BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_G14 (934 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g10520.1 68414.m01184 DNA polymerase lambda (POLL) identical ... 31 1.4 At1g67220.1 68414.m07651 zinc finger protein-related similar to ... 29 3.3 At5g48385.1 68418.m05980 expressed protein 29 5.8 At5g47280.1 68418.m05829 disease resistance protein (NBS-LRR cla... 29 5.8 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 28 7.7 >At1g10520.1 68414.m01184 DNA polymerase lambda (POLL) identical to DNA polymerase lambda GI:12053869 from [Arabidopsis thaliana] Length = 529 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/73 (23%), Positives = 39/73 (53%), Gaps = 1/73 (1%) Frame = +1 Query: 229 LWLYQG-DNVPRAPSTADHPILPSKIDDVQLDPNRRYVRSVTNPENNEASIEHSHHTVDI 405 L LYQ ++ + A+ + KID ++D ++ + +++ E+ + + + ++ D Sbjct: 86 LMLYQWLEDSLTSGEKANEDLYVLKIDSEEVDKPKKSLPAISGSEDQSSPQKRTRYSPDA 145 Query: 406 GLDQPIESHRNTR 444 G + +ESH NT+ Sbjct: 146 GDFKGVESHSNTQ 158 >At1g67220.1 68414.m07651 zinc finger protein-related similar to SP|Q09472 E1A-associated protein p300 {Homo sapiens}, SP|Q92793 CREB-binding protein {Homo sapiens}; contains Pfam profiles PF00569: Zinc finger ZZ type, PF00628: PHD-finger, PF02135: TAZ zinc finger Length = 1357 Score = 29.5 bits (63), Expect = 3.3 Identities = 19/70 (27%), Positives = 31/70 (44%), Gaps = 2/70 (2%) Frame = +2 Query: 317 SIQTEGMFAVSPIQKITRRPLNIHIIQLILDLTSRSRATVTQGTCGFCTLEGNCLF--QR 490 S+Q AVS +++ T + +H I+ L S + +G C E +C Sbjct: 596 SLQKRSKRAVSLVERFTEEEIKLH----IMSLKKPSTQSAVEGMCDLKEEEESCQLCDDG 651 Query: 491 FLRFNPKPIY 520 L F P+P+Y Sbjct: 652 TLLFPPQPLY 661 >At5g48385.1 68418.m05980 expressed protein Length = 558 Score = 28.7 bits (61), Expect = 5.8 Identities = 19/68 (27%), Positives = 29/68 (42%), Gaps = 1/68 (1%) Frame = -1 Query: 469 LEGTKTAGPLCYGGSRSAGQVQYQLYDVNVQWTPRYFLDW*HCE-HTFGLDRAARRRFSK 293 +E T++ L S Q+Q ++ Q L W E H GL+R+ +RRF + Sbjct: 1 MEDTRSVASLMDSTSSKIQQLQKAFAELESQRAVTLNLKWKELEEHFHGLERSLKRRFHE 60 Query: 292 EESDGLRY 269 E Y Sbjct: 61 LEDQEKEY 68 >At5g47280.1 68418.m05829 disease resistance protein (NBS-LRR class), putative domain signature NBS-LRR exists, suggestive of a disease resistance protein. Length = 623 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = -2 Query: 222 LASLSHCTCYRALCWRWPEGRLDEPLARSLSKEQHQN*T 106 L SL + TCYR W W E P R + E+ N T Sbjct: 581 LTSLCYVTCYREALWMWKEVEKAVPGLRIEATEKWFNMT 619 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 28.3 bits (60), Expect = 7.7 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +1 Query: 796 PPPFXVXPPDNXXXFPPXPTP 858 PPP+ PP +PP P+P Sbjct: 420 PPPYVYPPPPPPYVYPPPPSP 440 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,088,691 Number of Sequences: 28952 Number of extensions: 364648 Number of successful extensions: 1141 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 948 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1133 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2227127592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -