BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_H02 (886 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1783 + 29480987-29481165,29481526-29481685,29481767-294818... 34 0.17 03_01_0436 + 3384526-3385236,3387857-3388720 28 8.7 >07_03_1783 + 29480987-29481165,29481526-29481685,29481767-29481862, 29481948-29482062,29482175-29482337,29482536-29482707, 29483924-29484013,29484137-29484598,29484675-29485268, 29485486-29485554,29485810-29485902,29486432-29486677, 29487277-29487417,29487748-29487828,29487911-29487973, 29488059-29488166,29488303-29488383,29488474-29488521, 29488979-29489053,29489973-29490068,29490156-29490236, 29490295-29490402,29490989-29491033,29491119-29491202, 29491379-29491482,29491581-29491728 Length = 1233 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/48 (37%), Positives = 25/48 (52%) Frame = +3 Query: 219 PLDLDPALSFCTHLLYGYAGIQPDTYKLVSLNENLDIDRTHDNYRAIT 362 PL+LDP H+L Y + TY LV + +D HDNY+ I+ Sbjct: 679 PLELDPWELLQKHVLSDYVNNENATY-LVDWQRKIILDNYHDNYKNIS 725 >03_01_0436 + 3384526-3385236,3387857-3388720 Length = 524 Score = 28.3 bits (60), Expect = 8.7 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Frame = +3 Query: 237 ALSFCTHLLYGYAGIQPDTYKLVSLNENLDIDRTHDNYR--AITSLKAKYPGLTVLLS 404 A+ HLL +A +TY LV EN+ ++ NYR +T+ + G VLLS Sbjct: 228 AIDLAKHLLQVHA----ETYALVVSTENITLNAYMGNYRPMLVTNTLFRMGGAAVLLS 281 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,161,856 Number of Sequences: 37544 Number of extensions: 383946 Number of successful extensions: 861 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 834 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 859 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2503236492 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -