BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_H12 (966 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 24 1.8 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 23 4.1 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 7.2 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 24.2 bits (50), Expect = 1.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +1 Query: 49 TPLCCSPVRISSALSLSTVHHGRQVRSSLRLH 144 T L CS R LS+S + GR + S R+H Sbjct: 628 TTLTCSVTRGDLPLSISWLKDGRAMGPSERVH 659 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 23.0 bits (47), Expect = 4.1 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 Query: 710 SXXXPXPXPPPPXP 751 S P P PPPP P Sbjct: 335 SDTPPKPAPPPPPP 348 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 22.2 bits (45), Expect = 7.2 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 169 HHRSLGQSDAGEENYELGGHDVL 101 HH+ + AG + L GH VL Sbjct: 920 HHQIQVSTSAGLQTIRLSGHSVL 942 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 208,526 Number of Sequences: 438 Number of extensions: 5001 Number of successful extensions: 13 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 31806957 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -