BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_G16 (950 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC584.04 |sup35|erf3|translation release factor eRF3 |Schizosa... 27 3.9 SPAC32A11.02c |||conserved fungal protein|Schizosaccharomyces po... 27 3.9 SPAC6G9.10c |sen1||ATP-dependent 5' to 3' DNA/RNA helicase Sen1|... 27 5.1 >SPCC584.04 |sup35|erf3|translation release factor eRF3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 662 Score = 27.1 bits (57), Expect = 3.9 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +1 Query: 127 PRHSTTMARHIGRITITT-PSVLTFGKACWTHI 222 P H+TT R I +I I PS+LT G +C HI Sbjct: 553 PVHATT--RFIAQIAILELPSILTTGYSCVMHI 583 >SPAC32A11.02c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 851 Score = 27.1 bits (57), Expect = 3.9 Identities = 16/65 (24%), Positives = 31/65 (47%) Frame = +3 Query: 201 ESMLDTHSLWSNLANEMQHLDNMMKELSLKFPSIINEGRVEGDKYQISIHLPGYEQKDIN 380 E + + +W+++ +MQ D ++L F I N G++ Q +I L G + ++ Sbjct: 104 EGSTNVNEVWNDITEDMQSQDFSTEDLKQLFLLIFNNGKLR-TLLQNAIVLLGQQTTNVA 162 Query: 381 VKAKN 395 K N Sbjct: 163 SKKLN 167 >SPAC6G9.10c |sen1||ATP-dependent 5' to 3' DNA/RNA helicase Sen1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1687 Score = 26.6 bits (56), Expect = 5.1 Identities = 18/52 (34%), Positives = 28/52 (53%) Frame = +3 Query: 165 YHHYDPFSPYVRESMLDTHSLWSNLANEMQHLDNMMKELSLKFPSIINEGRV 320 + Y F +E +T S + NL E+++L NM+ EL KFP + GR+ Sbjct: 1484 FTQYRLFDVRGKERTSNTMSTY-NL-EEVEYLVNMVDELLNKFPDVNFTGRI 1533 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,057,791 Number of Sequences: 5004 Number of extensions: 57745 Number of successful extensions: 193 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 168 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 190 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 485316198 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -