP P PP PPP P PPP PP Sbjct: 157 PPGQMPPQPPFAGQGGPPPPYGMRPPYPGPPPPQYGGQQRPMMIPPPGGMMRGPPP 212 Score = 28.3 bits (60), Expect = 8.6 Identities = 15/46 (32%), Positives = 15/46 (32%), Gaps = 2/46 (4%) Frame = +2 Query: 851 PXPXPPXXXXPPPXXXXXPXPXXX--PPPXXXPPXXPPXPXXXXXP 982 P P PPP P P PPP P PP P P Sbjct: 201 PPPGGMMRGPPPPHGMQGPPPSRPGMPPPGGAPMFAPPHPGMPPAP 246 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/53 (28%), Positives = 15/53 (28%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 PP P PP P P P P P P PP PP Sbjct: 18 PPTNSTTTTPPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLPPSLPPPSPP 70 Score = 29.1 bits (62), Expect = 4.9 Identities = 17/62 (27%), Positives = 17/62 (27%), Gaps = 1/62 (1%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPX-PXXXPPPXXXPPXXPPXPXXXX 976 PP P PP PPP P P PP PP P P Sbjct: 27 PPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLPPSLPPPSPPGSLTPPLPQPSPSAPI 86 Query: 977 XP 982 P Sbjct: 87 TP 88 Score = 29.1 bits (62), Expect = 4.9 Identities = 16/53 (30%), Positives = 16/53 (30%), Gaps = 1/53 (1%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXP-PPXXXXXPXPXXXPPPXXXPPXXP 955 PP P P P P P P PP P P P PP P Sbjct: 61 PPSLPPPSPPGSLTPPLPQPSPSAPITPSPPSPTTPSNPRSPPSPNQGPPNTP 113 >At3g22070.1 68416.m02785 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 178 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P P P PPP P P PPP P P P Sbjct: 99 PNPPAPIVNPNPPPPSTPNPPPEFSPPPPDLDTTTAPPPPSTDIP 143 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 4/42 (9%) Frame = +2 Query: 851 PXPXPPXXXXPPPXXXXXP----XPXXXPPPXXXPPXXPPXP 964 P P PP PPP P PPP P PP P Sbjct: 108 PNPPPPSTPNPPPEFSPPPPDLDTTTAPPPPSTDIPIPPPPP 149 Score = 29.5 bits (63), Expect = 3.7 Identities = 17/53 (32%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXX-PPXXPP 958 P P +P PP P PPP P P P P PP PP Sbjct: 110 PPPPSTPNPPPEFSPPP-PDLDTTTAPPPPSTDIPIPPPPPAPVSASPPLTPP 161 >At2g11005.1 68415.m01177 glycine-rich protein Length = 170 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = -3 Query: 981 GXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G G G G GGG G G G G GG G G Sbjct: 16 GGSGGGGGSGDGSGSGDGGGSGDGGGSRDSDGSGDSSGGGSGDSG 60 Score = 28.3 bits (60), Expect = 8.6 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = -3 Query: 981 GXXXXXGXG-GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXG 856 G G G G GG GGG G GGG GG G Sbjct: 21 GGGSGDGSGSGDGGGSGDGGGSRDSDGSGDSSGGGSGDSGGFG 63 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +2 Query: 812 PXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 P P PP P PP PPP P P P P PP Sbjct: 81 PIKCTPCLQNIPPPSPPPP---SPPPPSQACPPPPLPPSPPKKSYCPPP 126 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 851 PXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 P P PP PPP P P PP PP Sbjct: 92 PPPSPPPPSPPPPSQACPPPPLPPSPPKKSYCPPPP 127 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 29.9 bits (64), Expect = 2.8 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXX 979 PP P PP P P PPP P PPP PP P Sbjct: 153 PPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSP---PPPPYVYKSPPPPPYVYSS 209 Query: 980 P 982 P Sbjct: 210 P 210 >At5g65390.1 68418.m08224 arabinogalactan-protein (AGP7) Length = 130 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P PP PP P P P P P P PP P P Sbjct: 28 PTTTVTPPPVATPPPAATPAPTTT--PPPAVSPAPTSSPPSSAPSP 71 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 29.5 bits (63), Expect = 3.7 Identities = 17/62 (27%), Positives = 17/62 (27%), Gaps = 1/62 (1%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPP-PXXXPPXXPPXPXXXX 976 P P P P P P P P P PP P P PP P Sbjct: 53 PKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAP 112 Query: 977 XP 982 P Sbjct: 113 AP 114 Score = 29.5 bits (63), Expect = 3.7 Identities = 17/62 (27%), Positives = 17/62 (27%), Gaps = 1/62 (1%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXP-PXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXX 976 PP P P P P PP P P P P P P P P Sbjct: 61 PPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTPAP 120 Query: 977 XP 982 P Sbjct: 121 KP 122 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/56 (28%), Positives = 16/56 (28%), Gaps = 1/56 (1%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXP-PXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P P P PP P P P P P P P P Sbjct: 28 PPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTP 83 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/56 (28%), Positives = 16/56 (28%), Gaps = 1/56 (1%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXP-PXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P P P PP P P P P P P P P Sbjct: 39 PPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTP 94 Score = 28.3 bits (60), Expect = 8.6 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 1/46 (2%) Frame = +2 Query: 848 PPXPXP-PXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 PP P P P P P P P P P P PP P P Sbjct: 28 PPKPKPAPAPTPPKPKPTPAPTP---PKPKPKPAPTPPKPKPAPAP 70 Score = 28.3 bits (60), Expect = 8.6 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 1/46 (2%) Frame = +2 Query: 848 PPXPXP-PXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 PP P P P P P P P P P P PP P P Sbjct: 39 PPKPKPTPAPTPPKPKPKPAPTP---PKPKPAPAPTPPKPKPAPAP 81 Score = 28.3 bits (60), Expect = 8.6 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 1/46 (2%) Frame = +2 Query: 848 PPXPXP-PXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 PP P P P P P P P P P P PP P P Sbjct: 50 PPKPKPKPAPTPPKPKPAPAPTP---PKPKPAPAPTPPKPKPKPAP 92 >At3g20850.1 68416.m02636 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 29.5 bits (63), Expect = 3.7 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXPXXXA 994 PP P P PPP P PP PP P P P A Sbjct: 55 PPPPTP--VYSPPPADLPPPPTPYYSPPADLPPPTPIYPPPVAFPPPQA 101 Score = 29.5 bits (63), Expect = 3.7 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPP 931 PP P P PP P PP P P PPP Sbjct: 56 PPPTPVYSPPPADLPPPPTPYYSPPADLPPPTPIYPPPVAFPPP 99 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/49 (28%), Positives = 14/49 (28%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPP 946 P P P P PP PP P P PP PP Sbjct: 51 PADLPPPPTPVYSPPPADLPPPPTPYYSPPADLPPPTPIYPPPVAFPPP 99 >At1g53625.1 68414.m06096 expressed protein Length = 89 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 930 GGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 GGG G G GGG GG G GG Sbjct: 59 GGGDGGGDGGGDGGGGGCGGGGGCGGGG 86 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGG 880 G GG GG GGG G G GGG Sbjct: 61 GDGGGDGGGDGGGGGCGGGGGCGGGGGG 88 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 942 GXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G GGG G G GGG GG G G Sbjct: 59 GGGDGGGDGGGDGGGGGCGGGGGCGGGGGGG 89 >At5g19090.2 68418.m02270 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 465 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G GG GGG GGG GG G GG Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGG 137 >At5g19090.1 68418.m02269 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 587 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGG 847 G GG GGG GGG GG G GG Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGG 137 >At5g13760.1 68418.m01604 expressed protein similar to unknown protein (gb AAF63775.1) Length = 569 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/43 (30%), Positives = 13/43 (30%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPP 931 P P P P P PP PP P PPP Sbjct: 72 PPPPNLAQPLRSSSRQPPPPPPRPQTPPTFVPEETQPQTPPPP 114 >At5g08230.1 68418.m00965 PWWP domain-containing protein putative transcription factor (HUA2) - Arabidopsis thaliana, EMBL:AF116556 Length = 1445 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 851 PXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P PP PP P P PPP PP P P Sbjct: 1122 PAGSPPLPHESPPSPP--PQPPSSPPPPSSPPQLAPAP 1157 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 29.1 bits (62), Expect = 4.9 Identities = 15/45 (33%), Positives = 15/45 (33%), Gaps = 3/45 (6%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPXPPXXXX---PPPXXXXXPXPXXXPP 928 P P P PP P PP PPP P P PP Sbjct: 28 PLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLPRPCSRPP 72 Score = 28.7 bits (61), Expect = 6.5 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 PP P PP P P PP PP PP P P Sbjct: 30 PPPPPPPLMRRRAPPPPPPPLMRRRAPP---PPPPPPLPRPCSRP 71 Score = 28.3 bits (60), Expect = 8.6 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 9/48 (18%) Frame = +2 Query: 848 PPXPXP------PXXXXPPPXXXXXPXPXXXPPP---XXXPPXXPPXP 964 PP P P P PPP P PPP PP PP P Sbjct: 16 PPPPPPLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPP 63 >At4g15460.1 68417.m02363 glycine-rich protein Length = 148 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -3 Query: 954 GXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G G GGG G G GGG GG G G Sbjct: 67 GGGGHASVGGGHASGGGGHAVEGGGHAGGGGGGHG 101 >At1g04800.1 68414.m00476 glycine-rich protein Length = 200 Score = 29.1 bits (62), Expect = 4.9 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 2/57 (3%) Frame = -3 Query: 963 GXGGXXGGXXXG-GGXXXGXGXXXXXGG-GXXXXGGXGXGGXXXXXXGXXXXGXXGG 799 G GG GG G GG G GG G GG GG G G GG Sbjct: 58 GGGGISGGGGFGAGGGWIGGSVGGFGGGIGGGFGGGGFGGGAGKGVDGGFGKGVDGG 114 >At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ boundaries domain protein 13 (LBD13) identical to LOB DOMAIN 13 [Arabidopsis thaliana] GI:17227158 SP|Q9AT61 Length = 268 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPP 946 PP P PP PP P P PP P Sbjct: 193 PPPPPPPPTPRPPRLLSSQPAPPPTPPVSLPSP 225 >At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 175 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 PP P P PPP P P P PP P Sbjct: 65 PPPPSPQYSPPPPPSQSSPPRSRCPPVPTTGCCNQPPGP 103 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 28.3 bits (60), Expect = 8.6 Identities = 14/52 (26%), Positives = 14/52 (26%) Frame = +2 Query: 827 PXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXPXXXXXP 982 P P P P PP P P P PP P P P Sbjct: 430 PSPPITVPSPPTTPSPGGSPPSPSIVPSPPSTTPSPGSPPTSPTTPTPGGSP 481 Score = 28.3 bits (60), Expect = 8.6 Identities = 18/59 (30%), Positives = 18/59 (30%), Gaps = 5/59 (8%) Frame = +2 Query: 803 PXXPXXXHPXXXXXXPPXPX-PPXXXXP----PPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P P PP P PP P PP P PP PP P P Sbjct: 546 PPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSPSPPLPPVIP 604 Score = 28.3 bits (60), Expect = 8.6 Identities = 14/40 (35%), Positives = 14/40 (35%), Gaps = 1/40 (2%) Frame = +2 Query: 848 PPXPXPPXXXXPPPXXXXXPXPXXXP-PPXXXPPXXPPXP 964 P P PP PP P P P PP P P P Sbjct: 579 PIIPSPPFTGPSPPSSPSPPLPPVIPSPPIVGPTPSSPPP 618 Score = 28.3 bits (60), Expect = 8.6 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 3/54 (5%) Frame = +2 Query: 812 PXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPP---XXPPXP 964 P P PP P PPP P P PPP PP PP P Sbjct: 713 PQPPPPPHYSLPPPTPTYHYISPPPP-----PTPIHSPPPQSHPPCIEYSPPPP 761 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 28.3 bits (60), Expect = 8.6 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 3/54 (5%) Frame = +2 Query: 812 PXXXHPXXXXXXPPXPX--PPXXXXPPPXXXXXPX-PXXXPPPXXXPPXXPPXP 964 P P PP P PP PPP P P PP P P P Sbjct: 51 PPVMSPMPMMTPPPMPMTPPPMPMTPPPMPMAPPPMPMASPPMMPMTPSTSPSP 104 >At3g60900.1 68416.m06813 fasciclin-like arabinogalactan-protein (FLA10) Length = 422 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/36 (33%), Positives = 12/36 (33%) Frame = +2 Query: 851 PXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPP 958 P P P P P P P P P P PP Sbjct: 339 PAPAPEPVSAPTPTPAKSPSPVEAPSPTAASPPAPP 374 >At3g06130.1 68416.m00704 heavy-metal-associated domain-containing protein contains Pfam heavy metal associated domain PF00403 Length = 473 Score = 28.3 bits (60), Expect = 8.6 Identities = 18/64 (28%), Positives = 18/64 (28%) Frame = -3 Query: 993 AXXXGXXXXXGXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXGGXXXXXXGXXXX 814 A G GG GG GG G GGG GG G G Sbjct: 253 AKNGGKGAPAAGGGGAGGGKGAGGGAKGGPGNQNQGGGKNGGGGHPQDGKNGGGGGGPNA 312 Query: 813 GXXG 802 G G Sbjct: 313 GKKG 316 >At2g26410.1 68415.m03169 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 516 Score = 28.3 bits (60), Expect = 8.6 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 851 PXPXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXPPXP 964 P P PPP P P P P PP PP P Sbjct: 44 PSPSSVHRPYPPPP----PLPDFAPQPLLPPPSPPPPP 77 >At2g16630.1 68415.m01909 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 359 Score = 28.3 bits (60), Expect = 8.6 Identities = 21/70 (30%), Positives = 21/70 (30%), Gaps = 9/70 (12%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXP------PXPXPPXXXXPPPXXXXXPX-PXXXPPPXXXPP--XX 952 PP P HP P P P P PP P P PP PP Sbjct: 167 PPQVPVKPHPKVPVISPDPPATLPPPKVPVISPDPPTTLPPPLVPVINLPPVTSPPQFKL 226 Query: 953 PPXPXXXXXP 982 PP P P Sbjct: 227 PPLPQIPPMP 236 >At1g79480.1 68414.m09263 hypothetical protein low similarity to beta-1,3-glucanase-like protein GI:9758115 from [Arabidopsis thaliana] Length = 356 Score = 28.3 bits (60), Expect = 8.6 Identities = 16/55 (29%), Positives = 17/55 (30%), Gaps = 3/55 (5%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPX---PXPPXXXXPPPXXXXXPXPXXXPPPXXXPPXXP 955 PP +P PP P PP PP P P PP P P Sbjct: 178 PPESSSNPNPPITIPYPPESSSPNPPEIVPSPPESGYTPGPVLGPPYSEPGPSTP 232 >At1g62240.1 68414.m07021 expressed protein Length = 227 Score = 28.3 bits (60), Expect = 8.6 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G GG GG GGG G G G G G G Sbjct: 95 GGGGGGGGGGGGGGGSGGSNGSFFNGSGSGTGYGSGDG 132 >At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 839 Score = 28.3 bits (60), Expect = 8.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 963 GXGGXXGGXXXGGGXXXGXGXXXXXGGGXXXXGGXGXG 850 G GG GG GGG G GGG GG G G Sbjct: 783 GGGGCGGGHHGGGG-----GGCGGCGGGGCGGGGDGGG 815 >At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin family protein similar to arabinogalactan protein [Daucus carota] GI:11322245; contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 359 Score = 28.3 bits (60), Expect = 8.6 Identities = 16/54 (29%), Positives = 16/54 (29%), Gaps = 1/54 (1%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXP-PPXXXPPXXPP 958 PP P P PP P PP P P P PP PP Sbjct: 90 PPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPP 143 Score = 28.3 bits (60), Expect = 8.6 Identities = 16/54 (29%), Positives = 16/54 (29%), Gaps = 1/54 (1%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXP-PPXXXPPXXPP 958 PP P P PP P PP P P P PP PP Sbjct: 110 PPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPP 163 Score = 28.3 bits (60), Expect = 8.6 Identities = 16/54 (29%), Positives = 16/54 (29%), Gaps = 1/54 (1%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXP-PPXXXPPXXPP 958 PP P P PP P PP P P P PP PP Sbjct: 138 PPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPP 191 Score = 28.3 bits (60), Expect = 8.6 Identities = 16/54 (29%), Positives = 16/54 (29%), Gaps = 1/54 (1%) Frame = +2 Query: 800 PPXXPXXXHPXXXXXXPPXPXPPXXXXPPPXXXXXPXPXXXP-PPXXXPPXXPP 958 PP P P PP P PP P P P PP PP Sbjct: 162 PPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPPVSPPTKPP 215 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,720,316 Number of Sequences: 28952 Number of extensions: 317272 Number of successful extensions: 6494 Number of sequences better than 10.0: 132 Number of HSP's better than 10.0 without gapping: 823 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3362 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2479989240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -