BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_H12 (966 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 26 1.9 AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 25 2.6 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 24 5.9 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 25.8 bits (54), Expect = 1.9 Identities = 18/59 (30%), Positives = 19/59 (32%) Frame = +2 Query: 704 PPSXXXPXPXPPPPXPPXPXXXXXPXXXXXRGAGXPPFXXGXLRPPTXXXXXXGGFGXP 880 P + P P PPPP P P AG P RPP GG P Sbjct: 577 PNAQPPPAPPPPPPMGPPPSPL----------AGGPLGGPAGSRPPLPNLLGFGGAAPP 625 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 25.4 bits (53), Expect = 2.6 Identities = 15/61 (24%), Positives = 22/61 (36%) Frame = +2 Query: 569 NXKMVPPNXDGRLRXLRXXPPQEVDPXXSXEARQRQAVSVDIELSPPSXXXPXPXPPPPX 748 N + PP+ + + PP+ + E D + P S P PPPP Sbjct: 625 NNVIPPPSAYQQQQPPVVPPPRTNSQSQASEPTPALPPRADRDSKPSSRDRPKDLPPPPI 684 Query: 749 P 751 P Sbjct: 685 P 685 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 24.2 bits (50), Expect = 5.9 Identities = 11/38 (28%), Positives = 13/38 (34%) Frame = +1 Query: 727 PPPPXXXXPXXPXXXPPXXXXXPXRXXPPLXXGVXPXP 840 PP P P P P P P + G+ P P Sbjct: 211 PPRPGGMYPQPPGVPMPMRPQMPPGAVPGMQPGMQPRP 248 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 710,373 Number of Sequences: 2352 Number of extensions: 11877 Number of successful extensions: 49 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 42 length of database: 563,979 effective HSP length: 65 effective length of database: 411,099 effective search space used: 105241344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -