BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_G16 (950 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CY... 26 1.9 AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CY... 25 3.4 AF316637-1|AAG45165.1| 224|Anopheles gambiae glutathione S-tran... 25 4.4 AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CY... 24 5.9 >AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CYPm3r10 protein. Length = 441 Score = 25.8 bits (54), Expect = 1.9 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +3 Query: 246 EMQHLDNMMKELSLKFPSIINEGRVEGDKYQI 341 EM +LD ++KE K+P + R +YQ+ Sbjct: 292 EMNYLDQILKESLRKYPPVPVHFRETSKEYQV 323 >AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CYP6M1 protein. Length = 503 Score = 25.0 bits (52), Expect = 3.4 Identities = 9/33 (27%), Positives = 20/33 (60%) Frame = +3 Query: 243 NEMQHLDNMMKELSLKFPSIINEGRVEGDKYQI 341 ++M++LD ++KE K+P + R+ Y++ Sbjct: 350 HDMKYLDQILKESLRKYPPVPMHFRMTAQDYRV 382 >AF316637-1|AAG45165.1| 224|Anopheles gambiae glutathione S-transferase D8 protein. Length = 224 Score = 24.6 bits (51), Expect = 4.4 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +3 Query: 171 HYDPFSPYVRESMLDTHSLWSNLANEMQHLDNMMKELSLK 290 +Y P SPY R ML +L L+ +Q +D +MK+ L+ Sbjct: 4 YYHPASPYCRSVMLVAKAL--KLSLNLQFVD-LMKDEQLR 40 >AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CYPm3r9 protein. Length = 499 Score = 24.2 bits (50), Expect = 5.9 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +3 Query: 246 EMQHLDNMMKELSLKFPSIINEGRVEGDKYQISIHLPG 359 EM++LD ++ E K+P + RV Y H+PG Sbjct: 352 EMKYLDQILNESLRKYPPVPVHLRVASKDY----HVPG 385 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 794,817 Number of Sequences: 2352 Number of extensions: 15497 Number of successful extensions: 103 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 99 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 103 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 104189652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -