BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_H04 (984 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0080 + 587674-588510 35 0.11 07_03_1136 + 24218601-24218734,24218769-24219906 34 0.15 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 33 0.35 02_05_0686 - 30900748-30902167,30903442-30904742 32 0.61 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 31 1.1 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 31 1.1 12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-27... 31 1.4 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 30 2.5 08_01_0059 - 394001-394708 30 2.5 07_01_0974 + 8211602-8212051 30 2.5 02_02_0240 + 8196140-8198248,8198381-8198650 30 2.5 09_04_0745 + 19884868-19886000,19886110-19886309,19886422-198866... 30 3.3 07_01_0479 + 3606663-3607448 30 3.3 11_04_0329 - 16442298-16443734 29 4.3 11_03_0171 + 11111534-11113207 29 4.3 11_01_0515 + 4003167-4003229,4003318-4003738,4004224-4004367,400... 29 4.3 11_01_0288 + 2151552-2151581,2151818-2151893,2152019-2153460 29 5.7 08_02_1403 + 26811020-26811146,26813351-26813609,26814932-26814983 29 5.7 06_03_1155 - 28065126-28065139,28065268-28065324,28065571-28066312 29 5.7 06_03_1150 + 28022633-28023374,28023501-28023565 29 5.7 05_07_0236 - 28582157-28582552,28582639-28582911,28583324-285835... 29 5.7 03_06_0758 - 36052261-36052301,36052463-36052697,36052895-360529... 29 5.7 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 29 5.7 03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500,597... 29 5.7 11_01_0359 - 2731522-2732346 29 7.5 09_01_0165 - 2436769-2437442,2438159-2438224,2438318-2438415,243... 29 7.5 07_03_1788 + 29523216-29524867,29525048-29525075 29 7.5 04_04_1500 + 34010819-34011016,34013267-34013308,34014195-340142... 29 7.5 04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 29 7.5 03_01_0515 - 3864796-3865425 29 7.5 04_04_1542 - 34264994-34265331,34266195-34267029 26 8.7 12_01_0580 + 4745639-4746528,4746666-4746747 28 9.9 09_03_0145 - 12749288-12751510 28 9.9 04_01_0500 - 6540769-6541482,6541819-6541877,6541965-6542064,654... 28 9.9 03_02_0234 + 6625417-6626184,6626314-6626339,6626435-6626531,662... 28 9.9 01_06_1377 + 36764461-36765339 28 9.9 01_01_0070 - 542603-542686,542803-543441 28 9.9 >07_01_0080 + 587674-588510 Length = 278 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +2 Query: 734 RGGGGXXFXLX*XTPPPPGXXGFXFXGPPPXSPPXXTPXPP 856 R GG F PPPP G PPP PP P PP Sbjct: 81 RLGGDGMFRRPPPPPPPPPSSGSPPPPPPPPPPPPPPPPPP 121 Score = 29.5 bits (63), Expect = 4.3 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 774 PPPPXGXGGXXFXAPXPXPXPXXPXXPXXXGRXTVP 881 PPPP G P P P P P P R P Sbjct: 95 PPPPPSSGSPPPPPPPPPPPPPPPPPPLFTRRSHAP 130 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = -3 Query: 817 GAXKXKPPXPXGGGGXLXXXKXXPPPPPEXG 725 GA P GG G PPPPP G Sbjct: 72 GAASTSTPPRLGGDGMFRRPPPPPPPPPSSG 102 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 773 TPPPPGXXGFXFXGPPPXSPPXXTPXPP 856 TPP G G PPP PP + PP Sbjct: 78 TPPRLGGDGMFRRPPPPPPPPPSSGSPP 105 >07_03_1136 + 24218601-24218734,24218769-24219906 Length = 423 Score = 34.3 bits (75), Expect = 0.15 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 870 PAPXXGGXGVXXGGEXGGGPXKXNPXXPGGGG 775 P P GG GG GGGP P GGGG Sbjct: 98 PGPLGGGGARPPGGGGGGGPPSLPPGAGGGGG 129 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 4/52 (7%) Frame = -3 Query: 916 PXXGXTXTPLXXGTVXRPXXXGXXGXX----GXGXGXGAXKXKPPXPXGGGG 773 P G PL G P G G G G G GA +PP P GGGG Sbjct: 92 PGGGGAPGPLGGGGARPPGGGGGGGPPSLPPGAGGGGGA---RPPAPGGGGG 140 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = -1 Query: 870 PAPXXGGXGVXXGGEXGGGPXKXNPXXPGGGG 775 P GG G+ GG GG P + GGGG Sbjct: 199 PGGGGGGGGLGGGGGEGGAPERVIGGGGGGGG 230 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/59 (33%), Positives = 20/59 (33%) Frame = +2 Query: 731 FRGGGGXXFXLX*XTPPPPGXXGFXFXGPPPXSPPXXTPXPPXXGAGXXSXXQGGXRLP 907 FRGG PPPP G G PP P P P G GG LP Sbjct: 1169 FRGGTPPPNAHGGVAPPPPPPRGHGGVGGPPTPPGAPAPPMPPGVPGGPPPPPGGRGLP 1227 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 32.3 bits (70), Expect = 0.61 Identities = 19/69 (27%), Positives = 20/69 (28%) Frame = +2 Query: 776 PPPPGXXGFXFXGPPPXSPPXXTPXPPXXGAGXXSXXQGGXRLPXXGXPXKXXPXXXAXX 955 PPPP PPP P P PP G +G P P P Sbjct: 314 PPPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPPGGK 373 Query: 956 KXXVSAPXP 982 K P P Sbjct: 374 KGGPPPPPP 382 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 773 TPPPPGXXGFXFXGPPPXSPPXXTPXPP 856 +PPPP G GPPP P PP Sbjct: 363 SPPPPPPPGGKKGGPPPPPPKGGASRPP 390 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +2 Query: 773 TPPPPGXXGFXFXGPPPXSPPXXTPXPPXXGA 868 +PPPP G PPP P P PP G+ Sbjct: 919 SPPPPRPPGAPPPPPPPGKPGGPPPPPPPPGS 950 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +2 Query: 776 PPPPGXXGFXFXGPPPXSPPXXTPXP 853 PPPP G PPP PP +P P Sbjct: 93 PPPPPPYGVNSSQPPPPPPPPPSPPP 118 Score = 28.3 bits (60), Expect = 9.9 Identities = 21/74 (28%), Positives = 22/74 (29%), Gaps = 2/74 (2%) Frame = +1 Query: 640 GTPXAFXGXPXXPXQKPXSPXPXAXFFXFXVPXXXXXXXXSXLXN--PPPPXXXGVXFXG 813 G P F P P P P F P + PPPP GV Sbjct: 46 GAPPPFLAPPPPPPPGPPPPHQPQFNFGPGPPQQQQPPPPPQMYYQPPPPPPPYGVNSSQ 105 Query: 814 PPXPFPXPXXPXXP 855 PP P P P P Sbjct: 106 PPPP--PPPPPSPP 117 >12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-274702, 274781-274912,275038-276330,279841-280545,280649-280695, 280787-280865 Length = 929 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 776 PPPPGXXGFXFXGPPPXSPPXXTPXPPXXGA 868 PPPP G PPP P P PP G+ Sbjct: 615 PPPPRPPGAPPPPPPPGKPGGPPPPPPRPGS 645 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 776 PPPPGXXGFXFXGPPPXSPPXXTPXP 853 PPPP F PPP PP P P Sbjct: 551 PPPPSGNKPAFSPPPPPPPPPPPPLP 576 Score = 29.1 bits (62), Expect = 5.7 Identities = 16/54 (29%), Positives = 17/54 (31%) Frame = +1 Query: 676 PXQKPXSPXPXAXFFXFXVPXXXXXXXXSXLXNPPPPXXXGVXFXGPPXPFPXP 837 P P P P P + L PPP G F PP P P P Sbjct: 619 PPPPPPPPLPNHSVLPPPPPPPPPPSLPNRLVPPPPAPGIGNKFPAPPPPPPPP 672 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 776 PPPPGXXGFXFXGPPPXSPPXXTPXPP 856 PPPP G PPP PP P PP Sbjct: 751 PPPPLMTGKKAPAPPP--PPPQAPKPP 775 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 Query: 776 PPPPGXXGFXFXGPPPXSPPXXTPXPPXXGAGXXS 880 PPP G F PPP PP + GA S Sbjct: 652 PPPAPGIGNKFPAPPPPPPPPRSSSRTPTGAATSS 686 >08_01_0059 - 394001-394708 Length = 235 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 773 TPPPPGXXGFXFXGPPPXSPPXXTPXPP 856 TPPPP PPP SPP P PP Sbjct: 16 TPPPPPRRA-----PPPPSPPIRPPPPP 38 >07_01_0974 + 8211602-8212051 Length = 149 Score = 30.3 bits (65), Expect = 2.5 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +3 Query: 774 PPP--PXGXGGXXFXAPXPXPXPXXPXXPXXXGRXTVP 881 PPP P G GG P P P P P G T P Sbjct: 50 PPPSSPVGGGGTGGGGPSPPTNPAPPAVPCNCGTTTAP 87 >02_02_0240 + 8196140-8198248,8198381-8198650 Length = 792 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 775 PPPPXXXGVXFXGPPXPFPXPXXPXXP 855 PPPP GPP P+ P P P Sbjct: 620 PPPPPGQNPYMPGPPRPYSMPPPPHMP 646 >09_04_0745 + 19884868-19886000,19886110-19886309,19886422-19886666, 19886880-19887668 Length = 788 Score = 29.9 bits (64), Expect = 3.3 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = +2 Query: 776 PPPPGXXGFXFX--GPPPXSPPXXTPXPPXXGAGXXSXXQG 892 PPPP F F PP PP T P GAG G Sbjct: 58 PPPPPAPFFPFLPDSAPPQLPPPVTTPAPAGGAGDGGTDAG 98 >07_01_0479 + 3606663-3607448 Length = 261 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 776 PPPPGXXGFXFXGPPPXSPPXXTPXPP 856 PPPPG GPPP PP P P Sbjct: 202 PPPPGPF---MRGPPPMGPPQVRPGMP 225 >11_04_0329 - 16442298-16443734 Length = 478 Score = 29.5 bits (63), Expect = 4.3 Identities = 20/60 (33%), Positives = 27/60 (45%) Frame = +1 Query: 88 DRCFS*PRAFSSLRAXXXXXXXXXXXXXYASRLLAIRALVSPTLSYTRTIRRRRSVKNSF 267 DRC + PRA +++ A ASRLLA A +SP + R + NSF Sbjct: 26 DRCAT-PRALAAVHAAMLVSGRLADDAFAASRLLAAHAALSPPGAVLRLLASLPCAPNSF 84 >11_03_0171 + 11111534-11113207 Length = 557 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/41 (39%), Positives = 18/41 (43%) Frame = +2 Query: 785 PGXXGFXFXGPPPXSPPXXTPXPPXXGAGXXSXXQGGXRLP 907 PG GF P +PP + PP AG S GG R P Sbjct: 275 PGLCGFPLQVPCRAAPPSSSTPPPPSAAGSIS-GAGGPRQP 314 >11_01_0515 + 4003167-4003229,4003318-4003738,4004224-4004367, 4004474-4004556,4004661-4004775,4005309-4005400, 4005558-4005612,4005689-4005834,4005888-4006001, 4006149-4006342,4006985-4007112,4008526-4008583, 4009800-4009876,4010214-4010263,4010336-4010515, 4010633-4010731,4010816-4011133,4011221-4011281, 4011693-4012781,4012951-4013005,4013133-4013291, 4013923-4014442 Length = 1406 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +2 Query: 812 GPP-PXSPPXXTPXPPXXGAGXXSXXQG 892 GPP P SPP P PP G G S G Sbjct: 103 GPPVPGSPPAAAPVPPSGGWGRPSDRAG 130 >11_01_0288 + 2151552-2151581,2151818-2151893,2152019-2153460 Length = 515 Score = 29.1 bits (62), Expect = 5.7 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 870 PAPXXGGXGVXXGGEXGGGPXKXNPXXPGGGG 775 P P GG G GG GGG N GGGG Sbjct: 244 PPPNAGGGGDKKGGNNGGG--AGNGGKKGGGG 273 >08_02_1403 + 26811020-26811146,26813351-26813609,26814932-26814983 Length = 145 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 776 PPPPGXXGFXFXGPPPXSPPXXTP 847 PPPPG G+ G P PP P Sbjct: 85 PPPPGYQGYFNQGQQPYYPPPPLP 108 >06_03_1155 - 28065126-28065139,28065268-28065324,28065571-28066312 Length = 270 Score = 29.1 bits (62), Expect = 5.7 Identities = 21/74 (28%), Positives = 21/74 (28%), Gaps = 1/74 (1%) Frame = +1 Query: 661 GXPXXPXQKPXSPXPXAXFFXFXVPXXXXXXXXSXLXNPPPPXXXGVXFXGP-PXPFPXP 837 G P P P P P F P PP G F P P PFP P Sbjct: 56 GAPTLPGL-PGLPFPLFPFLTLPFPLIPIGGSSGGGGAAPPSAGSGFRFPFPLPLPFPAP 114 Query: 838 XXPXXPXXXGGXXF 879 P G F Sbjct: 115 ASPGGAPPSSGSGF 128 >06_03_1150 + 28022633-28023374,28023501-28023565 Length = 268 Score = 29.1 bits (62), Expect = 5.7 Identities = 21/74 (28%), Positives = 21/74 (28%), Gaps = 1/74 (1%) Frame = +1 Query: 661 GXPXXPXQKPXSPXPXAXFFXFXVPXXXXXXXXSXLXNPPPPXXXGVXFXGP-PXPFPXP 837 G P P P P P F P PP G F P P PFP P Sbjct: 56 GAPTLPGL-PGLPFPLFPFLTLPFPLIPIGGSSGGGGAAPPSAGSGFRFPFPLPLPFPAP 114 Query: 838 XXPXXPXXXGGXXF 879 P G F Sbjct: 115 ASPGGAPPSSGSGF 128 >05_07_0236 - 28582157-28582552,28582639-28582911,28583324-28583560, 28583653-28583694,28583782-28583964,28584393-28584524, 28585605-28586057 Length = 571 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 776 PPPPGXXGFXFXGPPPXSPPXXTPXPP 856 PPP G PPP PP P P Sbjct: 98 PPPSSGSGHTLPSPPPPLPPLLPPPQP 124 >03_06_0758 - 36052261-36052301,36052463-36052697,36052895-36052966, 36056477-36056567,36056650-36056872,36056964-36057300, 36057406-36057588 Length = 393 Score = 29.1 bits (62), Expect = 5.7 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 734 RGGGGXXFXLX*XTPPPPGXXGFXFXGPPPXSPPXXTPXP 853 RGGGG F P P G PPP P P P Sbjct: 117 RGGGGGGFDALYRAPIGPYVRGATAPPPPPPPPMAVAPPP 156 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 29.1 bits (62), Expect = 5.7 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 4/52 (7%) Frame = +2 Query: 779 PPPGXXGFXFXGPPPX---SPPXXTPXPPXXGAGXXSXXQGG-XRLPXXGXP 922 PPP G PPP PP P PP G + G R P G P Sbjct: 296 PPPPVGGTQPPPPPPPLANGPPRSIPPPPMTGGAMANFTPGAPPRPPMQGFP 347 >03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500, 5975189-5976914,5977065-5977620,5978008-5978485 Length = 998 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/28 (46%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +2 Query: 776 PPPPGXXGFXFXGP-PPXSPPXXTPXPP 856 PPPP F PP SPP +P PP Sbjct: 71 PPPPRPPSFAPENALPPSSPPPPSPPPP 98 >11_01_0359 - 2731522-2732346 Length = 274 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +2 Query: 776 PPPPGXXGFXFXGPPPXSPPXXTPXPP 856 PPPP + PP PP P PP Sbjct: 52 PPPPPPHAYHHHHYPPPPPPHHHPYPP 78 >09_01_0165 - 2436769-2437442,2438159-2438224,2438318-2438415, 2439856-2440214 Length = 398 Score = 28.7 bits (61), Expect = 7.5 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 773 TPPPPGXXGFXFXGPPPXSPPXXTPXPPXXGA 868 +PPPPG PP PP P PP GA Sbjct: 243 SPPPPGQGPVLPRDAPPMPPP---PSPPNPGA 271 >07_03_1788 + 29523216-29524867,29525048-29525075 Length = 559 Score = 28.7 bits (61), Expect = 7.5 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +2 Query: 779 PPPGXXGFXFXGPPPXSPPXXTPXP-PXXGAGXXSXXQGG 895 PP G PPP PP P P P GAG + G Sbjct: 18 PPKRGRGRPRKNPPPPPPPATDPNPHPPSGAGAGAGAGAG 57 >04_04_1500 + 34010819-34011016,34013267-34013308,34014195-34014204, 34014526-34014586,34014621-34014678,34015266-34015412, 34015643-34016205,34018942-34019728 Length = 621 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +3 Query: 234 NQKTKKCEEFIYGGCQGNDNRFITLAECEQK 326 N KTK CE F+ G C D E EQ+ Sbjct: 587 NYKTKLCENFVKGTCTFGDRCHFAHGENEQR 617 >04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 Length = 906 Score = 28.7 bits (61), Expect = 7.5 Identities = 19/70 (27%), Positives = 21/70 (30%) Frame = +1 Query: 661 GXPXXPXQKPXSPXPXAXFFXFXVPXXXXXXXXSXLXNPPPPXXXGVXFXGPPXPFPXPX 840 G P P P +P P P + PPPP PP P P P Sbjct: 319 GAPPPPPAHPAAPAPPP-------PAPSPSAAGAGSGPPPPPPPAAPAAPRPPGPGPGPP 371 Query: 841 XPXXPXXXGG 870 P GG Sbjct: 372 PPPGAAGRGG 381 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 Query: 776 PPPPGXXGFXFXGPPPXSPP 835 PPPPG G GPPP + P Sbjct: 371 PPPPGAAGRGGGGPPPPALP 390 >03_01_0515 - 3864796-3865425 Length = 209 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 775 PPPPXXXGVXFXGPPXPFPXPXXP 846 PPPP V PP P P P P Sbjct: 71 PPPPPPPSVTSSPPPPPLPPPPPP 94 >04_04_1542 - 34264994-34265331,34266195-34267029 Length = 390 Score = 25.8 bits (54), Expect(2) = 8.7 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 773 TPPPPGXXGFXFXGPPPXSPP 835 TPPPP PPP SPP Sbjct: 216 TPPPP-PLALPLPPPPPPSPP 235 Score = 21.0 bits (42), Expect(2) = 8.7 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = +2 Query: 815 PPPXSPPXXTPXPP 856 PPP PP PP Sbjct: 254 PPPQPPPSSLQLPP 267 >12_01_0580 + 4745639-4746528,4746666-4746747 Length = 323 Score = 28.3 bits (60), Expect = 9.9 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = +2 Query: 83 VAIGAFPNHGLSLRCVLDVSHE**ANNEADMRAGFWQFGPLFRLH 217 + +GA+P H L LRCV ++S E +++A W RLH Sbjct: 279 ITVGAYPGHRLQLRCV-ELSRE----KFGEVKARVWWEENKARLH 318 >09_03_0145 - 12749288-12751510 Length = 740 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 Query: 775 PPPPXXXGVXFXGPPXPFP 831 PPPP G+ PP PFP Sbjct: 41 PPPPALPGMPHGRPPPPFP 59 >04_01_0500 - 6540769-6541482,6541819-6541877,6541965-6542064, 6542113-6542322,6542507-6542765,6544022-6544215 Length = 511 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -3 Query: 817 GAXKXKPPXPXGGGGXLXXXKXXPPPPP 734 GA + PP P G L PPPPP Sbjct: 27 GAGEPPPPLPPPPPGPLQRRSSLPPPPP 54 >03_02_0234 + 6625417-6626184,6626314-6626339,6626435-6626531, 6627009-6627116,6627194-6627328,6627429-6627528, 6627763-6627974,6628060-6628125,6628231-6628464, 6628583-6628641,6628716-6628782,6628863-6629192, 6629267-6629335,6629417-6629503,6629605-6629692, 6630057-6630178,6630251-6630355,6630442-6630485, 6630558-6630627,6630711-6630814,6630980-6631189, 6632935-6633018,6633291-6634003,6634115-6634649, 6634703-6634789,6634826-6634970,6635049-6635125, 6635215-6635359,6635462-6635626,6635725-6635958 Length = 1761 Score = 28.3 bits (60), Expect = 9.9 Identities = 15/32 (46%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = +2 Query: 779 PPPGXXGFXFXGPPPXSPPXXTP-XPPXXGAG 871 PPPG PPP SPP TP PP +G Sbjct: 1150 PPPGS------SPPPASPPPSTPSAPPTNSSG 1175 >01_06_1377 + 36764461-36765339 Length = 292 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +2 Query: 779 PPPGXXGFXFXGPPPXSPPXXTPXPPXXGA 868 PPP + F PPP P P PP G+ Sbjct: 163 PPPSSSPYYF--PPPPPPAYSAPPPPQYGS 190 >01_01_0070 - 542603-542686,542803-543441 Length = 240 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 773 TPPPPGXXGFXFXGPPPXSPPXXTPXP 853 TPPPP PPP +PP TP P Sbjct: 81 TPPPPTPKKAP---PPPVTPPPVTPPP 104 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,770,755 Number of Sequences: 37544 Number of extensions: 499277 Number of successful extensions: 3700 Number of sequences better than 10.0: 37 Number of HSP's better than 10.0 without gapping: 1634 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3040 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2870111300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -