SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP01_F_H01
         (900 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ850291-1|CAH64511.1|  533|Tribolium castaneum putative esteras...    23   4.3  
AJ850290-1|CAH64510.1|  533|Tribolium castaneum putative esteras...    23   4.3  
S73225-1|AAB30811.1|  327|Tribolium castaneum protein ( Triboliu...    21   9.9  

>AJ850291-1|CAH64511.1|  533|Tribolium castaneum putative esterase
           protein.
          Length = 533

 Score = 22.6 bits (46), Expect = 4.3
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = -3

Query: 586 NFTNKAFFSLH 554
           NF NKAFF  H
Sbjct: 20  NFNNKAFFCFH 30


>AJ850290-1|CAH64510.1|  533|Tribolium castaneum putative esterase
           protein.
          Length = 533

 Score = 22.6 bits (46), Expect = 4.3
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = -3

Query: 586 NFTNKAFFSLH 554
           NF NKAFF  H
Sbjct: 20  NFNNKAFFCFH 30


>S73225-1|AAB30811.1|  327|Tribolium castaneum protein ( Tribolium
           castaneum homeodomainprotein mRNA, complete cds. ).
          Length = 327

 Score = 21.4 bits (43), Expect = 9.9
 Identities = 11/40 (27%), Positives = 17/40 (42%)
 Frame = +3

Query: 222 DCENPEVHDFVDHVGPCDVPQCFCDRPNVRNTKTGKCVPE 341
           D  N  +   +D++   D  +   D  N+R  K    VPE
Sbjct: 122 DASNGNLKFSIDNILKADFGRRITDPINIRKCKPKTVVPE 161


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 160,392
Number of Sequences: 336
Number of extensions: 3232
Number of successful extensions: 9
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 122,585
effective HSP length: 57
effective length of database: 103,433
effective search space used: 25030786
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -