BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_H01 (900 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370036-1|ABD18597.1| 103|Anopheles gambiae putative TIL domai... 36 0.001 DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domai... 33 0.012 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 31 0.063 DQ370046-1|ABD18607.1| 125|Anopheles gambiae putative secreted ... 29 0.19 DQ370039-1|ABD18600.1| 168|Anopheles gambiae putative TIL domai... 29 0.25 DQ370042-1|ABD18603.1| 194|Anopheles gambiae putative TIL domai... 27 0.59 AY578797-1|AAT07302.1| 304|Anopheles gambiae activin protein. 25 3.1 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 25 4.1 AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 23 9.6 AF457552-1|AAL68782.1| 311|Anopheles gambiae D7 protein long fo... 23 9.6 >DQ370036-1|ABD18597.1| 103|Anopheles gambiae putative TIL domain protein protein. Length = 103 Score = 36.3 bits (80), Expect = 0.001 Identities = 22/62 (35%), Positives = 25/62 (40%) Frame = +3 Query: 165 RKCPKGEHSVLYCPQMAEPDCENPEVHDFVDHVGPCDVPQCFCDRPNVRNTKTGKCVPES 344 R C K E V C EP C PE D C V CFC + VR G C+ Sbjct: 36 RTCRKNEEFVC-CGPCVEPTCSKPEPD--ADCTNVC-VAGCFCKKNYVRRAIGGSCIWAK 91 Query: 345 EC 350 +C Sbjct: 92 KC 93 >DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domain protein protein. Length = 285 Score = 33.1 bits (72), Expect = 0.012 Identities = 27/81 (33%), Positives = 37/81 (45%), Gaps = 3/81 (3%) Frame = +3 Query: 105 LYLLF-VVAAVGYVTGXHFPTRKCPKGE--HSVLYCPQMAEPDCENPEVHDFVDHVGPCD 275 L L+F V+ +G + R+CPK E CPQ A C + + V C Sbjct: 3 LLLVFSVLLFIGSLEASRCVHRRCPKNEVYSCCAPCPQKA---C----ISEAVKCQTSC- 54 Query: 276 VPQCFCDRPNVRNTKTGKCVP 338 +P C C + VR T+ G CVP Sbjct: 55 LPGCVCKKGFVRETQFGNCVP 75 Score = 27.5 bits (58), Expect = 0.59 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 285 CFCDRPNVRNTKTGKCVPESEC 350 C C + VR T+ GKC+P C Sbjct: 95 CVCKKGFVRKTEFGKCIPLRLC 116 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 30.7 bits (66), Expect = 0.063 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -2 Query: 899 GGXXXXXGGXGXXPGPXGXGXXXXGGXGXRXXXXEXPXAGGXGGGXXG 756 GG GG PGP G G R E G GGG G Sbjct: 209 GGAPGGGGGSSGGPGPGGGGGGGGRDRDHRDRDREREGGGNGGGGGGG 256 >DQ370046-1|ABD18607.1| 125|Anopheles gambiae putative secreted polypeptide protein. Length = 125 Score = 29.1 bits (62), Expect = 0.19 Identities = 18/64 (28%), Positives = 28/64 (43%) Frame = +3 Query: 159 PTRKCPKGEHSVLYCPQMAEPDCENPEVHDFVDHVGPCDVPQCFCDRPNVRNTKTGKCVP 338 PT++CP E C + +C +D G C +C+C VR G+C+P Sbjct: 51 PTKECPPDE-VFKCCGPCYQLNCYGT----VLDCAGRC-YAECYCASGFVREYPGGRCIP 104 Query: 339 ESEC 350 + C Sbjct: 105 KLFC 108 >DQ370039-1|ABD18600.1| 168|Anopheles gambiae putative TIL domain polypeptide protein. Length = 168 Score = 28.7 bits (61), Expect = 0.25 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 285 CFCDRPNVRNTKTGKCVPE 341 CFC VR +K GKC+P+ Sbjct: 70 CFCKPGFVRESKEGKCIPK 88 >DQ370042-1|ABD18603.1| 194|Anopheles gambiae putative TIL domain polypeptide protein. Length = 194 Score = 27.5 bits (58), Expect = 0.59 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +3 Query: 285 CFCDRPNVRNTKTGKCVPESEC 350 CFC +R++ G C+P + C Sbjct: 172 CFCKPSYIRSSDGGPCIPTNNC 193 >AY578797-1|AAT07302.1| 304|Anopheles gambiae activin protein. Length = 304 Score = 25.0 bits (52), Expect = 3.1 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 827 GGXGXRXXXXEXPXAGGXGGGXXGRG 750 GG G R AGG GGG G G Sbjct: 234 GGAGNRGLGKMHHKAGGGGGGGAGGG 259 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 24.6 bits (51), Expect = 4.1 Identities = 13/42 (30%), Positives = 14/42 (33%) Frame = -2 Query: 878 GGXGXXPGPXGXGXXXXGGXGXRXXXXEXPXAGGXGGGXXGR 753 GG P P G + P GG GGG GR Sbjct: 498 GGRPNAPNPSSAVTPGGGRAEGDKVTFQIPNGGGGGGGGGGR 539 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 23.4 bits (48), Expect = 9.6 Identities = 18/62 (29%), Positives = 19/62 (30%), Gaps = 2/62 (3%) Frame = -2 Query: 878 GGXGXXPGPXGXGXXXXGGXGXRXXXXEXPXAGGXGGGXXG--RGPNXQTAXPGGXAXSX 705 G G G G GG G GG GGG G G + A G S Sbjct: 60 GDDGYGGGGRGGRGGRGGGRGRGRGRGGRDGGGGFGGGGYGDRNGDGGRPAYSGNSDPSM 119 Query: 704 XQ 699 Q Sbjct: 120 DQ 121 >AF457552-1|AAL68782.1| 311|Anopheles gambiae D7 protein long form protein. Length = 311 Score = 23.4 bits (48), Expect = 9.6 Identities = 16/64 (25%), Positives = 25/64 (39%) Frame = -2 Query: 212 HLRAIQN*MFTFRAFSRWKMXPGDVTDSCHNKQQIQIKLFXANXXFHNARTNDPKXLRXP 33 HL + N + + WK+ P D C+ +K A ++ +TN K P Sbjct: 41 HLPSGPNRETYLKTWKFWKLEPNDAVTHCY------VKCTLAGLQMYDEKTNTFKPETVP 94 Query: 32 VXGE 21 V E Sbjct: 95 VQHE 98 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 697,741 Number of Sequences: 2352 Number of extensions: 14143 Number of successful extensions: 74 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 73 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 97160985 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -