BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_G21 (932 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 42 9e-06 X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. 24 1.5 AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. 24 1.9 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 41.5 bits (93), Expect = 9e-06 Identities = 22/64 (34%), Positives = 33/64 (51%) Frame = +1 Query: 331 LPKNLEFSIFYEKMREEAIALFKLFYYAKDFECFYKTACYARVYMNQXMFLYAYYIAIIQ 510 L ++ FS+F K R A L +F ++ + A YAR +N +F YA +AI+ Sbjct: 74 LERDANFSLFIPKHRRIAGRLIDIFLGMRNVDDLLSVAVYARDRVNPYLFSYALSVAILH 133 Query: 511 RSDT 522 R DT Sbjct: 134 RQDT 137 >X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. Length = 251 Score = 24.2 bits (50), Expect = 1.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -2 Query: 448 SMLFCRNIQNLWHNRTA*TARWLLPS 371 S FC N+Q + N+ + T W LP+ Sbjct: 205 SYQFCDNLQYSFDNQCSGTIDWALPN 230 >AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. Length = 246 Score = 23.8 bits (49), Expect = 1.9 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -2 Query: 448 SMLFCRNIQNLWHNRTA*TARWLLP 374 S FC N+Q + N+ + T W LP Sbjct: 196 SYQFCDNLQYSFDNQCSGTIDWALP 220 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,417 Number of Sequences: 336 Number of extensions: 3027 Number of successful extensions: 15 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 26168549 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -