BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_G11 (998 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q01I59 Cluster: H0315A08.9 protein; n=3; Oryza sativa|R... 41 0.057 UniRef50_Q8L685 Cluster: Pherophorin-dz1 protein precursor; n=1;... 40 0.076 UniRef50_Q3HTL0 Cluster: Pherophorin-V1 protein precursor; n=1; ... 40 0.100 UniRef50_Q01AC1 Cluster: Meltrins, fertilins and related Zn-depe... 40 0.100 UniRef50_P12978 Cluster: Epstein-Barr nuclear antigen 2; n=2; Hu... 40 0.13 UniRef50_UPI0000DA3E0C Cluster: PREDICTED: similar to tumor endo... 39 0.17 UniRef50_Q4THH6 Cluster: Chromosome undetermined SCAF2934, whole... 39 0.23 UniRef50_Q4A2U1 Cluster: Putative membrane protein precursor; n=... 39 0.23 UniRef50_Q3HTK4 Cluster: Pherophorin-C3 protein precursor; n=1; ... 39 0.23 UniRef50_Q4U2V7 Cluster: Hydroxyproline-rich glycoprotein GAS31 ... 38 0.31 UniRef50_A7DWG3 Cluster: Cell wall glycoprotein GP2; n=4; Chlamy... 38 0.31 UniRef50_A4S9A6 Cluster: Predicted protein; n=1; Ostreococcus lu... 38 0.31 UniRef50_P21997 Cluster: Sulfated surface glycoprotein 185 precu... 38 0.31 UniRef50_Q4A2Z7 Cluster: Putative membrane protein precursor; n=... 38 0.40 UniRef50_A6UHC7 Cluster: Outer membrane autotransporter barrel d... 38 0.40 UniRef50_Q852P0 Cluster: Pherophorin; n=2; Eukaryota|Rep: Pherop... 38 0.40 UniRef50_P93797 Cluster: Pherophorin-S precursor; n=1; Volvox ca... 38 0.40 UniRef50_Q5CS67 Cluster: Signal peptide containing large protein... 38 0.40 UniRef50_Q581C6 Cluster: Flagellum-adhesion glycoprotein, putati... 38 0.40 UniRef50_UPI0000DB6CCB Cluster: PREDICTED: hypothetical protein;... 38 0.53 UniRef50_Q948Y7 Cluster: VMP3 protein; n=1; Volvox carteri f. na... 38 0.53 UniRef50_Q42421 Cluster: Chitinase; n=1; Beta vulgaris subsp. vu... 38 0.53 UniRef50_Q3HTK5 Cluster: Pherophorin-C2 protein precursor; n=8; ... 38 0.53 UniRef50_A7SGL4 Cluster: Predicted protein; n=1; Nematostella ve... 38 0.53 UniRef50_A0VF81 Cluster: Putative uncharacterized protein; n=4; ... 37 0.70 UniRef50_Q9LUI1 Cluster: Extensin protein-like; n=10; Magnolioph... 37 0.70 UniRef50_Q9FXA1 Cluster: F14J22.4 protein; n=2; Arabidopsis thal... 37 0.70 UniRef50_Q010M7 Cluster: Predicted membrane protein; n=3; Eukary... 37 0.70 UniRef50_A4S6G3 Cluster: Predicted protein; n=2; Eukaryota|Rep: ... 37 0.70 UniRef50_P40602 Cluster: Anter-specific proline-rich protein APG... 37 0.70 UniRef50_Q4A373 Cluster: Putative lectin protein precursor; n=1;... 37 0.93 UniRef50_Q8PPF4 Cluster: Putative uncharacterized protein XAC073... 37 0.93 UniRef50_Q948Y6 Cluster: VMP4 protein; n=1; Volvox carteri f. na... 37 0.93 UniRef50_Q6H7U3 Cluster: Putative formin I2I isoform; n=2; Oryza... 37 0.93 UniRef50_A7QGU9 Cluster: Chromosome chr16 scaffold_94, whole gen... 37 0.93 UniRef50_A5BAX2 Cluster: Putative uncharacterized protein; n=1; ... 37 0.93 UniRef50_Q9S8M0 Cluster: Chitin-binding lectin 1 precursor; n=1;... 37 0.93 UniRef50_Q8YQB7 Cluster: All3916 protein; n=2; Nostocaceae|Rep: ... 36 1.2 UniRef50_Q2N5D9 Cluster: Autotransporter; n=1; Erythrobacter lit... 36 1.2 UniRef50_Q3HTK2 Cluster: Pherophorin-C5 protein precursor; n=1; ... 36 1.2 UniRef50_Q9P6T1 Cluster: Putative uncharacterized protein 15E6.2... 36 1.2 UniRef50_Q4A2S6 Cluster: Putative membrane protein precursor; n=... 36 1.6 UniRef50_Q3UHZ5 Cluster: 17 days embryo heart cDNA, RIKEN full-l... 36 1.6 UniRef50_Q62CV6 Cluster: Hemagglutinin domain protein; n=8; Burk... 36 1.6 UniRef50_Q56B20 Cluster: Cell surface antigen Sca2-6; n=4; Ricke... 36 1.6 UniRef50_Q9SRL3 Cluster: F9F8.15 protein; n=13; Magnoliophyta|Re... 36 1.6 UniRef50_Q1EP07 Cluster: Putative uncharacterized protein; n=1; ... 36 1.6 UniRef50_Q01DC8 Cluster: Plg protein; n=2; Eukaryota|Rep: Plg pr... 36 1.6 UniRef50_Q013S1 Cluster: Chromosome 08 contig 1, DNA sequence; n... 36 1.6 UniRef50_A3BQ84 Cluster: Putative uncharacterized protein; n=1; ... 36 1.6 UniRef50_Q0U6P9 Cluster: Predicted protein; n=1; Phaeosphaeria n... 36 1.6 UniRef50_A3LN86 Cluster: Protein involved in actin organization ... 36 1.6 UniRef50_P21260 Cluster: Uncharacterized proline-rich protein; n... 36 1.6 UniRef50_Q8N3X1 Cluster: Formin-binding protein 4; n=28; Eumetaz... 36 1.6 UniRef50_Q9S740 Cluster: Lysine-rich arabinogalactan protein 19 ... 36 1.6 UniRef50_UPI0000F205BB Cluster: PREDICTED: similar to formin 2; ... 36 2.2 UniRef50_Q65553 Cluster: UL36; n=5; Varicellovirus|Rep: UL36 - B... 36 2.2 UniRef50_Q013M1 Cluster: Chromosome 08 contig 1, DNA sequence; n... 36 2.2 UniRef50_Q560V3 Cluster: Putative uncharacterized protein; n=2; ... 36 2.2 UniRef50_Q0CQD0 Cluster: Predicted protein; n=1; Aspergillus ter... 36 2.2 UniRef50_P0C5C7 Cluster: Glycine-rich cell wall structural prote... 36 2.2 UniRef50_UPI00015BDD6A Cluster: UPI00015BDD6A related cluster; n... 35 2.8 UniRef50_UPI000155D461 Cluster: PREDICTED: similar to Mitogen-ac... 35 2.8 UniRef50_UPI0000DC00CB Cluster: SH3 domain binding protein CR16;... 35 2.8 UniRef50_Q4A263 Cluster: Putative membrane protein; n=1; Emilian... 35 2.8 UniRef50_Q9A2R2 Cluster: OmpA family protein; n=5; Caulobacter|R... 35 2.8 UniRef50_Q2W222 Cluster: RTX toxins and related Ca2+-binding pro... 35 2.8 UniRef50_Q0M671 Cluster: Glycoside hydrolase, family 16:Hemolysi... 35 2.8 UniRef50_Q0C0P5 Cluster: OmpA family protein; n=1; Hyphomonas ne... 35 2.8 UniRef50_Q0ANI5 Cluster: OmpA/MotB domain protein precursor; n=2... 35 2.8 UniRef50_Q75JU4 Cluster: Similar to Volvox carteri f. nagariensi... 35 2.8 UniRef50_Q552N9 Cluster: RNA-binding region-containing protein; ... 35 2.8 UniRef50_A7RNZ0 Cluster: Predicted protein; n=1; Nematostella ve... 35 2.8 UniRef50_Q9UMN6 Cluster: WW domain-binding protein 7; n=16; Euka... 35 2.8 UniRef50_Q9Y613 Cluster: FH1/FH2 domain-containing protein 1; n=... 35 2.8 UniRef50_UPI0000D56EFA Cluster: PREDICTED: similar to Protein ca... 35 3.8 UniRef50_UPI000038C710 Cluster: COG2319: FOG: WD40 repeat; n=1; ... 35 3.8 UniRef50_UPI00004D6F7D Cluster: formin-like 2; n=3; Euteleostomi... 35 3.8 UniRef50_UPI0000F30E84 Cluster: UPI0000F30E84 related cluster; n... 35 3.8 UniRef50_Q3UQ97 Cluster: 10 days lactation, adult female mammary... 35 3.8 UniRef50_Q9LMQ1 Cluster: F7H2.17 protein; n=2; Arabidopsis thali... 35 3.8 UniRef50_Q41645 Cluster: Extensin; n=1; Volvox carteri|Rep: Exte... 35 3.8 UniRef50_Q41192 Cluster: NaPRP3; n=1; Nicotiana alata|Rep: NaPRP... 35 3.8 UniRef50_Q4QE97 Cluster: Formin, putative; n=3; Leishmania|Rep: ... 35 3.8 UniRef50_Q86UP3 Cluster: Zinc finger homeobox protein 4; n=18; E... 35 3.8 UniRef50_O36027 Cluster: Wiskott-Aldrich syndrome homolog protei... 35 3.8 UniRef50_Q95JC9 Cluster: Basic proline-rich protein precursor [C... 35 3.8 UniRef50_UPI0000F30DFE Cluster: UPI0000F30DFE related cluster; n... 34 5.0 UniRef50_Q08BP2 Cluster: LOC562403 protein; n=5; Danio rerio|Rep... 34 5.0 UniRef50_Q8UZB6 Cluster: Replicase; n=5; Grapevine fleck virus|R... 34 5.0 UniRef50_Q4A371 Cluster: Putative membrane protein precursor; n=... 34 5.0 UniRef50_Q0LTW4 Cluster: Peptidase M56, BlaR1 precursor; n=1; Ca... 34 5.0 UniRef50_A4FGR9 Cluster: Putative uncharacterized protein; n=1; ... 34 5.0 UniRef50_Q9ATK5 Cluster: PF6 protein; n=1; Chlamydomonas reinhar... 34 5.0 UniRef50_Q0DSG8 Cluster: Os03g0308700 protein; n=1; Oryza sativa... 34 5.0 UniRef50_Q00X46 Cluster: Chromosome 13 contig 1, DNA sequence; n... 34 5.0 UniRef50_A2WJU1 Cluster: Putative uncharacterized protein; n=3; ... 34 5.0 UniRef50_Q54U84 Cluster: Putative uncharacterized protein; n=1; ... 34 5.0 UniRef50_Q05H60 Cluster: Major ampullate spidroin 1 precursor; n... 34 5.0 UniRef50_Q6CH67 Cluster: Similarities with sp|P35207 Saccharomyc... 34 5.0 UniRef50_Q5A0V8 Cluster: Putative uncharacterized protein; n=1; ... 34 5.0 UniRef50_Q4PBP1 Cluster: Putative uncharacterized protein; n=1; ... 34 5.0 UniRef50_P42768 Cluster: Wiskott-Aldrich syndrome protein; n=14;... 34 5.0 UniRef50_P15771 Cluster: Nucleolin; n=25; Deuterostomia|Rep: Nuc... 34 5.0 UniRef50_Q4P6X2 Cluster: Putative uncharacterized protein; n=1; ... 27 5.1 UniRef50_UPI00015B541C Cluster: PREDICTED: hypothetical protein;... 34 6.6 UniRef50_UPI00015B4CAB Cluster: PREDICTED: hypothetical protein;... 34 6.6 UniRef50_UPI0000DC1448 Cluster: UPI0000DC1448 related cluster; n... 34 6.6 UniRef50_Q3M5H7 Cluster: VCBS; n=2; Bacteria|Rep: VCBS - Anabaen... 34 6.6 UniRef50_Q6ZD62 Cluster: Putative pherophorin-dz1 protein; n=4; ... 34 6.6 UniRef50_Q2R360 Cluster: C2 domain containing protein, expressed... 34 6.6 UniRef50_Q2HV13 Cluster: Plant lipid transfer/seed storage/tryps... 34 6.6 UniRef50_Q10R38 Cluster: Transposon protein, putative, CACTA, En... 34 6.6 UniRef50_Q0JA38 Cluster: Os04g0617200 protein; n=2; Oryza sativa... 34 6.6 UniRef50_A7QNX2 Cluster: Chromosome chr1 scaffold_135, whole gen... 34 6.6 UniRef50_A5BR16 Cluster: Putative uncharacterized protein; n=1; ... 34 6.6 UniRef50_Q7QDL5 Cluster: ENSANGP00000000741; n=1; Anopheles gamb... 34 6.6 UniRef50_Q874Y8 Cluster: DNA centromeric region sequence from BA... 34 6.6 UniRef50_Q6AHS6 Cluster: Protease-1 (PRT1) protein, putative; n=... 34 6.6 UniRef50_Q2GSQ8 Cluster: Putative uncharacterized protein; n=2; ... 34 6.6 UniRef50_A6R957 Cluster: Cytokinesis protein sepA; n=1; Ajellomy... 34 6.6 UniRef50_Q0GNC1 Cluster: Inverted formin-2; n=13; Euteleostomi|R... 34 6.6 UniRef50_O95466 Cluster: Formin-like protein 1; n=39; Tetrapoda|... 34 6.6 UniRef50_UPI0000F2E662 Cluster: PREDICTED: similar to CBLL1 prot... 33 8.7 UniRef50_UPI0000F1EE0D Cluster: PREDICTED: hypothetical protein;... 33 8.7 UniRef50_UPI0000DA3CD5 Cluster: PREDICTED: hypothetical protein;... 33 8.7 UniRef50_UPI00006A23F9 Cluster: UPI00006A23F9 related cluster; n... 33 8.7 UniRef50_Q4RSI9 Cluster: Chromosome 13 SCAF15000, whole genome s... 33 8.7 UniRef50_A4QN64 Cluster: Zgc:162320 protein; n=8; Danio rerio|Re... 33 8.7 UniRef50_Q9E938 Cluster: ICP4 protein; n=2; Gallid herpesvirus 3... 33 8.7 UniRef50_Q5YFM4 Cluster: Putative uncharacterized protein; n=2; ... 33 8.7 UniRef50_Q07701 Cluster: EBNA-2; n=1; Cercopithecine herpesvirus... 33 8.7 UniRef50_Q8VWD1 Cluster: Putative glycine-rich protein; n=2; Str... 33 8.7 UniRef50_A5NR52 Cluster: Putative uncharacterized protein; n=1; ... 33 8.7 UniRef50_A5NQH0 Cluster: Putative uncharacterized protein precur... 33 8.7 UniRef50_A7QW77 Cluster: Chromosome chr3 scaffold_199, whole gen... 33 8.7 UniRef50_A4S1Y9 Cluster: Predicted protein; n=1; Ostreococcus lu... 33 8.7 UniRef50_Q9VZC2 Cluster: CG15021-PA; n=1; Drosophila melanogaste... 33 8.7 UniRef50_Q57WJ7 Cluster: Calpain, putative; n=3; Trypanosoma bru... 33 8.7 UniRef50_Q38EF1 Cluster: Putative uncharacterized protein; n=1; ... 33 8.7 UniRef50_Q3HYB9 Cluster: Proline-and threonine-rich protein; n=2... 33 8.7 UniRef50_A7TQN2 Cluster: Putative uncharacterized protein; n=1; ... 33 8.7 UniRef50_A4RC14 Cluster: Predicted protein; n=1; Magnaporthe gri... 33 8.7 UniRef50_A4R5L4 Cluster: Putative uncharacterized protein; n=1; ... 33 8.7 UniRef50_P19837 Cluster: Spidroin-1; n=50; Araneae|Rep: Spidroin... 33 8.7 UniRef50_Q9Y6X0 Cluster: SET-binding protein; n=26; Tetrapoda|Re... 33 8.7 UniRef50_Q70E73 Cluster: Ras-associated and pleckstrin homology ... 33 8.7 UniRef50_Q9TZQ3 Cluster: P granule abnormality protein 1; n=5; C... 33 8.7 UniRef50_P19338 Cluster: Nucleolin; n=39; Deuterostomia|Rep: Nuc... 33 8.7 UniRef50_Q9FPQ6 Cluster: Vegetative cell wall protein gp1 precur... 33 8.7 UniRef50_Q9Y4D1 Cluster: Disheveled-associated activator of morp... 33 8.7 UniRef50_P35790 Cluster: Choline kinase alpha; n=41; Euteleostom... 33 8.7 >UniRef50_Q01I59 Cluster: H0315A08.9 protein; n=3; Oryza sativa|Rep: H0315A08.9 protein - Oryza sativa (Rice) Length = 168 Score = 40.7 bits (91), Expect = 0.057 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +2 Query: 863 FCXGWRXXSPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 F WR P PP PP PPP P P P PPP Sbjct: 8 FVSFWRVDPPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 35.5 bits (78), Expect = 2.2 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 860 PFCXGWRXXSPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 P C P PP PP PPP P P P PPP Sbjct: 19 PHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPP 66 >UniRef50_Q8L685 Cluster: Pherophorin-dz1 protein precursor; n=1; Volvox carteri f. nagariensis|Rep: Pherophorin-dz1 protein precursor - Volvox carteri f. nagariensis Length = 1009 Score = 40.3 bits (90), Expect = 0.076 Identities = 22/61 (36%), Positives = 23/61 (37%) Frame = +2 Query: 809 PXXCAPXIPTTLXVSXRPFCXGWRXXSPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPP 988 P +P P L S P SP L PP PP PPP P P P PP Sbjct: 209 PPPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Query: 989 P 991 P Sbjct: 269 P 269 Score = 37.9 bits (84), Expect = 0.40 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 674 Query: 975 LPXXXP 992 LP P Sbjct: 675 LPPSPP 680 Score = 37.9 bits (84), Expect = 0.40 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P LPP PP PP P P P P Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPP 695 Query: 975 LPXXXP 992 P P Sbjct: 696 PPPPPP 701 Score = 37.5 bits (83), Expect = 0.53 Identities = 21/66 (31%), Positives = 22/66 (33%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P + P P P S P P PP PP PP P P P P Sbjct: 212 PSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Query: 975 LPXXXP 992 P P Sbjct: 272 PPPPPP 277 Score = 36.7 bits (81), Expect = 0.93 Identities = 20/66 (30%), Positives = 21/66 (31%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P + P P PP PP PP P P P P Sbjct: 211 PPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Query: 975 LPXXXP 992 P P Sbjct: 271 PPPPPP 276 Score = 36.7 bits (81), Expect = 0.93 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P PLP PP PP PP P P P P Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPP 702 Query: 975 LP 980 P Sbjct: 703 HP 704 Score = 35.9 bits (79), Expect = 1.6 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 222 PSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 281 Query: 975 LPXXXP 992 P P Sbjct: 282 PPPPPP 287 Score = 35.5 bits (78), Expect = 2.2 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 677 Query: 975 LPXXXP 992 P P Sbjct: 678 SPPPPP 683 Score = 35.5 bits (78), Expect = 2.2 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPP 687 Query: 975 LPXXXP 992 P P Sbjct: 688 PPPPPP 693 Score = 35.5 bits (78), Expect = 2.2 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPP 698 Query: 975 LPXXXP 992 P P Sbjct: 699 PPPPHP 704 Score = 35.5 bits (78), Expect = 2.2 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 646 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPP 705 Query: 975 LPXXXP 992 P P Sbjct: 706 PPSPPP 711 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 219 PLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 278 Query: 975 LPXXXP 992 P P Sbjct: 279 PPPPPP 284 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 224 PPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 283 Query: 975 LPXXXP 992 P P Sbjct: 284 PPPPPP 289 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 227 PSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Query: 975 LPXXXP 992 P P Sbjct: 287 PPPPPP 292 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 229 PPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Query: 975 LPXXXP 992 P P Sbjct: 289 PPPPPP 294 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 231 PPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Query: 975 LPXXXP 992 P P Sbjct: 291 PPPPPP 296 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 233 PPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Query: 975 LPXXXP 992 P P Sbjct: 293 PPPPPP 298 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 234 PSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Query: 975 LPXXXP 992 P P Sbjct: 294 PPPPPP 299 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 236 PPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Query: 975 LPXXXP 992 P P Sbjct: 296 PPPPPP 301 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 238 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Query: 975 LPXXXP 992 P P Sbjct: 298 PPPPPP 303 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 239 PLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Query: 975 LPXXXP 992 P P Sbjct: 299 PPPPPP 304 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Query: 975 LPXXXP 992 P P Sbjct: 301 PPPPPP 306 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Query: 975 LPXXXP 992 P P Sbjct: 302 PPPPPP 307 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Query: 975 LPXXXP 992 P P Sbjct: 303 PPPPPP 308 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Query: 975 LPXXXP 992 P P Sbjct: 304 PPPPPP 309 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Query: 975 LPXXXP 992 P P Sbjct: 305 PPPPPP 310 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Query: 975 LPXXXP 992 P P Sbjct: 306 PPPPPP 311 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Query: 975 LPXXXP 992 P P Sbjct: 307 PPPPPP 312 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Query: 975 LPXXXP 992 P P Sbjct: 308 PPPPPP 313 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Query: 975 LPXXXP 992 P P Sbjct: 309 PPPPPP 314 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Query: 975 LPXXXP 992 P P Sbjct: 310 PPPPPP 315 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Query: 975 LPXXXP 992 P P Sbjct: 311 PPPPPP 316 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Query: 975 LPXXXP 992 P P Sbjct: 312 PPPPPP 317 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Query: 975 LPXXXP 992 P P Sbjct: 313 PPPPPP 318 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Query: 975 LPXXXP 992 P P Sbjct: 314 PPPPPP 319 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Query: 975 LPXXXP 992 P P Sbjct: 315 PPPPPP 320 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Query: 975 LPXXXP 992 P P Sbjct: 316 PPPPPP 321 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Query: 975 LPXXXP 992 P P Sbjct: 317 PPPPPP 322 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Query: 975 LPXXXP 992 P P Sbjct: 318 PPPPPP 323 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Query: 975 LPXXXP 992 P P Sbjct: 319 PPPPPP 324 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Query: 975 LPXXXP 992 P P Sbjct: 320 PPPPPP 325 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Query: 975 LPXXXP 992 P P Sbjct: 321 PPPPPP 326 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Query: 975 LPXXXP 992 P P Sbjct: 322 PPPPPP 327 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Query: 975 LPXXXP 992 P P Sbjct: 323 PPPPPP 328 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Query: 975 LPXXXP 992 P P Sbjct: 324 PPPPPP 329 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Query: 975 LPXXXP 992 P P Sbjct: 325 PPPPPP 330 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Query: 975 LPXXXP 992 P P Sbjct: 326 PPPPPP 331 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Query: 975 LPXXXP 992 P P Sbjct: 327 PPPPPP 332 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Query: 975 LPXXXP 992 P P Sbjct: 328 PPPPPP 333 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Query: 975 LPXXXP 992 P P Sbjct: 329 PPPPPP 334 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Query: 975 LPXXXP 992 P P Sbjct: 330 PPPPPP 335 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Query: 975 LPXXXP 992 P P Sbjct: 331 PPPPPP 336 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Query: 975 LPXXXP 992 P P Sbjct: 332 PPPPPP 337 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Query: 975 LPXXXP 992 P P Sbjct: 333 PPPPPP 338 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Query: 975 LPXXXP 992 P P Sbjct: 334 PPPPPP 339 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Query: 975 LPXXXP 992 P P Sbjct: 335 PPPPPP 340 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Query: 975 LPXXXP 992 P P Sbjct: 336 PPPPPP 341 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Query: 975 LPXXXP 992 P P Sbjct: 337 PPPPPP 342 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Query: 975 LPXXXP 992 P P Sbjct: 338 PPPPPP 343 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Query: 975 LPXXXP 992 P P Sbjct: 339 PPPPPP 344 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Query: 975 LPXXXP 992 P P Sbjct: 340 PPPPPP 345 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Query: 975 LPXXXP 992 P P Sbjct: 341 PPPPPP 346 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Query: 975 LPXXXP 992 P P Sbjct: 342 PPPPPP 347 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Query: 975 LPXXXP 992 P P Sbjct: 343 PPPPPP 348 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Query: 975 LPXXXP 992 P P Sbjct: 344 PPPPPP 349 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Query: 975 LPXXXP 992 P P Sbjct: 345 PPPPPP 350 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Query: 975 LPXXXP 992 P P Sbjct: 346 PPPPPP 351 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Query: 975 LPXXXP 992 P P Sbjct: 347 PPPPPP 352 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Query: 975 LPXXXP 992 P P Sbjct: 348 PPPPPP 353 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Query: 975 LPXXXP 992 P P Sbjct: 349 PPPPPP 354 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Query: 975 LPXXXP 992 P P Sbjct: 350 PPPPPP 355 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Query: 975 LPXXXP 992 P P Sbjct: 351 PPPPPP 356 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Query: 975 LPXXXP 992 P P Sbjct: 352 PPPPPP 357 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Query: 975 LPXXXP 992 P P Sbjct: 353 PPPPPP 358 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Query: 975 LPXXXP 992 P P Sbjct: 354 PPPPPP 359 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Query: 975 LPXXXP 992 P P Sbjct: 355 PPPPPP 360 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Query: 975 LPXXXP 992 P P Sbjct: 356 PPPPPP 361 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Query: 975 LPXXXP 992 P P Sbjct: 357 PPPPPP 362 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Query: 975 LPXXXP 992 P P Sbjct: 358 PPPPPP 363 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Query: 975 LPXXXP 992 P P Sbjct: 359 PPPPPP 364 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Query: 975 LPXXXP 992 P P Sbjct: 360 PPPPPP 365 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Query: 975 LPXXXP 992 P P Sbjct: 361 PPPPPP 366 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Query: 975 LPXXXP 992 P P Sbjct: 362 PPPPPP 367 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Query: 975 LPXXXP 992 P P Sbjct: 363 PPPPPP 368 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Query: 975 LPXXXP 992 P P Sbjct: 364 PPPPPP 369 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Query: 975 LPXXXP 992 P P Sbjct: 365 PPPPPP 370 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Query: 975 LPXXXP 992 P P Sbjct: 366 PPPPPP 371 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Query: 975 LPXXXP 992 P P Sbjct: 367 PPPPPP 372 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Query: 975 LPXXXP 992 P P Sbjct: 368 PPPPPP 373 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Query: 975 LPXXXP 992 P P Sbjct: 369 PPPPPP 374 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Query: 975 LPXXXP 992 P P Sbjct: 370 PPPPPP 375 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Query: 975 LPXXXP 992 P P Sbjct: 371 PPPPPP 376 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Query: 975 LPXXXP 992 P P Sbjct: 372 PPPPPP 377 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Query: 975 LPXXXP 992 P P Sbjct: 373 PPPPPP 378 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Query: 975 LPXXXP 992 P P Sbjct: 374 PPPPPP 379 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Query: 975 LPXXXP 992 P P Sbjct: 375 PPPPPP 380 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Query: 975 LPXXXP 992 P P Sbjct: 376 PPPPPP 381 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Query: 975 LPXXXP 992 P P Sbjct: 377 PPPPPP 382 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Query: 975 LPXXXP 992 P P Sbjct: 378 PPPPPP 383 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Query: 975 LPXXXP 992 P P Sbjct: 379 PPPPPP 384 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Query: 975 LPXXXP 992 P P Sbjct: 380 PPPPPP 385 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Query: 975 LPXXXP 992 P P Sbjct: 381 PPPPPP 386 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Query: 975 LPXXXP 992 P P Sbjct: 382 PPPPPP 387 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Query: 975 LPXXXP 992 P P Sbjct: 383 PPPPPP 388 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Query: 975 LPXXXP 992 P P Sbjct: 384 PPPPPP 389 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Query: 975 LPXXXP 992 P P Sbjct: 385 PPPPPP 390 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Query: 975 LPXXXP 992 P P Sbjct: 386 PPPPPP 391 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Query: 975 LPXXXP 992 P P Sbjct: 387 PPPPPP 392 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Query: 975 LPXXXP 992 P P Sbjct: 388 PPPPPP 393 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Query: 975 LPXXXP 992 P P Sbjct: 389 PPPPPP 394 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Query: 975 LPXXXP 992 P P Sbjct: 390 PPPPPP 395 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Query: 975 LPXXXP 992 P P Sbjct: 391 PPPPPP 396 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Query: 975 LPXXXP 992 P P Sbjct: 392 PPPPPP 397 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Query: 975 LPXXXP 992 P P Sbjct: 393 PPPPPP 398 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Query: 975 LPXXXP 992 P P Sbjct: 394 PPPPPP 399 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Query: 975 LPXXXP 992 P P Sbjct: 395 PPPPPP 400 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Query: 975 LPXXXP 992 P P Sbjct: 396 PPPPPP 401 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Query: 975 LPXXXP 992 P P Sbjct: 397 PPPPPP 402 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Query: 975 LPXXXP 992 P P Sbjct: 398 PPPPPP 403 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Query: 975 LPXXXP 992 P P Sbjct: 399 PPPPPP 404 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Query: 975 LPXXXP 992 P P Sbjct: 400 PPPPPP 405 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Query: 975 LPXXXP 992 P P Sbjct: 401 PPPPPP 406 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Query: 975 LPXXXP 992 P P Sbjct: 402 PPPPPP 407 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Query: 975 LPXXXP 992 P P Sbjct: 403 PPPPPP 408 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Query: 975 LPXXXP 992 P P Sbjct: 404 PPPPPP 409 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Query: 975 LPXXXP 992 P P Sbjct: 405 PPPPPP 410 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Query: 975 LPXXXP 992 P P Sbjct: 406 PPPPPP 411 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Query: 975 LPXXXP 992 P P Sbjct: 407 PPPPPP 412 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Query: 975 LPXXXP 992 P P Sbjct: 408 PPPPPP 413 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Query: 975 LPXXXP 992 P P Sbjct: 409 PPPPPP 414 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Query: 975 LPXXXP 992 P P Sbjct: 410 PPPPPP 415 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Query: 975 LPXXXP 992 P P Sbjct: 411 PPPPPP 416 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Query: 975 LPXXXP 992 P P Sbjct: 412 PPPPPP 417 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Query: 975 LPXXXP 992 P P Sbjct: 413 PPPPPP 418 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Query: 975 LPXXXP 992 P P Sbjct: 414 PPPPPP 419 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Query: 975 LPXXXP 992 P P Sbjct: 415 PPPPPP 420 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Query: 975 LPXXXP 992 P P Sbjct: 416 PPPPPP 421 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Query: 975 LPXXXP 992 P P Sbjct: 417 PPPPPP 422 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Query: 975 LPXXXP 992 P P Sbjct: 418 PPPPPP 423 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Query: 975 LPXXXP 992 P P Sbjct: 419 PPPPPP 424 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Query: 975 LPXXXP 992 P P Sbjct: 420 PPPPPP 425 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Query: 975 LPXXXP 992 P P Sbjct: 421 PPPPPP 426 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Query: 975 LPXXXP 992 P P Sbjct: 422 PPPPPP 427 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Query: 975 LPXXXP 992 P P Sbjct: 423 PPPPPP 428 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Query: 975 LPXXXP 992 P P Sbjct: 424 PPPPPP 429 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Query: 975 LPXXXP 992 P P Sbjct: 425 PPPPPP 430 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Query: 975 LPXXXP 992 P P Sbjct: 426 PPPPPP 431 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Query: 975 LPXXXP 992 P P Sbjct: 427 PPPPPP 432 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Query: 975 LPXXXP 992 P P Sbjct: 428 PPPPPP 433 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Query: 975 LPXXXP 992 P P Sbjct: 429 PPPPPP 434 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Query: 975 LPXXXP 992 P P Sbjct: 430 PPPPPP 435 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Query: 975 LPXXXP 992 P P Sbjct: 431 PPPPPP 436 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Query: 975 LPXXXP 992 P P Sbjct: 432 PPPPPP 437 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Query: 975 LPXXXP 992 P P Sbjct: 433 PPPPPP 438 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Query: 975 LPXXXP 992 P P Sbjct: 434 PPPPPP 439 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Query: 975 LPXXXP 992 P P Sbjct: 435 PPPPPP 440 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Query: 975 LPXXXP 992 P P Sbjct: 436 PPPPPP 441 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Query: 975 LPXXXP 992 P P Sbjct: 437 PPPPPP 442 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Query: 975 LPXXXP 992 P P Sbjct: 438 PPPPPP 443 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Query: 975 LPXXXP 992 P P Sbjct: 439 PPPPPP 444 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Query: 975 LPXXXP 992 P P Sbjct: 440 PPPPPP 445 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Query: 975 LPXXXP 992 P P Sbjct: 441 PPPPPP 446 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Query: 975 LPXXXP 992 P P Sbjct: 442 PPPPPP 447 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Query: 975 LPXXXP 992 P P Sbjct: 443 PPPPPP 448 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Query: 975 LPXXXP 992 P P Sbjct: 444 PPPPPP 449 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Query: 975 LPXXXP 992 P P Sbjct: 445 PPPPPP 450 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Query: 975 LPXXXP 992 P P Sbjct: 446 PPPPPP 451 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Query: 975 LPXXXP 992 P P Sbjct: 447 PPPPPP 452 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Query: 975 LPXXXP 992 P P Sbjct: 448 PPPPPP 453 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Query: 975 LPXXXP 992 P P Sbjct: 449 PPPPPP 454 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Query: 975 LPXXXP 992 P P Sbjct: 450 PPPPPP 455 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Query: 975 LPXXXP 992 P P Sbjct: 451 PPPPPP 456 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Query: 975 LPXXXP 992 P P Sbjct: 452 PPPPPP 457 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Query: 975 LPXXXP 992 P P Sbjct: 453 PPPPPP 458 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Query: 975 LPXXXP 992 P P Sbjct: 454 PPPPPP 459 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Query: 975 LPXXXP 992 P P Sbjct: 455 PPPPPP 460 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Query: 975 LPXXXP 992 P P Sbjct: 456 PPPPPP 461 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Query: 975 LPXXXP 992 P P Sbjct: 457 PPPPPP 462 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Query: 975 LPXXXP 992 P P Sbjct: 458 PPPPPP 463 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Query: 975 LPXXXP 992 P P Sbjct: 459 PPPPPP 464 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Query: 975 LPXXXP 992 P P Sbjct: 460 PPPPPP 465 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Query: 975 LPXXXP 992 P P Sbjct: 461 PPPPPP 466 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Query: 975 LPXXXP 992 P P Sbjct: 462 PPPPPP 467 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Query: 975 LPXXXP 992 P P Sbjct: 463 PPPPPP 468 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Query: 975 LPXXXP 992 P P Sbjct: 464 PPPPPP 469 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Query: 975 LPXXXP 992 P P Sbjct: 465 PPPPPP 470 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Query: 975 LPXXXP 992 P P Sbjct: 466 PPPPPP 471 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Query: 975 LPXXXP 992 P P Sbjct: 467 PPPPPP 472 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Query: 975 LPXXXP 992 P P Sbjct: 468 PPPPPP 473 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Query: 975 LPXXXP 992 P P Sbjct: 469 PPPPPP 474 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Query: 975 LPXXXP 992 P P Sbjct: 470 PPPPPP 475 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Query: 975 LPXXXP 992 P P Sbjct: 471 PPPPPP 476 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Query: 975 LPXXXP 992 P P Sbjct: 472 PPPPPP 477 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Query: 975 LPXXXP 992 P P Sbjct: 473 PPPPPP 478 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Query: 975 LPXXXP 992 P P Sbjct: 474 PPPPPP 479 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Query: 975 LPXXXP 992 P P Sbjct: 475 PPPPPP 480 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Query: 975 LPXXXP 992 P P Sbjct: 476 PPPPPP 481 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Query: 975 LPXXXP 992 P P Sbjct: 477 PPPPPP 482 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Query: 975 LPXXXP 992 P P Sbjct: 478 PPPPPP 483 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Query: 975 LPXXXP 992 P P Sbjct: 479 PPPPPP 484 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Query: 975 LPXXXP 992 P P Sbjct: 480 PPPPPP 485 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Query: 975 LPXXXP 992 P P Sbjct: 481 PPPPPP 486 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Query: 975 LPXXXP 992 P P Sbjct: 482 PPPPPP 487 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Query: 975 LPXXXP 992 P P Sbjct: 483 PPPPPP 488 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Query: 975 LPXXXP 992 P P Sbjct: 484 PPPPPP 489 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Query: 975 LPXXXP 992 P P Sbjct: 485 PPPPPP 490 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Query: 975 LPXXXP 992 P P Sbjct: 486 PPPPPP 491 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Query: 975 LPXXXP 992 P P Sbjct: 487 PPPPPP 492 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Query: 975 LPXXXP 992 P P Sbjct: 488 PPPPPP 493 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Query: 975 LPXXXP 992 P P Sbjct: 489 PPPPPP 494 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Query: 975 LPXXXP 992 P P Sbjct: 490 PPPPPP 495 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Query: 975 LPXXXP 992 P P Sbjct: 491 PPPPPP 496 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Query: 975 LPXXXP 992 P P Sbjct: 492 PPPPPP 497 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Query: 975 LPXXXP 992 P P Sbjct: 493 PPPPPP 498 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Query: 975 LPXXXP 992 P P Sbjct: 494 PPPPPP 499 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Query: 975 LPXXXP 992 P P Sbjct: 495 PPPPPP 500 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Query: 975 LPXXXP 992 P P Sbjct: 496 PPPPPP 501 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Query: 975 LPXXXP 992 P P Sbjct: 497 PPPPPP 502 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Query: 975 LPXXXP 992 P P Sbjct: 498 PPPPPP 503 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Query: 975 LPXXXP 992 P P Sbjct: 499 PPPPPP 504 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Query: 975 LPXXXP 992 P P Sbjct: 500 PPPPPP 505 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Query: 975 LPXXXP 992 P P Sbjct: 501 PPPPPP 506 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Query: 975 LPXXXP 992 P P Sbjct: 502 PPPPPP 507 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Query: 975 LPXXXP 992 P P Sbjct: 503 PPPPPP 508 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Query: 975 LPXXXP 992 P P Sbjct: 504 PPPPPP 509 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Query: 975 LPXXXP 992 P P Sbjct: 505 PPPPPP 510 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Query: 975 LPXXXP 992 P P Sbjct: 506 PPPPPP 511 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Query: 975 LPXXXP 992 P P Sbjct: 507 PPPPPP 512 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Query: 975 LPXXXP 992 P P Sbjct: 508 PPPPPP 513 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Query: 975 LPXXXP 992 P P Sbjct: 509 PPPPPP 514 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Query: 975 LPXXXP 992 P P Sbjct: 510 PPPPPP 515 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Query: 975 LPXXXP 992 P P Sbjct: 511 PPPPPP 516 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Query: 975 LPXXXP 992 P P Sbjct: 512 PPPPPP 517 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Query: 975 LPXXXP 992 P P Sbjct: 513 PPPPPP 518 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Query: 975 LPXXXP 992 P P Sbjct: 514 PPPPPP 519 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Query: 975 LPXXXP 992 P P Sbjct: 515 PPPPPP 520 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Query: 975 LPXXXP 992 P P Sbjct: 516 PPPPPP 521 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Query: 975 LPXXXP 992 P P Sbjct: 517 PPPPPP 522 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Query: 975 LPXXXP 992 P P Sbjct: 518 PPPPPP 523 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Query: 975 LPXXXP 992 P P Sbjct: 519 PPPPPP 524 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Query: 975 LPXXXP 992 P P Sbjct: 520 PPPPPP 525 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Query: 975 LPXXXP 992 P P Sbjct: 521 PPPPPP 526 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Query: 975 LPXXXP 992 P P Sbjct: 522 PPPPPP 527 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Query: 975 LPXXXP 992 P P Sbjct: 523 PPPPPP 528 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Query: 975 LPXXXP 992 P P Sbjct: 524 PPPPPP 529 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Query: 975 LPXXXP 992 P P Sbjct: 525 PPPPPP 530 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Query: 975 LPXXXP 992 P P Sbjct: 526 PPPPPP 531 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Query: 975 LPXXXP 992 P P Sbjct: 527 PPPPPP 532 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Query: 975 LPXXXP 992 P P Sbjct: 528 PPPPPP 533 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Query: 975 LPXXXP 992 P P Sbjct: 529 PPPPPP 534 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Query: 975 LPXXXP 992 P P Sbjct: 530 PPPPPP 535 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Query: 975 LPXXXP 992 P P Sbjct: 531 PPPPPP 536 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Query: 975 LPXXXP 992 P P Sbjct: 532 PPPPPP 537 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Query: 975 LPXXXP 992 P P Sbjct: 533 PPPPPP 538 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Query: 975 LPXXXP 992 P P Sbjct: 534 PPPPPP 539 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Query: 975 LPXXXP 992 P P Sbjct: 535 PPPPPP 540 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Query: 975 LPXXXP 992 P P Sbjct: 536 PPPPPP 541 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Query: 975 LPXXXP 992 P P Sbjct: 537 PPPPPP 542 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Query: 975 LPXXXP 992 P P Sbjct: 538 PPPPPP 543 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Query: 975 LPXXXP 992 P P Sbjct: 539 PPPPPP 544 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Query: 975 LPXXXP 992 P P Sbjct: 540 PPPPPP 545 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Query: 975 LPXXXP 992 P P Sbjct: 541 PPPPPP 546 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Query: 975 LPXXXP 992 P P Sbjct: 542 PPPPPP 547 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Query: 975 LPXXXP 992 P P Sbjct: 543 PPPPPP 548 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Query: 975 LPXXXP 992 P P Sbjct: 544 PPPPPP 549 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Query: 975 LPXXXP 992 P P Sbjct: 545 PPPPPP 550 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Query: 975 LPXXXP 992 P P Sbjct: 546 PPPPPP 551 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Query: 975 LPXXXP 992 P P Sbjct: 547 PPPPPP 552 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Query: 975 LPXXXP 992 P P Sbjct: 548 PPPPPP 553 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Query: 975 LPXXXP 992 P P Sbjct: 549 PPPPPP 554 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Query: 975 LPXXXP 992 P P Sbjct: 550 PPPPPP 555 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Query: 975 LPXXXP 992 P P Sbjct: 551 PPPPPP 556 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Query: 975 LPXXXP 992 P P Sbjct: 552 PPPPPP 557 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Query: 975 LPXXXP 992 P P Sbjct: 553 PPPPPP 558 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Query: 975 LPXXXP 992 P P Sbjct: 554 PPPPPP 559 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Query: 975 LPXXXP 992 P P Sbjct: 555 PPPPPP 560 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Query: 975 LPXXXP 992 P P Sbjct: 556 PPPPPP 561 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Query: 975 LPXXXP 992 P P Sbjct: 557 PPPPPP 562 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Query: 975 LPXXXP 992 P P Sbjct: 558 PPPPPP 563 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Query: 975 LPXXXP 992 P P Sbjct: 559 PPPPPP 564 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Query: 975 LPXXXP 992 P P Sbjct: 560 PPPPPP 565 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Query: 975 LPXXXP 992 P P Sbjct: 561 PPPPPP 566 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Query: 975 LPXXXP 992 P P Sbjct: 562 PPPPPP 567 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Query: 975 LPXXXP 992 P P Sbjct: 563 PPPPPP 568 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Query: 975 LPXXXP 992 P P Sbjct: 564 PPPPPP 569 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Query: 975 LPXXXP 992 P P Sbjct: 565 PPPPPP 570 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Query: 975 LPXXXP 992 P P Sbjct: 566 PPPPPP 571 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Query: 975 LPXXXP 992 P P Sbjct: 567 PPPPPP 572 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Query: 975 LPXXXP 992 P P Sbjct: 568 PPPPPP 573 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Query: 975 LPXXXP 992 P P Sbjct: 569 PPPPPP 574 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Query: 975 LPXXXP 992 P P Sbjct: 570 PPPPPP 575 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Query: 975 LPXXXP 992 P P Sbjct: 571 PPPPPP 576 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Query: 975 LPXXXP 992 P P Sbjct: 572 PPPPPP 577 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Query: 975 LPXXXP 992 P P Sbjct: 573 PPPPPP 578 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Query: 975 LPXXXP 992 P P Sbjct: 574 PPPPPP 579 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Query: 975 LPXXXP 992 P P Sbjct: 575 PPPPPP 580 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Query: 975 LPXXXP 992 P P Sbjct: 576 PPPPPP 581 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Query: 975 LPXXXP 992 P P Sbjct: 577 PPPPPP 582 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Query: 975 LPXXXP 992 P P Sbjct: 578 PPPPPP 583 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Query: 975 LPXXXP 992 P P Sbjct: 579 PPPPPP 584 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Query: 975 LPXXXP 992 P P Sbjct: 580 PPPPPP 585 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Query: 975 LPXXXP 992 P P Sbjct: 581 PPPPPP 586 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Query: 975 LPXXXP 992 P P Sbjct: 582 PPPPPP 587 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Query: 975 LPXXXP 992 P P Sbjct: 583 PPPPPP 588 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Query: 975 LPXXXP 992 P P Sbjct: 584 PPPPPP 589 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Query: 975 LPXXXP 992 P P Sbjct: 585 PPPPPP 590 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Query: 975 LPXXXP 992 P P Sbjct: 586 PPPPPP 591 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Query: 975 LPXXXP 992 P P Sbjct: 587 PPPPPP 592 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Query: 975 LPXXXP 992 P P Sbjct: 588 PPPPPP 593 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Query: 975 LPXXXP 992 P P Sbjct: 589 PPPPPP 594 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Query: 975 LPXXXP 992 P P Sbjct: 590 PPPPPP 595 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Query: 975 LPXXXP 992 P P Sbjct: 591 PPPPPP 596 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Query: 975 LPXXXP 992 P P Sbjct: 592 PPPPPP 597 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Query: 975 LPXXXP 992 P P Sbjct: 593 PPPPPP 598 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Query: 975 LPXXXP 992 P P Sbjct: 594 PPPPPP 599 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Query: 975 LPXXXP 992 P P Sbjct: 595 PPPPPP 600 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Query: 975 LPXXXP 992 P P Sbjct: 596 PPPPPP 601 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Query: 975 LPXXXP 992 P P Sbjct: 597 PPPPPP 602 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Query: 975 LPXXXP 992 P P Sbjct: 598 PPPPPP 603 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Query: 975 LPXXXP 992 P P Sbjct: 599 PPPPPP 604 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Query: 975 LPXXXP 992 P P Sbjct: 600 PPPPPP 605 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Query: 975 LPXXXP 992 P P Sbjct: 601 PPPPPP 606 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Query: 975 LPXXXP 992 P P Sbjct: 602 PPPPPP 607 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Query: 975 LPXXXP 992 P P Sbjct: 603 PPPPPP 608 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Query: 975 LPXXXP 992 P P Sbjct: 604 PPPPPP 609 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Query: 975 LPXXXP 992 P P Sbjct: 605 PPPPPP 610 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Query: 975 LPXXXP 992 P P Sbjct: 606 PPPPPP 611 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Query: 975 LPXXXP 992 P P Sbjct: 607 PPPPPP 612 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Query: 975 LPXXXP 992 P P Sbjct: 608 PPPPPP 613 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Query: 975 LPXXXP 992 P P Sbjct: 609 PPPPPP 614 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Query: 975 LPXXXP 992 P P Sbjct: 610 PPPPPP 615 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Query: 975 LPXXXP 992 P P Sbjct: 611 PPPPPP 616 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Query: 975 LPXXXP 992 P P Sbjct: 612 PPPPPP 617 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Query: 975 LPXXXP 992 P P Sbjct: 613 PPPPPP 618 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Query: 975 LPXXXP 992 P P Sbjct: 614 PPPPPP 619 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Query: 975 LPXXXP 992 P P Sbjct: 615 PPPPPP 620 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Query: 975 LPXXXP 992 P P Sbjct: 616 PPPPPP 621 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Query: 975 LPXXXP 992 P P Sbjct: 617 PPPPPP 622 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Query: 975 LPXXXP 992 P P Sbjct: 618 PPPPPP 623 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Query: 975 LPXXXP 992 P P Sbjct: 619 PPPPPP 624 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Query: 975 LPXXXP 992 P P Sbjct: 620 PPPPPP 625 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Query: 975 LPXXXP 992 P P Sbjct: 621 PPPPPP 626 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Query: 975 LPXXXP 992 P P Sbjct: 622 PPPPPP 627 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Query: 975 LPXXXP 992 P P Sbjct: 623 PPPPPP 628 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Query: 975 LPXXXP 992 P P Sbjct: 624 PPPPPP 629 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Query: 975 LPXXXP 992 P P Sbjct: 625 PPPPPP 630 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Query: 975 LPXXXP 992 P P Sbjct: 626 PPPPPP 631 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Query: 975 LPXXXP 992 P P Sbjct: 627 PPPPPP 632 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Query: 975 LPXXXP 992 P P Sbjct: 628 PPPPPP 633 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Query: 975 LPXXXP 992 P P Sbjct: 629 PPPPPP 634 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Query: 975 LPXXXP 992 P P Sbjct: 630 PPPPPP 635 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Query: 975 LPXXXP 992 P P Sbjct: 631 PPPPPP 636 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Query: 975 LPXXXP 992 P P Sbjct: 632 PPPPPP 637 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Query: 975 LPXXXP 992 P P Sbjct: 633 PPPPPP 638 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Query: 975 LPXXXP 992 P P Sbjct: 634 PPPPPP 639 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Query: 975 LPXXXP 992 P P Sbjct: 635 PPPPPP 640 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Query: 975 LPXXXP 992 P P Sbjct: 636 PPPPPP 641 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Query: 975 LPXXXP 992 P P Sbjct: 637 PPPPPP 642 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Query: 975 LPXXXP 992 P P Sbjct: 638 PPPPPP 643 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Query: 975 LPXXXP 992 P P Sbjct: 639 PPPPPP 644 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Query: 975 LPXXXP 992 P P Sbjct: 640 PPPPPP 645 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Query: 975 LPXXXP 992 P P Sbjct: 641 PPPPPP 646 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Query: 975 LPXXXP 992 P P Sbjct: 642 PPPPPP 647 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Query: 975 LPXXXP 992 P P Sbjct: 643 PPPPPP 648 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Query: 975 LPXXXP 992 P P Sbjct: 644 PPPPPP 649 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Query: 975 LPXXXP 992 P P Sbjct: 645 PPPPPP 650 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Query: 975 LPXXXP 992 P P Sbjct: 646 PPPPPP 651 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Query: 975 LPXXXP 992 P P Sbjct: 647 PPPPPP 652 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Query: 975 LPXXXP 992 P P Sbjct: 648 PPPPPP 653 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Query: 975 LPXXXP 992 P P Sbjct: 649 PPPPPP 654 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Query: 975 LPXXXP 992 P P Sbjct: 650 PPPPPP 655 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Query: 975 LPXXXP 992 P P Sbjct: 651 PPPPPP 656 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Query: 975 LPXXXP 992 P P Sbjct: 652 PPPPPP 657 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Query: 975 LPXXXP 992 P P Sbjct: 653 PPPPPP 658 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Query: 975 LPXXXP 992 P P Sbjct: 654 PPPPPP 659 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Query: 975 LPXXXP 992 P P Sbjct: 655 PPPPPP 660 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Query: 975 LPXXXP 992 P P Sbjct: 656 PPPPPP 661 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Query: 975 LPXXXP 992 P P Sbjct: 657 PPPPPP 662 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Query: 975 LPXXXP 992 P P Sbjct: 658 PPPPPP 663 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Query: 975 LPXXXP 992 P P Sbjct: 659 PPPPPP 664 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Query: 975 LPXXXP 992 P P Sbjct: 660 PPPPPP 665 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Query: 975 LPXXXP 992 P P Sbjct: 661 PPPPPP 666 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Query: 975 LPXXXP 992 P P Sbjct: 662 PPPPPP 667 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Query: 975 LPXXXP 992 P P Sbjct: 663 PPPPPP 668 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Query: 975 LPXXXP 992 P P Sbjct: 664 PPPPPP 669 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Query: 975 LPXXXP 992 P P Sbjct: 665 PPPPPP 670 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Query: 975 LPXXXP 992 P P Sbjct: 666 PPPPPP 671 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Query: 975 LPXXXP 992 P P Sbjct: 667 PPPPPP 672 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Query: 975 LPXXXP 992 P P Sbjct: 668 PPPPPP 673 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Query: 975 LPXXXP 992 P P Sbjct: 669 PPPPPP 674 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Query: 975 LPXXXP 992 P P Sbjct: 671 PPPPLP 676 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671 Query: 975 LPXXXP 992 P P Sbjct: 672 PPPLPP 677 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPP 680 Query: 975 LPXXXP 992 P P Sbjct: 681 PPPPPP 686 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPP 690 Query: 975 LPXXXP 992 P P Sbjct: 691 PPPPPP 696 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPP 700 Query: 975 LPXXXP 992 P P Sbjct: 701 PPHPPP 706 Score = 34.7 bits (76), Expect = 3.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PPLP P P Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPP 684 Query: 975 LPXXXP 992 P P Sbjct: 685 PPPPPP 690 >UniRef50_Q3HTL0 Cluster: Pherophorin-V1 protein precursor; n=1; Volvox carteri f. nagariensis|Rep: Pherophorin-V1 protein precursor - Volvox carteri f. nagariensis Length = 590 Score = 39.9 bits (89), Expect = 0.100 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 SP PP PP PPP P SP PS PPP Sbjct: 226 SPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPP 260 Score = 37.9 bits (84), Expect = 0.40 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 SP PP PP PPP P SP P PPP Sbjct: 214 SPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPP 248 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 211 PPPSPSPPPSPPPPPSPPPPPPPPPPP 237 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 223 PPPSPPPPPPPPPPPSPPPPPPPPPPP 249 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 241 PPPPPPPPPSPPPPPSPPPPSPPLPPP 267 Score = 34.7 bits (76), Expect = 3.8 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 SP PP PP PP P P PS PPP Sbjct: 220 SPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPP 254 >UniRef50_Q01AC1 Cluster: Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family; n=2; Ostreococcus tauri|Rep: Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family - Ostreococcus tauri Length = 872 Score = 39.9 bits (89), Expect = 0.100 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P SA P P PP PP PP P P P P Sbjct: 534 PSPPPPSPSPPPSPPPPPSPPPGSAARPPSPPPPSPPPPSPPPPSPPPPPSPPPSPPPPP 593 Query: 975 LP 980 P Sbjct: 594 SP 595 Score = 36.7 bits (81), Expect = 0.93 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ P P P SP PS PPP Sbjct: 524 PPPSPPPPSPPSPPPPSPSPPPSPPPP 550 Score = 35.9 bits (79), Expect = 1.6 Identities = 20/66 (30%), Positives = 22/66 (33%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P + + P P PP PP PP P P P P Sbjct: 531 PSPPSPPPPSPSPPPSPPPPPSPPPGSAARPPSPPPPSPPPPSPPPPSPP-PPPSPPPSP 589 Query: 975 LPXXXP 992 P P Sbjct: 590 PPPPSP 595 Score = 34.3 bits (75), Expect = 5.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPP 988 PP PP PPP P P PS PP Sbjct: 501 PPPSPSPPPSPPPSPPPPSPPPSPPP 526 Score = 33.9 bits (74), Expect = 6.6 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 SP PP PP+ PP P P P PPP Sbjct: 568 SPPPPSPPPPSPPPPPSPPPSPPPPPSPPPPSPPP 602 Score = 33.5 bits (73), Expect = 8.7 Identities = 18/54 (33%), Positives = 20/54 (37%) Frame = +2 Query: 830 IPTTLXVSXRPFCXGWRXXSPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 +PT VS P P P PP+ PPP P SP PPP Sbjct: 492 LPTAPPVSSPPPSPSPPPSPPPSPPPPSPPPSPPPSPPPPSPPSPPPPSPSPPP 545 Score = 33.5 bits (73), Expect = 8.7 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXX--PSXPPP 991 SP PP PP+ PPP P P PS PPP Sbjct: 578 SPPPPPSPPPSPPPPPSPPPPSPPPPPVVVVPSSPPP 614 >UniRef50_P12978 Cluster: Epstein-Barr nuclear antigen 2; n=2; Human herpesvirus 4|Rep: Epstein-Barr nuclear antigen 2 - Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4) Length = 487 Score = 39.5 bits (88), Expect = 0.13 Identities = 20/56 (35%), Positives = 21/56 (37%) Frame = +2 Query: 824 PXIPTTLXVSXRPFCXGWRXXSPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 P IP T+ V P PP PP PPP P SP P PPP Sbjct: 44 PLIPLTIFVGENTGVPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 99 Score = 35.5 bits (78), Expect = 2.2 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPPXK 997 PP PP PPP P P P PPP + Sbjct: 74 PPPPPPPPPPPPPPPSPPPPPPPPPPPQR 102 >UniRef50_UPI0000DA3E0C Cluster: PREDICTED: similar to tumor endothelial marker 8 isoform 1 precursor; n=2; Rattus norvegicus|Rep: PREDICTED: similar to tumor endothelial marker 8 isoform 1 precursor - Rattus norvegicus Length = 542 Score = 39.1 bits (87), Expect = 0.17 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPPXK 997 PP PPT PPP P P P PPP K Sbjct: 411 PPPPVPPPTPPPPPPPPPPPPPPPPPPVK 439 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 319 PPPRPVPPPAPPPPPPPPPPPPRPPPP 345 >UniRef50_Q4THH6 Cluster: Chromosome undetermined SCAF2934, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome undetermined SCAF2934, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 300 Score = 38.7 bits (86), Expect = 0.23 Identities = 20/63 (31%), Positives = 22/63 (34%) Frame = +2 Query: 809 PXXCAPXIPTTLXVSXRPFCXGWRXXSPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPP 988 P C P P L S R +P PP PP PPP P P PP Sbjct: 227 PPPCPPSPPDCLRGSLTISRIRTRVRAPTRSYTNPPPAPPPPPPPPPPPPPTPPPPPPPP 286 Query: 989 PXK 997 P + Sbjct: 287 PER 289 >UniRef50_Q4A2U1 Cluster: Putative membrane protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein precursor - Emiliania huxleyi virus 86 Length = 2873 Score = 38.7 bits (86), Expect = 0.23 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P +P PS PPP Sbjct: 2748 PPPSPPPPSPPPPLPPAPSPPPSPPPP 2774 Score = 37.9 bits (84), Expect = 0.40 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P P PS PPP Sbjct: 2546 PPPLPPPPSPPPPSPPPPSPPPSPPPP 2572 Score = 37.9 bits (84), Expect = 0.40 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P P PS PPP Sbjct: 2694 PPPSPPPPSPPPPSPPPPSPPPSPPPP 2720 Score = 37.1 bits (82), Expect = 0.70 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P PS PPP Sbjct: 2555 PPPPSPPPPSPPPSPPPPSPPPSPPPP 2581 Score = 36.7 bits (81), Expect = 0.93 Identities = 20/63 (31%), Positives = 20/63 (31%) Frame = +3 Query: 804 PXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXPLPX 983 P P P P P S P P PP PP PP P P P P P Sbjct: 2687 PSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 2746 Query: 984 XXP 992 P Sbjct: 2747 PPP 2749 Score = 35.9 bits (79), Expect = 1.6 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = +2 Query: 890 PXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 P L PP PP+ PPP P P PS PPP Sbjct: 210 PPPPLPPPPPPPPPPSPPPPSPPPPPP-PSPPPP 242 Score = 35.9 bits (79), Expect = 1.6 Identities = 15/27 (55%), Positives = 16/27 (59%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P SP PS PPP Sbjct: 222 PPPSPPPPSPPPPPPPSP-PPPSPPPP 247 Score = 35.9 bits (79), Expect = 1.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P P P PPP Sbjct: 1183 PPSPPPPPSPPPPSPPPPLPPPPSPPP 1209 Score = 35.9 bits (79), Expect = 1.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P P P PPP Sbjct: 2258 PPPSPHPPSPPPPSPPPPSPPPPTPPP 2284 Score = 35.9 bits (79), Expect = 1.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P P P PPP Sbjct: 2288 PPPPTPPPSPPPPSPPPPSPPPPSPPP 2314 Score = 35.9 bits (79), Expect = 1.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P P P PPP Sbjct: 2728 PPPSPPPPSPPPPSPPPPSPPPPSPPP 2754 Score = 35.9 bits (79), Expect = 1.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P P P PPP Sbjct: 2733 PPPSPPPPSPPPPSPPPPSPPPPSPPP 2759 Score = 35.1 bits (77), Expect = 2.8 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P SP PS PPP Sbjct: 209 PPPPPLPPPPPPPPPPSP-PPPSPPPP 234 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 914 PXXXXPPTXPPPXPXSPXXXPSXPPP 991 P PP+ PPP P P PS PPP Sbjct: 2264 PPSPPPPSPPPPSPPPPTPPPSPPPP 2289 Score = 35.1 bits (77), Expect = 2.8 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = +2 Query: 911 PPXXXXPPTXPP-PXPXSPXXXPSXPPP 991 PP PPT PP P P P PS PPP Sbjct: 2273 PPPSPPPPTPPPSPPPPPPTPPPSPPPP 2300 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 2283 PPSPPPPPPTPPPSPPPPSPPPPSPPP 2309 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 2541 PPPSPPPPLPPPPSPPPPSPPPPSPPP 2567 Score = 35.1 bits (77), Expect = 2.8 Identities = 21/67 (31%), Positives = 21/67 (31%), Gaps = 1/67 (1%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXP-LPXDXXXLPPXXXPPXPPLPXPXPXXX 971 P P P P P P S P P PP PP PP P P P Sbjct: 2703 PPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPLP 2762 Query: 972 PLPXXXP 992 P P P Sbjct: 2763 PAPSPPP 2769 Score = 34.7 bits (76), Expect = 3.8 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 2714 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPP 2773 Score = 34.3 bits (75), Expect = 5.0 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSP-XXXPSXPPP 991 SP PP PP+ PPP P P PS PPP Sbjct: 2285 SPPPPPPTPPPSPPPPSPPPPSPPPPSPPPPSQPPP 2320 Score = 33.9 bits (74), Expect = 6.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P SP P P P Sbjct: 235 PPPSPPPPSPPPPPPPSPPPPPPPPLP 261 Score = 33.9 bits (74), Expect = 6.6 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P P PS PPP Sbjct: 2671 PPPPSPPPSPPPPSPP-PSPPPSPPPP 2696 Score = 33.9 bits (74), Expect = 6.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP P PPP P P PS PPP Sbjct: 2757 PPPPLPPAPSPPPSPPPPSPPPSPPPP 2783 Score = 33.5 bits (73), Expect = 8.7 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 SP P PP+ PPP P P P PPP Sbjct: 2528 SPPSPPPPSPPPSPPPSPPPPLPPPPSPPPPSPPP 2562 >UniRef50_Q3HTK4 Cluster: Pherophorin-C3 protein precursor; n=1; Chlamydomonas reinhardtii|Rep: Pherophorin-C3 protein precursor - Chlamydomonas reinhardtii Length = 443 Score = 38.7 bits (86), Expect = 0.23 Identities = 20/56 (35%), Positives = 21/56 (37%) Frame = +2 Query: 824 PXIPTTLXVSXRPFCXGWRXXSPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 P PT + PF P PP PP PPP P SP P PPP Sbjct: 202 PTFPTPVSAPPPPF-----RDRPVASPSPPPPPPPPPPPPPPPPPSPPPPPPPPPP 252 Score = 37.1 bits (82), Expect = 0.70 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P PS PPP Sbjct: 239 PPPSPPPPPPPPPPPPPPPPPPSPPPP 265 Score = 35.9 bits (79), Expect = 1.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P P P PPP Sbjct: 234 PPPPPPPPSPPPPPPPPPPPPPPPPPP 260 Score = 35.9 bits (79), Expect = 1.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P+ PPP Sbjct: 246 PPPPPPPPPPPPPPPSPPPPSPNPPPP 272 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPPXK 997 PP PP PPP P SP PPP K Sbjct: 245 PPPPPPPPPPPPPPPPSPPPPSPNPPPPK 273 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 233 PPPPPPPPPSPPPPPPPPPPPPPPPPP 259 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 238 PPPPSPPPPPPPPPPPPPPPPPPSPPP 264 >UniRef50_Q4U2V7 Cluster: Hydroxyproline-rich glycoprotein GAS31 precursor; n=2; Chlamydomonas reinhardtii|Rep: Hydroxyproline-rich glycoprotein GAS31 precursor - Chlamydomonas reinhardtii Length = 647 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +2 Query: 890 PXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 P + PP PP PPP P SP P PPP Sbjct: 242 PPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 275 Score = 36.7 bits (81), Expect = 0.93 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 SP PP PP PPP P P P PPP Sbjct: 234 SPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPP 268 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 250 PPPPPPPPPPPPPPPSPPPPPPPPPPP 276 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 252 PPPPPPPPPPPPPSPPPPPPPPPPPPP 278 Score = 33.9 bits (74), Expect = 6.6 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 SP PP PP PPP P P PS PPP Sbjct: 236 SPSPRPPPPPMPPPPPPPPPP-PPPPPPPPSPPPP 269 Score = 33.5 bits (73), Expect = 8.7 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 2/59 (3%) Frame = +3 Query: 804 PXPXXVXPXFX--PHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P V P P P SA + P P PP PP PP P P P P Sbjct: 205 PSPPPVTPAVRRPPPSSPPPPPSASSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPP 263 Score = 33.5 bits (73), Expect = 8.7 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 SP P PP PPP P P P PPP Sbjct: 230 SPPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPP 264 >UniRef50_A7DWG3 Cluster: Cell wall glycoprotein GP2; n=4; Chlamydomonas reinhardtii|Rep: Cell wall glycoprotein GP2 - Chlamydomonas reinhardtii Length = 1226 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 SP + PP PP+ PPP P P P PPP Sbjct: 966 SPPPPVLSPPPSPPPPSPPPPAPPPPSPPPPVPPP 1000 Score = 37.1 bits (82), Expect = 0.70 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 SP PP PP+ PPP P P P PPP Sbjct: 961 SPPPPSPPPPVLSPPPSPPPPSPPPPAPPPPSPPP 995 Score = 36.3 bits (80), Expect = 1.2 Identities = 19/60 (31%), Positives = 22/60 (36%), Gaps = 2/60 (3%) Frame = +2 Query: 818 CAPXIPTTLXVSXRPFCXGWRXXSPXXGLXXPPXXXXPP--TXPPPXPXSPXXXPSXPPP 991 C+ +PT V+ C P PP PP PPP P P P PPP Sbjct: 931 CSRDVPTNPAVAVLDLCCPLPPSPPPPTPPSPPPPSPPPPVLSPPPSPPPPSPPPPAPPP 990 Score = 35.9 bits (79), Expect = 1.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P P P PPP Sbjct: 984 PPPAPPPPSPPPPVPPPPSPPPPSPPP 1010 Score = 35.5 bits (78), Expect = 2.2 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P S P P PP PP PP P P P P Sbjct: 954 PPPPTPPSPPPPSPP----PPVLSPPPSPPPPSPPPPAPPPPSPPPPVPPPPSPPPPSPP 1009 Query: 975 LPXXXP 992 P P Sbjct: 1010 PPSPPP 1015 Score = 35.5 bits (78), Expect = 2.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 979 PPPSPPPPAPPPPSPPPPVPPPPSPPP 1005 Score = 34.7 bits (76), Expect = 3.8 Identities = 19/66 (28%), Positives = 19/66 (28%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P Sbjct: 960 PSPPPPSPPPPVLSPPPSPPPPSPPPPAPPPPSPPPPVPPPPSPPPPSPPPPSPPPAAAS 1019 Query: 975 LPXXXP 992 P P Sbjct: 1020 PPPSPP 1025 Score = 33.9 bits (74), Expect = 6.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP SP P PPP Sbjct: 1003 PPPPSPPPPSPPPAAASPPPSPPPPPP 1029 Score = 33.5 bits (73), Expect = 8.7 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +3 Query: 888 PLPXDXXXLPPXXXP-PXPPLPXPXPXXXPLPXXXP 992 PLP LPP P P PP P P PLP P Sbjct: 304 PLPPSPAPLPPSPPPSPLPPSPKPPTPPSPLPPAPP 339 Score = 33.5 bits (73), Expect = 8.7 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P Sbjct: 980 PPSPPPPAPPPPSPPPPVPPPPSPPPPSPPPPSPPPAAASPPPSPPPPPP-PSPPPPVAR 1038 Query: 975 LPXXXP 992 LP P Sbjct: 1039 LPPWPP 1044 >UniRef50_A4S9A6 Cluster: Predicted protein; n=1; Ostreococcus lucimarinus CCE9901|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 4076 Score = 38.3 bits (85), Expect = 0.31 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = +2 Query: 866 CXGWRXXSPXXGLXXPPXXXXPPT-XPPPXPXSPXXXPSXPPP 991 C G SP PP PP+ PPP P P PS PPP Sbjct: 76 CEGIANCSPPPSPPPPPSPPPPPSPPPPPSPPPPSPPPSPPPP 118 Score = 37.1 bits (82), Expect = 0.70 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 SP PP PP+ PPP P P P PPP Sbjct: 2083 SPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPP 2117 Score = 37.1 bits (82), Expect = 0.70 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 SP PP PP+ PPP P P P PPP Sbjct: 2088 SPPPPSPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 2122 Score = 36.7 bits (81), Expect = 0.93 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPPXK 997 PP PP PPP P P P PPP K Sbjct: 1669 PPPPSPPPPSPPPSPPPPSPSPPPPPPGK 1697 Score = 36.7 bits (81), Expect = 0.93 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 SP PP PP+ PPP P P P PPP Sbjct: 2093 SPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 2127 Score = 35.9 bits (79), Expect = 1.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P P P PPP Sbjct: 1870 PPSPPPPPSPPPPSPPPPSPPPPSPPP 1896 Score = 35.1 bits (77), Expect = 2.8 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +2 Query: 878 RXXSPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 R SP PP P P P P SP PS PPP Sbjct: 2066 RIASPPPPSPPPPSPPPSPPPPSPPPPSPPPPPSPPPP 2103 Score = 34.7 bits (76), Expect = 3.8 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P PS PPP Sbjct: 97 PPSPPPPPSPPPPSPPPSPPPPSPPPP 123 Score = 34.3 bits (75), Expect = 5.0 Identities = 18/59 (30%), Positives = 20/59 (33%) Frame = +3 Query: 804 PXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXPLP 980 P P P P P + + P P PP PP PP P P P P P Sbjct: 2070 PPPPSPPPPSPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 2128 Score = 33.5 bits (73), Expect = 8.7 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPPXK 997 PP PP PP P P P PPP K Sbjct: 1873 PPPPPSPPPPSPPPPSPPPPSPPPPPPGK 1901 >UniRef50_P21997 Cluster: Sulfated surface glycoprotein 185 precursor; n=1; Volvox carteri|Rep: Sulfated surface glycoprotein 185 precursor - Volvox carteri Length = 485 Score = 38.3 bits (85), Expect = 0.31 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 SP PP PP PPP P P PS PPP Sbjct: 247 SPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPP 281 Score = 37.1 bits (82), Expect = 0.70 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P SP P PPP Sbjct: 261 PPPPPPPPPPPPPPPPSPPPPPPPPPP 287 Score = 35.9 bits (79), Expect = 1.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P P P PPP Sbjct: 244 PPPSPRPPSPPPPSPSPPPPPPPPPPP 270 Score = 35.9 bits (79), Expect = 1.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P P P PPP Sbjct: 269 PPPPPPPPSPPPPPPPPPPPPPPPPPP 295 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPPXK 997 PP PP PPP P P PS PP K Sbjct: 274 PPPSPPPPPPPPPPPPPPPPPPSPSPPRK 302 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 262 PPPPPPPPPPPPPPPSPPPPPPPPPPP 288 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 264 PPPPPPPPPPPPPSPPPPPPPPPPPPP 290 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 268 PPPPPPPPPSPPPPPPPPPPPPPPPPP 294 Score = 33.9 bits (74), Expect = 6.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P PS PP Sbjct: 283 PPPPPPPPPPPPPSPSPPRKPPSPSPP 309 Score = 33.5 bits (73), Expect = 8.7 Identities = 18/58 (31%), Positives = 19/58 (32%) Frame = +3 Query: 825 PXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXPLPXXXPXK 998 P P P S P P PP PP PP P P P P P P + Sbjct: 244 PPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPR 301 >UniRef50_Q4A2Z7 Cluster: Putative membrane protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein precursor - Emiliania huxleyi virus 86 Length = 516 Score = 37.9 bits (84), Expect = 0.40 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P P PS PPP Sbjct: 123 PPPSPSPPSPPPPSPPPPSISPSPPPP 149 Score = 35.9 bits (79), Expect = 1.6 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 51 PPSPPPSPPPPLPPPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPP 110 Query: 975 LPXXXP 992 P P Sbjct: 111 PPSPPP 116 Score = 35.9 bits (79), Expect = 1.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P P P PPP Sbjct: 95 PPPSPPPPSPPPPSPPPPSPPPPSPPP 121 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPP 988 PP PP+ PPP P P PS PP Sbjct: 100 PPPSPPPPSPPPPSPPPPSPPPSPPP 125 Score = 34.7 bits (76), Expect = 3.8 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 866 CXGWRXXSPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 C G P PP PP PPP P P PS PPP Sbjct: 12 CGGAYATPPSPPPPSPPPPSPPPPSPPPLP-PPLPPPSPPPP 52 Score = 34.7 bits (76), Expect = 3.8 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P PS PPP Sbjct: 49 PPPPSPPPSPPPPLPPPSPSPPSPPPP 75 Score = 34.7 bits (76), Expect = 3.8 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P P PS P P Sbjct: 207 PPPSPPPPSPPPPPPPPPPPPPSPPSP 233 Score = 34.3 bits (75), Expect = 5.0 Identities = 20/66 (30%), Positives = 22/66 (33%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P + + P P PP PP PP P P P P Sbjct: 42 PPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSPPPPSPPPPSPPSPP-PSPPPPSPP 100 Query: 975 LPXXXP 992 P P Sbjct: 101 PPSPPP 106 Score = 33.9 bits (74), Expect = 6.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 P PP PPP P P PS PPP Sbjct: 35 PSPPPLPPPLPPPSPPPPSPPPSPPPP 61 Score = 33.9 bits (74), Expect = 6.6 Identities = 20/66 (30%), Positives = 21/66 (31%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P + P P PP PP PP P P P P Sbjct: 69 PPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPP-PPSPPPSPPPSP 127 Query: 975 LPXXXP 992 P P Sbjct: 128 SPPSPP 133 Score = 33.9 bits (74), Expect = 6.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P PS PPP Sbjct: 109 PPPPSPPPPSPPPSPPPSPSPPSPPPP 135 Score = 33.9 bits (74), Expect = 6.6 Identities = 18/60 (30%), Positives = 22/60 (36%) Frame = +2 Query: 809 PXXCAPXIPTTLXVSXRPFCXGWRXXSPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPP 988 P +P P++ + P P PP PP PPP P SP PS P Sbjct: 182 PPSISPSPPSSASPTPPPPSASPSPPPPSPPPPSPPPPPPPPPPPPPSPPSPNPPPSASP 241 Score = 33.5 bits (73), Expect = 8.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 915 PPXXXPPXPPLPXPXPXXXPLPXXXP 992 PP PP PP P P P PLP P Sbjct: 24 PPSPPPPSPPPPSPPPLPPPLPPPSP 49 >UniRef50_A6UHC7 Cluster: Outer membrane autotransporter barrel domain; n=1; Sinorhizobium medicae WSM419|Rep: Outer membrane autotransporter barrel domain - Sinorhizobium medicae WSM419 Length = 864 Score = 37.9 bits (84), Expect = 0.40 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P SP P PPP Sbjct: 496 PPPPPPPPSPPPPPPPSPPPPPPPPPP 522 Score = 35.5 bits (78), Expect = 2.2 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 875 WRXXSPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 W S PP PP PPP P P P PPP Sbjct: 477 WFLRSGGVSPPPPPPPPPPPPPPPPPPSPPPPPPPSPPP 515 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 499 PPPPPSPPPPPPPSPPPPPPPPPPPPP 525 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 507 PPPPPSPPPPPPPPPPPPPPPPPPPPP 533 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 508 PPPPSPPPPPPPPPPPPPPPPPPPPPP 534 Score = 33.9 bits (74), Expect = 6.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P PS PPP Sbjct: 490 PPPPPPPPPPPPPPSPPPPPPPSPPPP 516 >UniRef50_Q852P0 Cluster: Pherophorin; n=2; Eukaryota|Rep: Pherophorin - Volvox carteri f. nagariensis Length = 606 Score = 37.9 bits (84), Expect = 0.40 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 SP PP PP PPP P SP P PPP Sbjct: 216 SPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPP 250 Score = 37.1 bits (82), Expect = 0.70 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P SP P PPP Sbjct: 212 PPPPSPPPPPPPPPPPSPPPPPPPPPP 238 Score = 35.9 bits (79), Expect = 1.6 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P S P P PP PP PP P P P P Sbjct: 205 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSP 264 Query: 975 LP 980 P Sbjct: 265 PP 266 Score = 35.9 bits (79), Expect = 1.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P P P PPP Sbjct: 208 PPPPPPPPSPPPPPPPPPPPSPPPPPP 234 Score = 35.9 bits (79), Expect = 1.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P P P PPP Sbjct: 232 PPPPPPPPSPPPPPPPPPPPSPPPPPP 258 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 213 PPPSPPPPPPPPPPPSPPPPPPPPPPP 239 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 225 PPPSPPPPPPPPPPPSPPPPPPPPPPP 251 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 243 PPPPPPPPPSPPPPPPPPSPSPPPPPP 269 Score = 34.7 bits (76), Expect = 3.8 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 SP PP PP PPP P SP P P P Sbjct: 228 SPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSP 262 Score = 34.7 bits (76), Expect = 3.8 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 SP PP PP PPP P P PS PP Sbjct: 240 SPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPP 274 Score = 33.9 bits (74), Expect = 6.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PP P P PS PPP Sbjct: 206 PPPPPPPPPPSPPPPPPPPPPPSPPPP 232 Score = 33.9 bits (74), Expect = 6.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP P P P P PS PPP Sbjct: 250 PPSPPPPPPPPSPSPPPPPPSPSPPPP 276 Score = 33.9 bits (74), Expect = 6.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP P PPP P SP P PPP Sbjct: 254 PPPPPPPSPSPPPPPPSPSPPPPPPPP 280 >UniRef50_P93797 Cluster: Pherophorin-S precursor; n=1; Volvox carteri|Rep: Pherophorin-S precursor - Volvox carteri Length = 599 Score = 37.9 bits (84), Expect = 0.40 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 SP PP PP PPP P SP P PPP Sbjct: 252 SPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 286 Score = 36.7 bits (81), Expect = 0.93 Identities = 20/66 (30%), Positives = 21/66 (31%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P + P P PP PP PP P P P P Sbjct: 224 PSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPP 283 Query: 975 LPXXXP 992 P P Sbjct: 284 PPPPPP 289 Score = 36.3 bits (80), Expect = 1.2 Identities = 20/66 (30%), Positives = 21/66 (31%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P + P P PP PP PP P P P P Sbjct: 226 PPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPP 285 Query: 975 LPXXXP 992 P P Sbjct: 286 PPPPPP 291 Score = 35.9 bits (79), Expect = 1.6 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 240 PPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 299 Query: 975 LPXXXP 992 P P Sbjct: 300 PPPVYP 305 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +2 Query: 902 LXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 L P PP+ PPP P SP P PPP Sbjct: 214 LPNAPPSPLPPSPPPPPPPSPPPSPPPPPP 243 Score = 35.1 bits (77), Expect = 2.8 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 888 PLPXDXXXLPPXXXPPXPPLPXPXPXXXPLPXXXP 992 PLP PP PP PP P P P P P P Sbjct: 221 PLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPP 255 Score = 34.7 bits (76), Expect = 3.8 Identities = 21/74 (28%), Positives = 22/74 (29%) Frame = +3 Query: 771 SXXSRXXXPXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLP 950 S S P P P P P + P P PP PP PP P Sbjct: 205 SQASTLPLPLPNAPPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPP 264 Query: 951 XPXPXXXPLPXXXP 992 P P P P P Sbjct: 265 PPPPPPPPPPPSPP 278 Score = 34.7 bits (76), Expect = 3.8 Identities = 19/63 (30%), Positives = 20/63 (31%) Frame = +3 Query: 804 PXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXPLPX 983 P P P P P + P P PP PP PP P P P P P Sbjct: 219 PSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPP 278 Query: 984 XXP 992 P Sbjct: 279 PPP 281 Score = 33.5 bits (73), Expect = 8.7 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 239 PPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 298 Query: 975 LP 980 P Sbjct: 299 PP 300 >UniRef50_Q5CS67 Cluster: Signal peptide containing large protein with proline stretches; n=2; Cryptosporidium|Rep: Signal peptide containing large protein with proline stretches - Cryptosporidium parvum Iowa II Length = 1884 Score = 37.9 bits (84), Expect = 0.40 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 890 PXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 P G PP PP PPP P P P PPP Sbjct: 1538 PSSGSSAPPPPPPPPPPPPPPPPPPPSPPPSPPP 1571 Score = 37.1 bits (82), Expect = 0.70 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P SP P PPP Sbjct: 1422 PPPHSPPPPPPPPPPSSPPSPPPSPPP 1448 >UniRef50_Q581C6 Cluster: Flagellum-adhesion glycoprotein, putative; n=2; Trypanosoma brucei|Rep: Flagellum-adhesion glycoprotein, putative - Trypanosoma brucei Length = 590 Score = 37.9 bits (84), Expect = 0.40 Identities = 19/55 (34%), Positives = 21/55 (38%) Frame = +2 Query: 824 PXIPTTLXVSXRPFCXGWRXXSPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPP 988 P P T V P SP + PP PP PPP P +P P PP Sbjct: 343 PTPPPTPSVPPSPSPSPSASPSPSPSVQPPPPPPPPPPPPPPPPITPNPDPPSPP 397 >UniRef50_UPI0000DB6CCB Cluster: PREDICTED: hypothetical protein; n=1; Apis mellifera|Rep: PREDICTED: hypothetical protein - Apis mellifera Length = 394 Score = 37.5 bits (83), Expect = 0.53 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 888 PLPXDXXXLPPXXXPPXPPLPXPXPXXXPLPXXXP 992 P P PP PP PPLP P P PLP P Sbjct: 253 PPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPP 287 Score = 35.9 bits (79), Expect = 1.6 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 890 PXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 P + PP PP PPP P P P PPP Sbjct: 228 PQVQVVPPPPPPPPPPPPPPPPPPPPPPPPPPPP 261 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 236 PPPPPPPPPPPPPPPPPPPPPPPPPPP 262 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 237 PPPPPPPPPPPPPPPPPPPPPPPPPPP 263 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 238 PPPPPPPPPPPPPPPPPPPPPPPPPPP 264 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 239 PPPPPPPPPPPPPPPPPPPPPPPPPPP 265 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 240 PPPPPPPPPPPPPPPPPPPPPPPPPPP 266 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPLPPP 275 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 252 PPPPPPPPPPPPPPPPPPPPLPPPPPP 278 Score = 34.7 bits (76), Expect = 3.8 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 888 PLPXDXXXLPPXXXPPXPPLPXPXPXXXPLPXXXP 992 P P PP PP PP P P P PLP P Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPP 277 >UniRef50_Q948Y7 Cluster: VMP3 protein; n=1; Volvox carteri f. nagariensis|Rep: VMP3 protein - Volvox carteri f. nagariensis Length = 687 Score = 37.5 bits (83), Expect = 0.53 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 584 PPSPDPPSAPPPSPPPPSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPPPPSPP 643 Query: 975 LPXXXP 992 P P Sbjct: 644 PPSPRP 649 Score = 37.1 bits (82), Expect = 0.70 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 579 PPSPDPPSPDPPSAPPPSPPPPSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPP 638 Query: 975 LPXXXP 992 P P Sbjct: 639 PPSPPP 644 Score = 37.1 bits (82), Expect = 0.70 Identities = 20/68 (29%), Positives = 21/68 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 594 PPSPPPPSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPPPPSPPPPSPRPPTPP 653 Query: 975 LPXXXPXK 998 P P + Sbjct: 654 PPSPPPPR 661 Score = 34.7 bits (76), Expect = 3.8 Identities = 19/66 (28%), Positives = 19/66 (28%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 609 PPSPPPPNPPPPSPPPPSPPPPSPPPPNPPPPSPPPPSPRPPTPPPPSPPPPRPPPRPPP 668 Query: 975 LPXXXP 992 P Sbjct: 669 TRRSPP 674 Score = 34.3 bits (75), Expect = 5.0 Identities = 19/66 (28%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P + P P PP PP P P P P P Sbjct: 544 PSPPPPSPPSPPTSPSPPDPAWANLPTSPDPPSPNPPSPDPPSPDPPSAPPPSPPPPSPP 603 Query: 975 LPXXXP 992 P P Sbjct: 604 PPNPPP 609 Score = 33.9 bits (74), Expect = 6.6 Identities = 19/66 (28%), Positives = 19/66 (28%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P PP PP PP P P P P Sbjct: 574 PPSPNPPSPDPPSPDPPSAPPPSPPPPSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPP 633 Query: 975 LPXXXP 992 P P Sbjct: 634 PPNPPP 639 Score = 33.5 bits (73), Expect = 8.7 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 902 LXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 L P PP+ PPP P P P PPP Sbjct: 475 LPSAPPSPPPPSPPPPRPPPPSPVPPTPPP 504 Score = 33.5 bits (73), Expect = 8.7 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P PS PP Sbjct: 483 PPPSPPPPRPPPPSPVPPTPPPSPRPP 509 Score = 33.5 bits (73), Expect = 8.7 Identities = 19/66 (28%), Positives = 19/66 (28%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP P P P P P Sbjct: 599 PPSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPPPPSPPPPSPRPPTPPPPSPP 658 Query: 975 LPXXXP 992 P P Sbjct: 659 PPRPPP 664 >UniRef50_Q42421 Cluster: Chitinase; n=1; Beta vulgaris subsp. vulgaris|Rep: Chitinase - Beta vulgaris subsp. vulgaris Length = 439 Score = 37.5 bits (83), Expect = 0.53 Identities = 22/71 (30%), Positives = 22/71 (30%) Frame = +3 Query: 780 SRXXXPXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPX 959 SR P P P P P P P P PP PP PP P P Sbjct: 49 SRPTPPRPPTPRPPPPR-PPTPRPPPPRPPTPRPPPPTPRPPPPRPPTPRPPPPPTPRPP 107 Query: 960 PXXXPLPXXXP 992 P P P P Sbjct: 108 PPRPPTPRPPP 118 Score = 34.3 bits (75), Expect = 5.0 Identities = 20/70 (28%), Positives = 20/70 (28%) Frame = +3 Query: 783 RXXXPXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXP 962 R P P P P P P P PP PP PP P P P Sbjct: 75 RPPTPRPPPPTPRPPPPRPPTPRPPPPPTPRPPPPRPPTPRPPPPPTPRPPPPPTPRPPP 134 Query: 963 XXXPLPXXXP 992 P P P Sbjct: 135 PSPPTPRPPP 144 Score = 33.5 bits (73), Expect = 8.7 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 783 RXXXPXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXP 962 R P P P P P P P P PP PP PP P P P Sbjct: 70 RPPPPRPPTPRPPPPTPRPPPPRPPTPRPPP---PPTPRPPPPRPPTPRPPPPPTPRPPP 126 Query: 963 XXXPLP 980 P P Sbjct: 127 PPTPRP 132 >UniRef50_Q3HTK5 Cluster: Pherophorin-C2 protein precursor; n=8; Chlamydomonadales|Rep: Pherophorin-C2 protein precursor - Chlamydomonas reinhardtii Length = 853 Score = 37.5 bits (83), Expect = 0.53 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 385 PPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSP 444 Query: 975 LPXXXP 992 P P Sbjct: 445 PPPPPP 450 Score = 37.1 bits (82), Expect = 0.70 Identities = 20/66 (30%), Positives = 22/66 (33%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P + + P P PP PP PP P P P P Sbjct: 210 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPP 269 Query: 975 LPXXXP 992 P P Sbjct: 270 PPSPPP 275 Score = 37.1 bits (82), Expect = 0.70 Identities = 20/66 (30%), Positives = 22/66 (33%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P + + P P PP PP PP P P P P Sbjct: 401 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 460 Query: 975 LPXXXP 992 P P Sbjct: 461 PPPPPP 466 Score = 36.7 bits (81), Expect = 0.93 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 415 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPP 474 Query: 975 LPXXXP 992 P P Sbjct: 475 PPSPPP 480 Score = 36.3 bits (80), Expect = 1.2 Identities = 20/66 (30%), Positives = 21/66 (31%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P + P P PP PP PP P P P P Sbjct: 220 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPP 279 Query: 975 LPXXXP 992 P P Sbjct: 280 SPPPPP 285 Score = 36.3 bits (80), Expect = 1.2 Identities = 20/66 (30%), Positives = 21/66 (31%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P + P P PP PP PP P P P P Sbjct: 238 PPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 297 Query: 975 LPXXXP 992 P P Sbjct: 298 PPPSPP 303 Score = 36.3 bits (80), Expect = 1.2 Identities = 20/63 (31%), Positives = 20/63 (31%) Frame = +3 Query: 804 PXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXPLPX 983 P P P P P S P P PP PP PP P P P P P Sbjct: 348 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPS 407 Query: 984 XXP 992 P Sbjct: 408 PPP 410 Score = 36.3 bits (80), Expect = 1.2 Identities = 20/63 (31%), Positives = 20/63 (31%) Frame = +3 Query: 804 PXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXPLPX 983 P P P P P S P P PP PP PP P P P P P Sbjct: 462 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPS 521 Query: 984 XXP 992 P Sbjct: 522 PPP 524 Score = 35.9 bits (79), Expect = 1.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P P P PPP Sbjct: 193 PPPSPPPPSPPPPSPPPPSPPPPSPPP 219 Score = 35.9 bits (79), Expect = 1.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P P P PPP Sbjct: 198 PPPSPPPPSPPPPSPPPPSPPPPSPPP 224 Score = 35.9 bits (79), Expect = 1.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P P P PPP Sbjct: 203 PPPSPPPPSPPPPSPPPPSPPPPSPPP 229 Score = 35.9 bits (79), Expect = 1.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P P P PPP Sbjct: 208 PPPSPPPPSPPPPSPPPPSPPPPSPPP 234 Score = 35.9 bits (79), Expect = 1.6 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P S P P PP PP PP P P P P Sbjct: 330 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPP-PSPPPPSPPPPSPPPPPPPSPPPPPPP 388 Query: 975 LPXXXP 992 P P Sbjct: 389 SPPPPP 394 Score = 35.9 bits (79), Expect = 1.6 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P S P P PP PP PP P P P P Sbjct: 400 PPSPPPPSPPPPSPPPPS-PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPP 458 Query: 975 LPXXXP 992 P P Sbjct: 459 SPPPPP 464 Score = 35.9 bits (79), Expect = 1.6 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P S P P PP PP PP P P P P Sbjct: 444 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPP-PSPPPPSPPPPSPPPPPPPSPPPPPPP 502 Query: 975 LPXXXP 992 P P Sbjct: 503 SPPPPP 508 Score = 35.9 bits (79), Expect = 1.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P P P PPP Sbjct: 508 PPPSPPPPSPPPPSPPPPSPPPPSPPP 534 Score = 35.9 bits (79), Expect = 1.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P P P PPP Sbjct: 513 PPPSPPPPSPPPPSPPPPSPPPPSPPP 539 Score = 35.5 bits (78), Expect = 2.2 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P S P P PP PP PP P P P P Sbjct: 245 PPPPSPPPPSPP-PPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPP 303 Query: 975 LPXXXP 992 P P Sbjct: 304 PPSPPP 309 Score = 35.5 bits (78), Expect = 2.2 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P S P P PP PP PP P P P P Sbjct: 302 PPPPSPPPPPPPSPPPPS-PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPP 360 Query: 975 LPXXXP 992 P P Sbjct: 361 PPSPPP 366 Score = 34.7 bits (76), Expect = 3.8 Identities = 19/66 (28%), Positives = 19/66 (28%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P Sbjct: 194 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 253 Query: 975 LPXXXP 992 P P Sbjct: 254 SPPPPP 259 Score = 34.7 bits (76), Expect = 3.8 Identities = 19/62 (30%), Positives = 20/62 (32%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P + P P PP PP PP P P P P Sbjct: 215 PSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPP 274 Query: 975 LP 980 P Sbjct: 275 PP 276 Score = 34.7 bits (76), Expect = 3.8 Identities = 20/66 (30%), Positives = 22/66 (33%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P + + P P PP PP PP P P P P Sbjct: 229 PPSPPPPSPPPPPPPSPP-PPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 287 Query: 975 LPXXXP 992 P P Sbjct: 288 SPPPPP 293 Score = 34.7 bits (76), Expect = 3.8 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P SP P PP Sbjct: 321 PPPSPPPPSPPPPPPPSPPPPPPPSPP 347 Score = 34.7 bits (76), Expect = 3.8 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P S P P PP PP PP P P P P Sbjct: 322 PPSPPPPSPPPPPPPSPPPPPPPSPPPP-PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 380 Query: 975 LPXXXP 992 P P Sbjct: 381 SPPPPP 386 Score = 34.7 bits (76), Expect = 3.8 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P S P PP PP PP P P P P Sbjct: 420 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 479 Query: 975 LPXXXP 992 P P Sbjct: 480 PPSPPP 485 Score = 34.7 bits (76), Expect = 3.8 Identities = 19/63 (30%), Positives = 20/63 (31%) Frame = +3 Query: 804 PXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXPLPX 983 P P P P P + P P PP PP PP P P P P P Sbjct: 438 PPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 497 Query: 984 XXP 992 P Sbjct: 498 PPP 500 Score = 34.3 bits (75), Expect = 5.0 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P S P P PP PP PP P P P P Sbjct: 366 PPSPPPPSPPPPPPPSPPPPPPPSPPPP-PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 424 Query: 975 LPXXXP 992 P P Sbjct: 425 PPSPPP 430 Score = 33.9 bits (74), Expect = 6.6 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P P PS PPP Sbjct: 293 PPPSPPPPSPPPPSPPPPPP-PSPPPP 318 Score = 33.9 bits (74), Expect = 6.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P PS PPP Sbjct: 297 PPPPSPPPPSPPPPPPPSPPPPSPPPP 323 Score = 33.9 bits (74), Expect = 6.6 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P P PS PPP Sbjct: 316 PPPSPPPPSPPPPSPPPPPP-PSPPPP 341 Score = 33.9 bits (74), Expect = 6.6 Identities = 19/66 (28%), Positives = 21/66 (31%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P + + P PP PP PP P P P P Sbjct: 391 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPP 450 Query: 975 LPXXXP 992 P P Sbjct: 451 SPPPPP 456 Score = 33.9 bits (74), Expect = 6.6 Identities = 20/66 (30%), Positives = 21/66 (31%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P + P P PP PP PP P P P P Sbjct: 410 PPSPPPPSPPPPSPPPPS-PPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 468 Query: 975 LPXXXP 992 P P Sbjct: 469 PPPSPP 474 Score = 33.9 bits (74), Expect = 6.6 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P P PS PPP Sbjct: 523 PPPSPPPPSPPPPSPPPPPP-PSPPPP 548 Score = 33.9 bits (74), Expect = 6.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P PS PPP Sbjct: 527 PPPPSPPPPSPPPPPPPSPPPPSPPPP 553 Score = 33.5 bits (73), Expect = 8.7 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P S P P PP PP PP P P P P Sbjct: 273 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPP-PSPPPPPPPSPPPPSPPPPSPPPPSPP 331 Query: 975 LP 980 P Sbjct: 332 PP 333 Score = 33.5 bits (73), Expect = 8.7 Identities = 20/66 (30%), Positives = 21/66 (31%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P + P P PP PP PP P P P P Sbjct: 289 PPPPPPPSPPPPSPP----PPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 344 Query: 975 LPXXXP 992 P P Sbjct: 345 SPPPPP 350 Score = 33.5 bits (73), Expect = 8.7 Identities = 20/66 (30%), Positives = 21/66 (31%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P + P P PP PP PP P P P P Sbjct: 312 PPSPPPPSPPPPSPPPPS-PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPP 370 Query: 975 LPXXXP 992 P P Sbjct: 371 PPSPPP 376 Score = 33.5 bits (73), Expect = 8.7 Identities = 20/66 (30%), Positives = 21/66 (31%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P + P P PP PP PP P P P P Sbjct: 356 PPSPPPPSPPPPSPPPPS-PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPP 414 Query: 975 LPXXXP 992 P P Sbjct: 415 PPSPPP 420 Score = 33.5 bits (73), Expect = 8.7 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P P Sbjct: 361 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP-PPSPPPPSPPPPSPPPPSPP 419 Query: 975 LPXXXP 992 P P Sbjct: 420 PPSPPP 425 Score = 33.5 bits (73), Expect = 8.7 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 SP P PP+ PPP P P P PPP Sbjct: 381 SPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP 415 Score = 33.5 bits (73), Expect = 8.7 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P S P P PP PP PP P P P P Sbjct: 428 PPPPPPPSPPPPPPPSPPPPPPPSPPP---PPPPSPPPPPPPSPPPPSPPPPSPPPPSPP 484 Query: 975 LPXXXP 992 P P Sbjct: 485 PPSPPP 490 Score = 33.5 bits (73), Expect = 8.7 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 SP P PP+ PPP P P P PPP Sbjct: 495 SPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP 529 >UniRef50_A7SGL4 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 620 Score = 37.5 bits (83), Expect = 0.53 Identities = 19/63 (30%), Positives = 22/63 (34%) Frame = +3 Query: 804 PXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXPLPX 983 P P P P YP + + P P PP PP P+P P P P P Sbjct: 395 PYPPPPAPYPPPSAPYPAPYTPPSPPPPPCPVPCPPPPPPPPPPPCPVPCPPPPPPPPPS 454 Query: 984 XXP 992 P Sbjct: 455 PPP 457 >UniRef50_A0VF81 Cluster: Putative uncharacterized protein; n=4; Proteobacteria|Rep: Putative uncharacterized protein - Delftia acidovorans SPH-1 Length = 1679 Score = 37.1 bits (82), Expect = 0.70 Identities = 22/56 (39%), Positives = 25/56 (44%) Frame = +2 Query: 821 APXIPTTLXVSXRPFCXGWRXXSPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPP 988 AP +P + S FC SP L PP PP+ PP P SP PS PP Sbjct: 314 APAVPPSR--SPTVFCTVVTRPSP---LPVPPPGTRPPSRPPTRPSSPNTPPSRPP 364 Score = 37.1 bits (82), Expect = 0.70 Identities = 22/56 (39%), Positives = 25/56 (44%) Frame = +2 Query: 821 APXIPTTLXVSXRPFCXGWRXXSPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPP 988 AP +P + S FC SP L PP PP+ PP P SP PS PP Sbjct: 585 APAVPPSR--SPTVFCTVVTRPSP---LPVPPPGTRPPSRPPTRPSSPSTPPSRPP 635 >UniRef50_Q9LUI1 Cluster: Extensin protein-like; n=10; Magnoliophyta|Rep: Extensin protein-like - Arabidopsis thaliana (Mouse-ear cress) Length = 470 Score = 37.1 bits (82), Expect = 0.70 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P PS PPP Sbjct: 390 PPPPPPPPPPPPPPPPPPYVYPSPPPP 416 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPP 407 >UniRef50_Q9FXA1 Cluster: F14J22.4 protein; n=2; Arabidopsis thaliana|Rep: F14J22.4 protein - Arabidopsis thaliana (Mouse-ear cress) Length = 494 Score = 37.1 bits (82), Expect = 0.70 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P PS PPP Sbjct: 66 PPPPCPPPPSPPPCPPPPSPPPSPPPP 92 >UniRef50_Q010M7 Cluster: Predicted membrane protein; n=3; Eukaryota|Rep: Predicted membrane protein - Ostreococcus tauri Length = 1449 Score = 37.1 bits (82), Expect = 0.70 Identities = 16/28 (57%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = +2 Query: 911 PPXXXXPPTXP-PPXPXSPXXXPSXPPP 991 PP PPT P PP P SP PS PPP Sbjct: 814 PPPPPNPPTPPSPPPPPSPPPPPSSPPP 841 Score = 36.3 bits (80), Expect = 1.2 Identities = 21/61 (34%), Positives = 23/61 (37%) Frame = +2 Query: 809 PXXCAPXIPTTLXVSXRPFCXGWRXXSPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPP 988 P P P+ S P SP L PP PP PP P SP P+ PP Sbjct: 890 PPPSPPPSPSPPPSSNPPLSSPPPLSSPPP-LSSPPPPSSPPPPSPPLPPSPPLPPNPPP 948 Query: 989 P 991 P Sbjct: 949 P 949 Score = 35.9 bits (79), Expect = 1.6 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = +2 Query: 929 PPTXPPPXPXSPXXXPSXPPP 991 PP+ PPP P SP PS PPP Sbjct: 788 PPSPPPPLPPSPPPPPSPPPP 808 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PP P SP PS PPP Sbjct: 809 PPPPSPPPPPNPPTPPSPPPPPSPPPP 835 Score = 33.9 bits (74), Expect = 6.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP P PPP P P PS PPP Sbjct: 791 PPPPLPPSPPPPPSPPPPPPPPSPPPP 817 Score = 33.9 bits (74), Expect = 6.6 Identities = 19/66 (28%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P + P P PP PP PP P P P P Sbjct: 823 PPSPPPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSP 882 Query: 975 LPXXXP 992 P P Sbjct: 883 PPPPSP 888 Score = 33.9 bits (74), Expect = 6.6 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 914 PXXXXPPTXPPPXPXSPXXXPSXPPP 991 P PP+ PP P SP PS PPP Sbjct: 866 PTPPPPPSPPPSPPPSPPPPPSPPPP 891 Score = 33.5 bits (73), Expect = 8.7 Identities = 14/28 (50%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = +2 Query: 911 PPXXXXPPTXP-PPXPXSPXXXPSXPPP 991 PP PP P PP P +P PS PPP Sbjct: 802 PPSPPPPPPPPSPPPPPNPPTPPSPPPP 829 Score = 33.5 bits (73), Expect = 8.7 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 SP PP PP P P SP PS PPP Sbjct: 825 SPPPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPP 859 >UniRef50_A4S6G3 Cluster: Predicted protein; n=2; Eukaryota|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 2146 Score = 37.1 bits (82), Expect = 0.70 Identities = 20/66 (30%), Positives = 21/66 (31%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P S P P P PP PP+P P P P Sbjct: 889 PPPPSPLPSPPPPSPPSPSPPPPSPLPPSPSPPPPSPPSPSPPSPPPPPPVPSPPPPSPP 948 Query: 975 LPXXXP 992 P P Sbjct: 949 PPSPPP 954 Score = 34.7 bits (76), Expect = 3.8 Identities = 21/66 (31%), Positives = 22/66 (33%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P S PLP PP P PP P P P P Sbjct: 882 PSPPPPSPPPPSPLPSPPPPSPPSPSPPPPSPLPPSPSPPPPSPPSPSPPSPPPPP---P 938 Query: 975 LPXXXP 992 +P P Sbjct: 939 VPSPPP 944 Score = 34.3 bits (75), Expect = 5.0 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = +3 Query: 804 PXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXPLPX 983 P P P P P P P LPP PP P P P P P P Sbjct: 878 PSPPPSPPPPSPPPPSPLPSPPPPSPPSPSPPPPSPLPPSPSPPPPSPPSPSPPSPPPPP 937 Query: 984 XXP 992 P Sbjct: 938 PVP 940 Score = 33.9 bits (74), Expect = 6.6 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +2 Query: 890 PXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 P + PP PP PPP P P PS PPP Sbjct: 935 PPPPVPSPPPPSPPPPSPPPLP-PPPPPPSPPPP 967 >UniRef50_P40602 Cluster: Anter-specific proline-rich protein APG precursor; n=4; Brassicaceae|Rep: Anter-specific proline-rich protein APG precursor - Arabidopsis thaliana (Mouse-ear cress) Length = 534 Score = 37.1 bits (82), Expect = 0.70 Identities = 22/71 (30%), Positives = 24/71 (33%) Frame = +3 Query: 780 SRXXXPXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPX 959 S+ P P P P P P A S P +PP PP PP P P Sbjct: 77 SKPVAPPGPSPCPSPPP-KPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPK 135 Query: 960 PXXXPLPXXXP 992 P P P P Sbjct: 136 PAPPPEPKPAP 146 >UniRef50_Q4A373 Cluster: Putative lectin protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative lectin protein precursor - Emiliania huxleyi virus 86 Length = 1994 Score = 36.7 bits (81), Expect = 0.93 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ P P P SP PS PPP Sbjct: 693 PPPSPPPPSPPSPPPPSPPPPPSPPPP 719 Score = 33.9 bits (74), Expect = 6.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 914 PXXXXPPTXPPPXPXSPXXXPSXPPP 991 P PP PPP P SP P PPP Sbjct: 490 PPPPTPPPSPPPPPPSPPPSPFLPPP 515 Score = 33.9 bits (74), Expect = 6.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP P PPP P P PS PPP Sbjct: 702 PPSPPPPSPPPPPSPPPPSLPPSPPPP 728 Score = 33.5 bits (73), Expect = 8.7 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 SP P PP PPP P P P PPP Sbjct: 1444 SPPPSPPPSPPPSPPPLQPPPSPPPPLLPPPFPPP 1478 >UniRef50_Q8PPF4 Cluster: Putative uncharacterized protein XAC0732; n=2; Xanthomonas|Rep: Putative uncharacterized protein XAC0732 - Xanthomonas axonopodis pv. citri Length = 266 Score = 36.7 bits (81), Expect = 0.93 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 899 GLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 G PP PP PPP P P P PPP Sbjct: 229 GFAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 259 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPP 260 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPPPP 261 >UniRef50_Q948Y6 Cluster: VMP4 protein; n=1; Volvox carteri f. nagariensis|Rep: VMP4 protein - Volvox carteri f. nagariensis Length = 1143 Score = 36.7 bits (81), Expect = 0.93 Identities = 21/66 (31%), Positives = 22/66 (33%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P S + P P PP PP PP P P P P Sbjct: 500 PPPPSPLLTSPR--PPSPRPPRPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPP 557 Query: 975 LPXXXP 992 P P Sbjct: 558 PPSPPP 563 Score = 36.7 bits (81), Expect = 0.93 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 SP PP PP PP P SP PS PPP Sbjct: 524 SPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPP 558 Score = 36.7 bits (81), Expect = 0.93 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 SP PP PP PP P SP PS PPP Sbjct: 530 SPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPP 564 Score = 36.7 bits (81), Expect = 0.93 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 SP PP PP PP P SP PS PPP Sbjct: 536 SPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPP 570 Score = 36.7 bits (81), Expect = 0.93 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 SP PP PP PP P SP PS PPP Sbjct: 542 SPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPP 576 Score = 36.7 bits (81), Expect = 0.93 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 SP PP PP PP P SP PS PPP Sbjct: 548 SPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPP 582 Score = 34.3 bits (75), Expect = 5.0 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 825 PXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXPLPXXXP 992 P F P P S P PP PP PP P P P P P P Sbjct: 496 PPFVPPPPSPLLTSPRPPSPRPPRPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPP 551 Score = 34.3 bits (75), Expect = 5.0 Identities = 21/71 (29%), Positives = 22/71 (30%), Gaps = 1/71 (1%) Frame = +3 Query: 783 RXXXPXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXP-LPXDXXXLPPXXXPPXPPLPXPX 959 R P P P P P P + P P PP PP PP P P Sbjct: 511 RPPSPRPPRPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPP 570 Query: 960 PXXXPLPXXXP 992 P P P P Sbjct: 571 PSPPPPPSPPP 581 Score = 33.9 bits (74), Expect = 6.6 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPP 988 SP PP PP PP P SP PS PP Sbjct: 560 SPPPPPSPPPPPSPPPPPSPPPPPSPRHPPSPPP 593 >UniRef50_Q6H7U3 Cluster: Putative formin I2I isoform; n=2; Oryza sativa|Rep: Putative formin I2I isoform - Oryza sativa subsp. japonica (Rice) Length = 881 Score = 36.7 bits (81), Expect = 0.93 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPPXK 997 PP PP PPP P P P PPP K Sbjct: 353 PPPPPPPPPPPPPPPPPPPRPPPPPPPIK 381 >UniRef50_A7QGU9 Cluster: Chromosome chr16 scaffold_94, whole genome shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome chr16 scaffold_94, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 341 Score = 36.7 bits (81), Expect = 0.93 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPPXK 997 PP PP PPP P P P PPP K Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPVK 76 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 Query: 875 WRXXSPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 W+ PP PP PPP P P P PPP Sbjct: 34 WKPEVTAVNPAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPP 73 >UniRef50_A5BAX2 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 131 Score = 36.7 bits (81), Expect = 0.93 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPPXK 997 PP PP PPP P SP + PPP K Sbjct: 49 PPLAPPPPVPPPPPPPSPPCPTTPPPPYK 77 >UniRef50_Q9S8M0 Cluster: Chitin-binding lectin 1 precursor; n=1; Solanum tuberosum|Rep: Chitin-binding lectin 1 precursor - Solanum tuberosum (Potato) Length = 323 Score = 36.7 bits (81), Expect = 0.93 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = +2 Query: 902 LXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 L PP PP+ PPP P SP PS PPP Sbjct: 149 LPSPPPPPPPPSPPPPSPPSP-PPPSPPPP 177 Score = 34.7 bits (76), Expect = 3.8 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P SP P+ PPP Sbjct: 178 PPPSPPPPSPPPPSP-SPPPPPASPPP 203 Score = 33.9 bits (74), Expect = 6.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PP P P PS PPP Sbjct: 171 PPSPPPPPPPSPPPPSPPPPSPSPPPP 197 >UniRef50_Q8YQB7 Cluster: All3916 protein; n=2; Nostocaceae|Rep: All3916 protein - Anabaena sp. (strain PCC 7120) Length = 383 Score = 36.3 bits (80), Expect = 1.2 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPPXK 997 PP PP PPP P P P PPP + Sbjct: 343 PPDPPPPPDPPPPPPPDPPPPPDPPPPDR 371 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 336 PPPDPPPPPDPPPPPDPPPPPPPDPPP 362 >UniRef50_Q2N5D9 Cluster: Autotransporter; n=1; Erythrobacter litoralis HTCC2594|Rep: Autotransporter - Erythrobacter litoralis (strain HTCC2594) Length = 1819 Score = 36.3 bits (80), Expect = 1.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 899 GLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 G PP PP PPP P P P PPP Sbjct: 1406 GTAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1436 Score = 35.9 bits (79), Expect = 1.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P+ PPP Sbjct: 1422 PPPPPPPPPPPPPPPPPPTPPPAPPPP 1448 Score = 35.9 bits (79), Expect = 1.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P +P P PPP Sbjct: 1424 PPPPPPPPPPPPPPPPTPPPAPPPPPP 1450 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 +P PP PP PPP P P P PPP Sbjct: 1403 TPTGTAPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1437 Score = 35.1 bits (77), Expect = 2.8 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 899 GLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 GL P PP PPP P P P PPP Sbjct: 1399 GLTLTPTGTAPPPPPPPPPPPPPPPPPPPPP 1429 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 1412 PPPPPPPPPPPPPPPPPPPPPPPPPPP 1438 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 1413 PPPPPPPPPPPPPPPPPPPPPPPPPPP 1439 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 1417 PPPPPPPPPPPPPPPPPPPPPPPTPPP 1443 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 1421 PPPPPPPPPPPPPPPPPPPTPPPAPPP 1447 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 1425 PPPPPPPPPPPPPPPTPPPAPPPPPPP 1451 >UniRef50_Q3HTK2 Cluster: Pherophorin-C5 protein precursor; n=1; Chlamydomonas reinhardtii|Rep: Pherophorin-C5 protein precursor - Chlamydomonas reinhardtii Length = 541 Score = 36.3 bits (80), Expect = 1.2 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 SP PP PP PPP P P P PPP Sbjct: 195 SPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPP 229 Score = 35.9 bits (79), Expect = 1.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P P P PPP Sbjct: 213 PPPSPPPPSPPPPSPPPPSPPPPSPPP 239 Score = 35.5 bits (78), Expect = 2.2 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P S P P PP PP PP P P P P Sbjct: 193 PPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPP-PSPPPPSPPPPSPPPPPPPSPPPPSPP 251 Query: 975 LPXXXP 992 P P Sbjct: 252 PPSPPP 257 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 177 PPPPPSPPPPPPPSPPPPSPPPPSPPP 203 Score = 35.1 bits (77), Expect = 2.8 Identities = 19/62 (30%), Positives = 20/62 (32%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P + P P PP PP PP P P P P Sbjct: 184 PPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 243 Query: 975 LP 980 P Sbjct: 244 SP 245 Score = 34.7 bits (76), Expect = 3.8 Identities = 16/33 (48%), Positives = 17/33 (51%), Gaps = 4/33 (12%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXX----PSXPPPXK 997 PP PP+ PPP P SP PS PPP K Sbjct: 228 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPCK 260 Score = 33.9 bits (74), Expect = 6.6 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P P PS PPP Sbjct: 223 PPPSPPPPSPPPPSPPPPPP-PSPPPP 248 Score = 33.9 bits (74), Expect = 6.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P PS PPP Sbjct: 227 PPPPSPPPPSPPPPPPPSPPPPSPPPP 253 >UniRef50_Q9P6T1 Cluster: Putative uncharacterized protein 15E6.220; n=1; Neurospora crassa|Rep: Putative uncharacterized protein 15E6.220 - Neurospora crassa Length = 1992 Score = 36.3 bits (80), Expect = 1.2 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P+ PPP Sbjct: 58 PPPPPPPPPPPPPPPPEPEPQPAPPPP 84 Score = 35.5 bits (78), Expect = 2.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 43 PPPPPPPPASPPPPPPPPPPPPPPPPP 69 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 47 PPPPASPPPPPPPPPPPPPPPPPPPPP 73 >UniRef50_Q4A2S6 Cluster: Putative membrane protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein precursor - Emiliania huxleyi virus 86 Length = 430 Score = 35.9 bits (79), Expect = 1.6 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 875 WRXXSPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 W SP PP PP+ PPP P P P PP Sbjct: 28 WPHQSPPPPSNPPPPLSPPPSLPPPPPSPPPPSPPSLPP 66 Score = 34.3 bits (75), Expect = 5.0 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 SP L PP PP+ P P P PS PPP Sbjct: 44 SPPPSLPPPPPSPPPPSPPSLPPWWPNVSPSPPPP 78 Score = 33.5 bits (73), Expect = 8.7 Identities = 19/66 (28%), Positives = 21/66 (31%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P + P + PP PP PP P P P P Sbjct: 110 PSVPPPSN-PPNVPPSIPSPSPVPSPPPPPSPFAPEPSPPPPMPPPPTPPPPSPSPPPLP 168 Query: 975 LPXXXP 992 P P Sbjct: 169 PPPWSP 174 >UniRef50_Q3UHZ5 Cluster: 17 days embryo heart cDNA, RIKEN full-length enriched library, clone:I920184N14 product:leiomodin 2 (cardiac), full insert sequence; n=16; Tetrapoda|Rep: 17 days embryo heart cDNA, RIKEN full-length enriched library, clone:I920184N14 product:leiomodin 2 (cardiac), full insert sequence - Mus musculus (Mouse) Length = 550 Score = 35.9 bits (79), Expect = 1.6 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 899 GLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 G PP PP PPP P P P PPP Sbjct: 417 GRSRPPSPVAPPPPPPPPPLPPHMLPPPPPP 447 >UniRef50_Q62CV6 Cluster: Hemagglutinin domain protein; n=8; Burkholderia|Rep: Hemagglutinin domain protein - Burkholderia mallei (Pseudomonas mallei) Length = 373 Score = 35.9 bits (79), Expect = 1.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P P P PPP Sbjct: 100 PPPPPPPPSPPPPSPPPPSPPPPSPPP 126 Score = 35.9 bits (79), Expect = 1.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P P P PPP Sbjct: 105 PPPSPPPPSPPPPSPPPPSPPPPSPPP 131 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 90 PPPPPPPPPPPPPPPPPPSPPPPSPPP 116 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 95 PPPPPPPPPPPPPSPPPPSPPPPSPPP 121 Score = 33.9 bits (74), Expect = 6.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P PS PPP Sbjct: 91 PPPPPPPPPPPPPPPPPSPPPPSPPPP 117 Score = 33.5 bits (73), Expect = 8.7 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 P PP PPP P P PS PPP Sbjct: 86 PNKVPPPPPPPPPPPPPPPPPPSPPPP 112 >UniRef50_Q56B20 Cluster: Cell surface antigen Sca2-6; n=4; Rickettsia bellii|Rep: Cell surface antigen Sca2-6 - Rickettsia bellii Length = 909 Score = 35.9 bits (79), Expect = 1.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P+ PPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPTPPPP 70 Score = 33.5 bits (73), Expect = 8.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 915 PPXXXPPXPPLPXPXPXXXPLPXXXP 992 PP PP PP P P P PLP P Sbjct: 52 PPPPPPPPPPPPPPTPPPPPLPKTPP 77 >UniRef50_Q9SRL3 Cluster: F9F8.15 protein; n=13; Magnoliophyta|Rep: F9F8.15 protein - Arabidopsis thaliana (Mouse-ear cress) Length = 451 Score = 35.9 bits (79), Expect = 1.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P P P PPP Sbjct: 68 PPTSPPPPSPPPPSPPPPSPPPPSPPP 94 >UniRef50_Q1EP07 Cluster: Putative uncharacterized protein; n=1; Musa acuminata|Rep: Putative uncharacterized protein - Musa acuminata (Banana) Length = 390 Score = 35.9 bits (79), Expect = 1.6 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = +3 Query: 804 PXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXPLPX 983 P P P P P P P PP PP PP P P P P P Sbjct: 162 PEPEPAPPPPEPAPPTPEPPPPPGPEPPPPPGPEPPPPPAPEPPPPPAPEPPPPPPPKPD 221 Query: 984 XXP 992 P Sbjct: 222 PTP 224 >UniRef50_Q01DC8 Cluster: Plg protein; n=2; Eukaryota|Rep: Plg protein - Ostreococcus tauri Length = 3738 Score = 35.9 bits (79), Expect = 1.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P P P PPP Sbjct: 1808 PPPSPPPPSPPPPSPPPPSPPPPSPPP 1834 Score = 35.9 bits (79), Expect = 1.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P P P PPP Sbjct: 1813 PPPSPPPPSPPPPSPPPPSPPPPSPPP 1839 Score = 33.9 bits (74), Expect = 6.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP P P P SP P PPP Sbjct: 13 PPPPPSPPPPPSPAPPSPPPPPPSPPP 39 Score = 33.5 bits (73), Expect = 8.7 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P P PS PPP Sbjct: 21 PPPSPAPPSPPPPPPSPP--PPSPPPP 45 >UniRef50_Q013S1 Cluster: Chromosome 08 contig 1, DNA sequence; n=1; Ostreococcus tauri|Rep: Chromosome 08 contig 1, DNA sequence - Ostreococcus tauri Length = 736 Score = 35.9 bits (79), Expect = 1.6 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PP P SP PS PPP Sbjct: 687 PPPPSPPPPPSPPPPPSPPPPPSPPPP 713 >UniRef50_A3BQ84 Cluster: Putative uncharacterized protein; n=1; Oryza sativa (japonica cultivar-group)|Rep: Putative uncharacterized protein - Oryza sativa subsp. japonica (Rice) Length = 2240 Score = 35.9 bits (79), Expect = 1.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P+ PPP Sbjct: 425 PPPPPLPPPPPPPPPPPPPLPPNMPPP 451 >UniRef50_Q0U6P9 Cluster: Predicted protein; n=1; Phaeosphaeria nodorum|Rep: Predicted protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 349 Score = 35.9 bits (79), Expect = 1.6 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 890 PXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 P + PP PP PPP P P P PPP Sbjct: 49 PQTFMASPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPP 88 >UniRef50_A3LN86 Cluster: Protein involved in actin organization and endocytosis; n=2; Saccharomycetales|Rep: Protein involved in actin organization and endocytosis - Pichia stipitis (Yeast) Length = 1373 Score = 35.9 bits (79), Expect = 1.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P +P P PPP Sbjct: 1292 PPPPPPPPPGPPPIPNAPFGAPPPPPP 1318 >UniRef50_P21260 Cluster: Uncharacterized proline-rich protein; n=1; Owenia fusiformis|Rep: Uncharacterized proline-rich protein - Owenia fusiformis Length = 141 Score = 35.9 bits (79), Expect = 1.6 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 902 LXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 L PP PP PPP P P P PPP Sbjct: 7 LTPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 35.5 bits (78), Expect = 2.2 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPPXK 997 PP PP PPP P P P PPP + Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPR 59 Score = 35.5 bits (78), Expect = 2.2 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPPXK 997 PP PP PPP P P P PPP + Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPRR 60 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPP 56 >UniRef50_Q8N3X1 Cluster: Formin-binding protein 4; n=28; Eumetazoa|Rep: Formin-binding protein 4 - Homo sapiens (Human) Length = 1017 Score = 35.9 bits (79), Expect = 1.6 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +2 Query: 851 SXRPFCXGWRXXSPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 S P W + PP P PPP P SP P PPP Sbjct: 685 SLMPLTPFWTLLQSNVPVLQPPLPLEMPPPPPPPPESPPPPPPPPPP 731 >UniRef50_Q9S740 Cluster: Lysine-rich arabinogalactan protein 19 precursor; n=2; Arabidopsis thaliana|Rep: Lysine-rich arabinogalactan protein 19 precursor - Arabidopsis thaliana (Mouse-ear cress) Length = 222 Score = 35.9 bits (79), Expect = 1.6 Identities = 15/28 (53%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = +2 Query: 911 PPXXXXP-PTXPPPXPXSPXXXPSXPPP 991 PP P PT PPP P SP P+ PPP Sbjct: 114 PPVSPPPAPTSPPPTPASPPPAPASPPP 141 Score = 35.5 bits (78), Expect = 2.2 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 914 PXXXXPPTXPPPXPXSPXXXPSXPPP 991 P PP PPP P SP P+ PPP Sbjct: 109 PTVSPPPVSPPPAPTSPPPTPASPPP 134 >UniRef50_UPI0000F205BB Cluster: PREDICTED: similar to formin 2; n=2; Danio rerio|Rep: PREDICTED: similar to formin 2 - Danio rerio Length = 1465 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 890 PXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 P G+ PP P PPP P P P PPP Sbjct: 957 PLPGMVPPPPPPLPGMAPPPPPPFPGMTPPPPPP 990 >UniRef50_Q65553 Cluster: UL36; n=5; Varicellovirus|Rep: UL36 - Bovine herpesvirus 1 Length = 3247 Score = 35.5 bits (78), Expect = 2.2 Identities = 20/60 (33%), Positives = 21/60 (35%), Gaps = 3/60 (5%) Frame = +3 Query: 810 PXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXP---PXPPLPXPXPXXXPLP 980 P P P P PLP LPP P P PPLP P P P+P Sbjct: 2614 PVPPGPRLPPAPPLPPPAPPLPPPAPPLPPPAPPLPPPAPPLPPPAPPLPPPAPSTAPVP 2673 >UniRef50_Q013M1 Cluster: Chromosome 08 contig 1, DNA sequence; n=1; Ostreococcus tauri|Rep: Chromosome 08 contig 1, DNA sequence - Ostreococcus tauri Length = 442 Score = 35.5 bits (78), Expect = 2.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 192 PPPSLSPPNPPPPSPSPPPSPPPSPPP 218 Score = 33.5 bits (73), Expect = 8.7 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPPXK 997 PP PP PPP P P PS PPP + Sbjct: 202 PPPSPSPPPSPPPSPP-PSPPPSLPPPFR 229 >UniRef50_Q560V3 Cluster: Putative uncharacterized protein; n=2; Filobasidiella neoformans|Rep: Putative uncharacterized protein - Cryptococcus neoformans (Filobasidiella neoformans) Length = 606 Score = 35.5 bits (78), Expect = 2.2 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPPXK 997 PP PP PPP P P P PPP + Sbjct: 548 PPPPSPPPDLPPPPPPPPCDLPPPPPPNR 576 >UniRef50_Q0CQD0 Cluster: Predicted protein; n=1; Aspergillus terreus NIH2624|Rep: Predicted protein - Aspergillus terreus (strain NIH 2624) Length = 313 Score = 35.5 bits (78), Expect = 2.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 129 PPVLPGPPVGPPPPPPPPPPPPPPPPP 155 >UniRef50_P0C5C7 Cluster: Glycine-rich cell wall structural protein 2 precursor; n=15; Eukaryota|Rep: Glycine-rich cell wall structural protein 2 precursor - Oryza sativa subsp. indica (Rice) Length = 185 Score = 35.5 bits (78), Expect = 2.2 Identities = 21/66 (31%), Positives = 22/66 (33%) Frame = -2 Query: 991 GXXXGRGXXXGXGXGRGGXGGXXXGGRXXQSXGRGXXPPAXAEXAXGYXQCGXNXGXTXX 812 G G G G G GG GG G G+G A A GY G G Sbjct: 64 GSGGAAGGGYGRGGGGGGGGGEGGGSGSGYGSGQGSGYGAGVGGAGGYGSGGGGGGGQGG 123 Query: 811 GXGXXG 794 G G G Sbjct: 124 GAGGYG 129 >UniRef50_UPI00015BDD6A Cluster: UPI00015BDD6A related cluster; n=1; unknown|Rep: UPI00015BDD6A UniRef100 entry - unknown Length = 231 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPETPPPPPP 94 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 69 PPPPPPPPPPPPPPPPPPETPPPPPPP 95 >UniRef50_UPI000155D461 Cluster: PREDICTED: similar to Mitogen-activated protein kinase kinase kinase 7 interacting protein 3; n=1; Ornithorhynchus anatinus|Rep: PREDICTED: similar to Mitogen-activated protein kinase kinase kinase 7 interacting protein 3 - Ornithorhynchus anatinus Length = 639 Score = 35.1 bits (77), Expect = 2.8 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 888 PLPXDXXXLPPXXXPPXPPLPXPXPXXXPLPXXXP 992 P P PP PP PP P P P PLP P Sbjct: 331 PGPGPAAPAPPYQPPPPPPPPPPPPGPAPLPRALP 365 >UniRef50_UPI0000DC00CB Cluster: SH3 domain binding protein CR16; n=1; Rattus norvegicus|Rep: SH3 domain binding protein CR16 - Rattus norvegicus Length = 456 Score = 35.1 bits (77), Expect = 2.8 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 915 PPXXXPPXPPLPXPXPXXXPLPXXXPXK 998 PP PP PP P P P PLP P K Sbjct: 196 PPPTTPPPPPPPPPPPPPPPLPPASPIK 223 >UniRef50_Q4A263 Cluster: Putative membrane protein; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein - Emiliania huxleyi virus 86 Length = 403 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPP 988 PP PP+ PPP P P PS PP Sbjct: 139 PPPPPPPPSSPPPSPPPPSSPPSPPP 164 Score = 33.5 bits (73), Expect = 8.7 Identities = 14/28 (50%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = +2 Query: 911 PPXXXXPPTXPP-PXPXSPXXXPSXPPP 991 PP PP+ PP P P SP P PPP Sbjct: 149 PPPSPPPPSSPPSPPPSSPPSSPPSPPP 176 >UniRef50_Q9A2R2 Cluster: OmpA family protein; n=5; Caulobacter|Rep: OmpA family protein - Caulobacter crescentus (Caulobacter vibrioides) Length = 449 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPP 336 >UniRef50_Q2W222 Cluster: RTX toxins and related Ca2+-binding protein; n=1; Magnetospirillum magneticum AMB-1|Rep: RTX toxins and related Ca2+-binding protein - Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) Length = 1274 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 277 PPPPPPPPPPPPPPPSPPAPAPPPPPP 303 Score = 33.9 bits (74), Expect = 6.6 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P SP P+ PPP Sbjct: 276 PPPPPPPPPPPPPPPPSP-PAPAPPPP 301 >UniRef50_Q0M671 Cluster: Glycoside hydrolase, family 16:Hemolysin-type calcium-binding region; n=1; Caulobacter sp. K31|Rep: Glycoside hydrolase, family 16:Hemolysin-type calcium-binding region - Caulobacter sp. K31 Length = 608 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPP 498 >UniRef50_Q0C0P5 Cluster: OmpA family protein; n=1; Hyphomonas neptunium ATCC 15444|Rep: OmpA family protein - Hyphomonas neptunium (strain ATCC 15444) Length = 387 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 231 PPAPPPPPPPPPPPPPPPPPPPPPPPP 257 >UniRef50_Q0ANI5 Cluster: OmpA/MotB domain protein precursor; n=2; Hyphomonadaceae|Rep: OmpA/MotB domain protein precursor - Maricaulis maris (strain MCS10) Length = 359 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 216 PPPPPPPPPPPPPPPPPPPPPPPPPPP 242 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 217 PPPPPPPPPPPPPPPPPPPPPPPPPPP 243 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 218 PPPPPPPPPPPPPPPPPPPPPPPPPPP 244 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 219 PPPPPPPPPPPPPPPPPPPPPPPPPPP 245 >UniRef50_Q75JU4 Cluster: Similar to Volvox carteri f. nagariensis. Pherophorin-dz1 protein; n=2; Dictyostelium discoideum|Rep: Similar to Volvox carteri f. nagariensis. Pherophorin-dz1 protein - Dictyostelium discoideum (Slime mold) Length = 243 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 56 PPLPPAPPPPPPPPPPPPPPPPPPPPP 82 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 59 PPAPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPLPPP 105 Score = 35.1 bits (77), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 82 PPPPPPPPPPPPPPPPPPPPLPPPPPP 108 Score = 34.7 bits (76), Expect = 3.8 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 888 PLPXDXXXLPPXXXPPXPPLPXPXPXXXPLPXXXP 992 P P PP PP PP P P P PLP P Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPP 107 >UniRef50_Q552N9 Cluster: RNA-binding region-containing protein; n=2; Dictyostelium discoideum|Rep: RNA-binding region-containing protein - Dictyostelium discoideum AX4 Length = 299 Score = 35.1 bits (77), Expect = 2.8 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = -2 Query: 997 FXGXXXGRGXXXGXGXGRGGXGGXXXGGRXXQSXGRG 887 F G GRG G G GRGG GG GGR S GRG Sbjct: 255 FGGGRGGRGGF-GNGGGRGGFGGGRGGGRGG-SGGRG 289 >UniRef50_A7RNZ0 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 370 Score = 35.1 bits (77), Expect = 2.8 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P YP P P P PP PP P P P P Sbjct: 251 PPYPNPYPQPPYPPPPPPYPNPYPQPPYPPPPAPCSGPGPCPYPGPPPPPYPAPTPYPPP 310 Query: 975 LP 980 P Sbjct: 311 PP 312 >UniRef50_Q9UMN6 Cluster: WW domain-binding protein 7; n=16; Eukaryota|Rep: WW domain-binding protein 7 - Homo sapiens (Human) Length = 2715 Score = 35.1 bits (77), Expect = 2.8 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPX-SPXXXPSXPPP 991 SP L P PP PPP P SP PS PPP Sbjct: 412 SPPPPLPPPSTSPPPPLCPPPPPPVSPPPLPSPPPP 447 >UniRef50_Q9Y613 Cluster: FH1/FH2 domain-containing protein 1; n=10; Theria|Rep: FH1/FH2 domain-containing protein 1 - Homo sapiens (Human) Length = 1164 Score = 35.1 bits (77), Expect = 2.8 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +3 Query: 888 PLPXDXXXLPPXXXPPXPPLPXPXPXXXPLPXXXP 992 PLP PP PP PP+ P P PLP P Sbjct: 575 PLPLLSGVPPPPPLPPPPPIKGPFPPPPPLPLAAP 609 >UniRef50_UPI0000D56EFA Cluster: PREDICTED: similar to Protein cappuccino; n=1; Tribolium castaneum|Rep: PREDICTED: similar to Protein cappuccino - Tribolium castaneum Length = 1011 Score = 34.7 bits (76), Expect = 3.8 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 890 PXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 P G+ PP P T PPP P P PPP Sbjct: 509 PMPGIGGPPPPPMPGTGPPPPPPPMGGVPPPPPP 542 >UniRef50_UPI000038C710 Cluster: COG2319: FOG: WD40 repeat; n=1; Nostoc punctiforme PCC 73102|Rep: COG2319: FOG: WD40 repeat - Nostoc punctiforme PCC 73102 Length = 492 Score = 34.7 bits (76), Expect = 3.8 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +2 Query: 929 PPTXPPPXPXSPXXXPSXPPPXK 997 P T PPP P SP P+ PPP K Sbjct: 170 PATPPPPKPTSPPPKPATPPPPK 192 >UniRef50_UPI00004D6F7D Cluster: formin-like 2; n=3; Euteleostomi|Rep: formin-like 2 - Xenopus tropicalis Length = 1054 Score = 34.7 bits (76), Expect = 3.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 537 PPPPPPPPPPPPPPPPLPSAEPPVPPP 563 >UniRef50_UPI0000F30E84 Cluster: UPI0000F30E84 related cluster; n=1; Bos taurus|Rep: UPI0000F30E84 UniRef100 entry - Bos Taurus Length = 921 Score = 34.7 bits (76), Expect = 3.8 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 888 PLPXDXXXLPPXXXPPXPPLPXPXPXXXPLPXXXP 992 P P LPP PP PP P P P P P P Sbjct: 777 PPPPPPLALPPPPPPPPPPPPPPLPPSHPNPEVPP 811 >UniRef50_Q3UQ97 Cluster: 10 days lactation, adult female mammary gland cDNA, RIKEN full-length enriched library, clone:D730033L13 product:hypothetical Proline-rich region profile containing protein, full insert sequence; n=3; Murinae|Rep: 10 days lactation, adult female mammary gland cDNA, RIKEN full-length enriched library, clone:D730033L13 product:hypothetical Proline-rich region profile containing protein, full insert sequence - Mus musculus (Mouse) Length = 254 Score = 34.7 bits (76), Expect = 3.8 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 891 LPXDXXXLPPXXXPPXPPLPXPXPXXXPLPXXXP 992 +P LPP PP PP P P P P P P Sbjct: 26 IPGSPTILPPPPAPPRPPSPAPPPLPPPPPRPPP 59 >UniRef50_Q9LMQ1 Cluster: F7H2.17 protein; n=2; Arabidopsis thaliana|Rep: F7H2.17 protein - Arabidopsis thaliana (Mouse-ear cress) Length = 1006 Score = 34.7 bits (76), Expect = 3.8 Identities = 18/57 (31%), Positives = 21/57 (36%) Frame = +2 Query: 821 APXIPTTLXVSXRPFCXGWRXXSPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 +P +P L S P P + PP P PPP P P P PPP Sbjct: 112 SPRLPPPLVPSPPPPLHPRPSPCPPPLMPSPPPLVPSPPPPPPSPLVPSPPPPSPPP 168 >UniRef50_Q41645 Cluster: Extensin; n=1; Volvox carteri|Rep: Extensin - Volvox carteri Length = 464 Score = 34.7 bits (76), Expect = 3.8 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 SP PP PP P P P P PS PPP Sbjct: 328 SPSPPPPSPPPPSPPPPRPSPSPPPPRSSPSPPPP 362 >UniRef50_Q41192 Cluster: NaPRP3; n=1; Nicotiana alata|Rep: NaPRP3 - Nicotiana alata (Winged tobacco) (Persian tobacco) Length = 151 Score = 34.7 bits (76), Expect = 3.8 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 P PP+ PPP P P PS PPP Sbjct: 85 PSPSPPPPSPPPPSPSPPPPSPSPPPP 111 >UniRef50_Q4QE97 Cluster: Formin, putative; n=3; Leishmania|Rep: Formin, putative - Leishmania major Length = 1300 Score = 34.7 bits (76), Expect = 3.8 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 890 PXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 P G PP PP PPP P P + PPP Sbjct: 656 PTGGPKQPPPPPPPPPPPPPPPPPPPRMGNGPPP 689 >UniRef50_Q86UP3 Cluster: Zinc finger homeobox protein 4; n=18; Eukaryota|Rep: Zinc finger homeobox protein 4 - Homo sapiens (Human) Length = 3567 Score = 34.7 bits (76), Expect = 3.8 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 914 PXXXXPPTXPPPXPXSPXXXPSXPPP 991 P PPT PPP P P P PPP Sbjct: 1989 PLQAPPPTPPPPPPPPPPPPPPPPPP 2014 >UniRef50_O36027 Cluster: Wiskott-Aldrich syndrome homolog protein 1; n=1; Schizosaccharomyces pombe|Rep: Wiskott-Aldrich syndrome homolog protein 1 - Schizosaccharomyces pombe (Fission yeast) Length = 574 Score = 34.7 bits (76), Expect = 3.8 Identities = 23/75 (30%), Positives = 25/75 (33%), Gaps = 4/75 (5%) Frame = +3 Query: 780 SRXXXPXXPXPXXVXPXFXPHXX--YPXAXSAXAGGXXPLPXDXXXLPPXXX--PPXPPL 947 SR P P P + P P P + A PLP PP P PPL Sbjct: 410 SRTSTPPVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPL 469 Query: 948 PXPXPXXXPLPXXXP 992 P P P P P Sbjct: 470 PPAAPAPPPAPAPAP 484 >UniRef50_Q95JC9 Cluster: Basic proline-rich protein precursor [Contains: Proline-rich peptide SP-A (PRP-SP-A); Proline-rich peptide SP-B (PRP-SP-B); Parotid hormone (PH-Ab)]; n=10; Eukaryota|Rep: Basic proline-rich protein precursor [Contains: Proline-rich peptide SP-A (PRP-SP-A); Proline-rich peptide SP-B (PRP-SP-B); Parotid hormone (PH-Ab)] - Sus scrofa (Pig) Length = 676 Score = 34.7 bits (76), Expect = 3.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 394 PPPGPPPPGPPPPGPAPPGARPPPPPP 420 >UniRef50_UPI0000F30DFE Cluster: UPI0000F30DFE related cluster; n=1; Bos taurus|Rep: UPI0000F30DFE UniRef100 entry - Bos Taurus Length = 591 Score = 34.3 bits (75), Expect = 5.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPP 988 PP PP PPP P SP P PP Sbjct: 335 PPSPQPPPPSPPPPPSSPSSPPPSPP 360 Score = 33.5 bits (73), Expect = 8.7 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 902 LXXPPXXXXP-PTXPPPXPXSPXXXPSXPPP 991 L PP P P PPP P P PS PPP Sbjct: 327 LKKPPRPPPPSPQPPPPSPPPPPSSPSSPPP 357 >UniRef50_Q08BP2 Cluster: LOC562403 protein; n=5; Danio rerio|Rep: LOC562403 protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 576 Score = 34.3 bits (75), Expect = 5.0 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 894 PXDXXXLPPXXXPPXPPLPXPXPXXXPLP 980 P D LPP PP PP P P P P P Sbjct: 365 PSDPPLLPPPPSPPPPPPPPPPPPPPPPP 393 >UniRef50_Q8UZB6 Cluster: Replicase; n=5; Grapevine fleck virus|Rep: Replicase - Grapevine fleck virus Length = 1949 Score = 34.3 bits (75), Expect = 5.0 Identities = 18/52 (34%), Positives = 20/52 (38%) Frame = +3 Query: 837 PHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXPLPXXXP 992 P +P + A PLP LPP PP PP P P P P P Sbjct: 669 PFLPHPSSHPRRARRLPPLPP-APPLPPQPPPPPPPQPSPHPPLFPASIPSP 719 >UniRef50_Q4A371 Cluster: Putative membrane protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein precursor - Emiliania huxleyi virus 86 Length = 194 Score = 34.3 bits (75), Expect = 5.0 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +2 Query: 902 LXXPPXXXX-PPTXPPPXPXSPXXXPSXPPP 991 L PP PP+ PPP P P PS PPP Sbjct: 25 LPPPPLPPSLPPSLPPPSPPPPPLPPSLPPP 55 >UniRef50_Q0LTW4 Cluster: Peptidase M56, BlaR1 precursor; n=1; Caulobacter sp. K31|Rep: Peptidase M56, BlaR1 precursor - Caulobacter sp. K31 Length = 596 Score = 34.3 bits (75), Expect = 5.0 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +2 Query: 902 LXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 L PP PP PPP P +P P+ P P Sbjct: 380 LPPPPPAPPPPPAPPPPPPAPPAPPAPPAP 409 >UniRef50_A4FGR9 Cluster: Putative uncharacterized protein; n=1; Saccharopolyspora erythraea NRRL 2338|Rep: Putative uncharacterized protein - Saccharopolyspora erythraea (strain NRRL 23338) Length = 373 Score = 34.3 bits (75), Expect = 5.0 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +3 Query: 888 PLPXDXXXLPPXXXPPXPPLPXPXPXXXPLP 980 P P +PP PP PP+P P P P P Sbjct: 268 PPPPTPEPVPPPPIPPPPPVPAPPPPPEPAP 298 >UniRef50_Q9ATK5 Cluster: PF6 protein; n=1; Chlamydomonas reinhardtii|Rep: PF6 protein - Chlamydomonas reinhardtii Length = 2301 Score = 34.3 bits (75), Expect = 5.0 Identities = 21/61 (34%), Positives = 22/61 (36%) Frame = +2 Query: 809 PXXCAPXIPTTLXVSXRPFCXGWRXXSPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPP 988 P AP P V P G + S G PP PP PPP P P PP Sbjct: 444 PEPEAPPPPPPEPVLPPPPAAGAKTPSAKGGRTTPPAPPPPP--PPPPEPEPEPTPPPPP 501 Query: 989 P 991 P Sbjct: 502 P 502 >UniRef50_Q0DSG8 Cluster: Os03g0308700 protein; n=1; Oryza sativa (japonica cultivar-group)|Rep: Os03g0308700 protein - Oryza sativa subsp. japonica (Rice) Length = 464 Score = 34.3 bits (75), Expect = 5.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PT PPP P P P PPP Sbjct: 270 PPRWTRSPTPPPPPPSPPHATPPPPPP 296 >UniRef50_Q00X46 Cluster: Chromosome 13 contig 1, DNA sequence; n=5; root|Rep: Chromosome 13 contig 1, DNA sequence - Ostreococcus tauri Length = 1990 Score = 34.3 bits (75), Expect = 5.0 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = +3 Query: 804 PXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXPLPX 983 P P P P P PLP PP P PP P P P P P Sbjct: 781 PPPSPPPPNPPPLPSPPPPSPPPPSPTPPLPPPPSPFPPPSPSPSPPPPSPPPPSPPPPS 840 Query: 984 XXP 992 P Sbjct: 841 PPP 843 Score = 34.3 bits (75), Expect = 5.0 Identities = 20/66 (30%), Positives = 22/66 (33%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P +P + P P PP PP PP P P P P Sbjct: 799 PSPPPPSPTPPLPPPPSPFPPPSPS------PSPPPPSPPPPSPPPPSPPPPSPFPPPAP 852 Query: 975 LPXXXP 992 P P Sbjct: 853 PPPSPP 858 Score = 33.5 bits (73), Expect = 8.7 Identities = 14/29 (48%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = +2 Query: 911 PPXXXXPPTXPP--PXPXSPXXXPSXPPP 991 PP PP+ PP P P SP P+ PPP Sbjct: 827 PPPSPPPPSPPPPSPPPPSPFPPPAPPPP 855 >UniRef50_A2WJU1 Cluster: Putative uncharacterized protein; n=3; Oryza sativa|Rep: Putative uncharacterized protein - Oryza sativa subsp. indica (Rice) Length = 240 Score = 34.3 bits (75), Expect = 5.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P PS PPP Sbjct: 102 PPPVTPPPVSPPPATPPPALPPSTPPP 128 >UniRef50_Q54U84 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 674 Score = 34.3 bits (75), Expect = 5.0 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP P + PPP P SP P PPP Sbjct: 312 PPPPPPPSSPPPPPPPSPPRVPFLPPP 338 >UniRef50_Q05H60 Cluster: Major ampullate spidroin 1 precursor; n=1; Euprosthenops australis|Rep: Major ampullate spidroin 1 precursor - Euprosthenops australis Length = 394 Score = 34.3 bits (75), Expect = 5.0 Identities = 19/59 (32%), Positives = 22/59 (37%) Frame = -2 Query: 979 GRGXXXGXGXGRGGXGGXXXGGRXXQSXGRGXXPPAXAEXAXGYXQCGXNXGXTXXGXG 803 G+G G G G+GG GG G+ G G A A A G G G G Sbjct: 300 GQGGQGGGGYGQGGQGGQGGQGQGGYGQGAGSSAAAAAAAAAAAAAAGRGQGGYGQGSG 358 >UniRef50_Q6CH67 Cluster: Similarities with sp|P35207 Saccharomyces cerevisiae Antiviral protein SKI2; n=2; Yarrowia lipolytica|Rep: Similarities with sp|P35207 Saccharomyces cerevisiae Antiviral protein SKI2 - Yarrowia lipolytica (Candida lipolytica) Length = 1429 Score = 34.3 bits (75), Expect = 5.0 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = -2 Query: 991 GXXXGRGXXXGX-GXGRGGXGGXXXGGRXXQSXGRGXXPP 875 G GRG G G GRGG GG GG RG PP Sbjct: 539 GGRGGRGGKGGGDGGGRGGRGGGNGGGGGKGGFSRGPPPP 578 >UniRef50_Q5A0V8 Cluster: Putative uncharacterized protein; n=1; Candida albicans|Rep: Putative uncharacterized protein - Candida albicans (Yeast) Length = 106 Score = 34.3 bits (75), Expect = 5.0 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = +3 Query: 852 PXAXSAXAGGXXPL-PXDXXXLPPXXXPPXPPLPXPXPXXXPL 977 P A + PL P LPP PP PPLP P P PL Sbjct: 45 PLAPPSAPPRAPPLDPPRAPPLPPPRAPPSPPLPPPKPPRPPL 87 >UniRef50_Q4PBP1 Cluster: Putative uncharacterized protein; n=1; Ustilago maydis|Rep: Putative uncharacterized protein - Ustilago maydis (Smut fungus) Length = 638 Score = 34.3 bits (75), Expect = 5.0 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 997 FXGXXXGRGXXXGXGXGRGGXGGXXXGG 914 F G GRG G G GRGG GG GG Sbjct: 206 FRGGRGGRGGRGGRGGGRGGRGGGFGGG 233 >UniRef50_P42768 Cluster: Wiskott-Aldrich syndrome protein; n=14; Mammalia|Rep: Wiskott-Aldrich syndrome protein - Homo sapiens (Human) Length = 502 Score = 34.3 bits (75), Expect = 5.0 Identities = 19/66 (28%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P + G P P PP PP PP P P P Sbjct: 351 PPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGP 410 Query: 975 LPXXXP 992 P P Sbjct: 411 APPPLP 416 >UniRef50_P15771 Cluster: Nucleolin; n=25; Deuterostomia|Rep: Nucleolin - Gallus gallus (Chicken) Length = 694 Score = 34.3 bits (75), Expect = 5.0 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 997 FXGXXXGRGXXXGXGXGRGGXGGXXXGGRXXQSXGRG 887 F G GRG G G GRGG GG GGR G G Sbjct: 638 FGGGFGGRGGRGGRGGGRGGFGG-RGGGRGFGGRGGG 673 >UniRef50_Q4P6X2 Cluster: Putative uncharacterized protein; n=1; Ustilago maydis|Rep: Putative uncharacterized protein - Ustilago maydis (Smut fungus) Length = 1859 Score = 27.1 bits (57), Expect(2) = 5.1 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 899 GLXXPPXXXXPPTXPPPXP 955 GL PP PP PPP P Sbjct: 984 GLATPPPPPPPPPPPPPPP 1002 Score = 25.8 bits (54), Expect(2) = 5.1 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +2 Query: 929 PPTXPPPXPXSPXXXPS 979 PP PPP P +P PS Sbjct: 1029 PPPPPPPPPPAPGMMPS 1045 >UniRef50_UPI00015B541C Cluster: PREDICTED: hypothetical protein; n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical protein - Nasonia vitripennis Length = 661 Score = 33.9 bits (74), Expect = 6.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 P PP PPP P P PS PPP Sbjct: 485 PSPPPPPPPPPPPRPPPPPPPPSQPPP 511 >UniRef50_UPI00015B4CAB Cluster: PREDICTED: hypothetical protein; n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical protein - Nasonia vitripennis Length = 972 Score = 33.9 bits (74), Expect = 6.6 Identities = 14/29 (48%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXS--PXXXPSXPPP 991 PP PPT PPP P + P P+ PPP Sbjct: 725 PPPPTRPPTRPPPQPSTYLPPAPPTRPPP 753 >UniRef50_UPI0000DC1448 Cluster: UPI0000DC1448 related cluster; n=2; Rattus norvegicus|Rep: UPI0000DC1448 UniRef100 entry - Rattus norvegicus Length = 319 Score = 33.9 bits (74), Expect = 6.6 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +2 Query: 866 CXGWRXXSPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 C R P PP PP PP P P P PPP Sbjct: 99 CASERKNHPFSSPPSPPSPPPPPPPLPPSPSPPSPPPPSPPP 140 >UniRef50_Q3M5H7 Cluster: VCBS; n=2; Bacteria|Rep: VCBS - Anabaena variabilis (strain ATCC 29413 / PCC 7937) Length = 6581 Score = 33.9 bits (74), Expect = 6.6 Identities = 19/66 (28%), Positives = 21/66 (31%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P + P P P+P PP PP PP P P P P Sbjct: 2191 PIPPRPPIILPPIPIPIPIPPIPIPIPIPPIPIPIPIPP-PPPPPPPIPPRPEPPPPIPP 2249 Query: 975 LPXXXP 992 P P Sbjct: 2250 RPEPPP 2255 >UniRef50_Q6ZD62 Cluster: Putative pherophorin-dz1 protein; n=4; Eukaryota|Rep: Putative pherophorin-dz1 protein - Oryza sativa subsp. japonica (Rice) Length = 342 Score = 33.9 bits (74), Expect = 6.6 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +3 Query: 852 PXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXPLPXXXP 992 P + G P P PP PP P LP P P P P P Sbjct: 63 PPGRAPPPPGRAPPPPSQAPPPPRRAPPPPALPPPPPRRAPPPPSMP 109 >UniRef50_Q2R360 Cluster: C2 domain containing protein, expressed; n=1; Oryza sativa (japonica cultivar-group)|Rep: C2 domain containing protein, expressed - Oryza sativa subsp. japonica (Rice) Length = 347 Score = 33.9 bits (74), Expect = 6.6 Identities = 20/64 (31%), Positives = 21/64 (32%), Gaps = 2/64 (3%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAX--SAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXX 968 P P P V F P+ YP S G P P PP P P P P Sbjct: 212 PPPPPPPHVTQSFAPNSSYPPPPPPSQYIAGYPPPPPSNFYPPPPAGYPAPSFPSPTSTY 271 Query: 969 XPLP 980 P P Sbjct: 272 PPPP 275 >UniRef50_Q2HV13 Cluster: Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor; Pistil-specific extensin-like protein; n=2; Medicago truncatula|Rep: Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor; Pistil-specific extensin-like protein - Medicago truncatula (Barrel medic) Length = 200 Score = 33.9 bits (74), Expect = 6.6 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXS-PXXXPSXPPP 991 PP PPT PP P S P PS PPP Sbjct: 85 PPPSTPPPTTPPSTPPSIPRTPPSTPPP 112 >UniRef50_Q10R38 Cluster: Transposon protein, putative, CACTA, En/Spm sub-class; n=2; Oryza sativa|Rep: Transposon protein, putative, CACTA, En/Spm sub-class - Oryza sativa subsp. japonica (Rice) Length = 209 Score = 33.9 bits (74), Expect = 6.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P PS PPP Sbjct: 83 PPPPPLPPPPPPPAASPPPPPPSPPPP 109 >UniRef50_Q0JA38 Cluster: Os04g0617200 protein; n=2; Oryza sativa (japonica cultivar-group)|Rep: Os04g0617200 protein - Oryza sativa subsp. japonica (Rice) Length = 149 Score = 33.9 bits (74), Expect = 6.6 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = +2 Query: 887 SPXXGLXXPPXXXXP---PTXPPPXPXSPXXXPSXPPP 991 +P L PP P PT PPP P P P PPP Sbjct: 17 TPPPPLPPPPHPSPPLPLPTPPPPPPSPPPPPPPAPPP 54 >UniRef50_A7QNX2 Cluster: Chromosome chr1 scaffold_135, whole genome shotgun sequence; n=4; Magnoliophyta|Rep: Chromosome chr1 scaffold_135, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 673 Score = 33.9 bits (74), Expect = 6.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P S P PPP Sbjct: 82 PPPSPSPPPPPPPPPSSGSGPPKPPPP 108 >UniRef50_A5BR16 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 196 Score = 33.9 bits (74), Expect = 6.6 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 888 PLPXDXXXLPPXXXPPXPPLPXPXPXXXPLPXXXP 992 P P PP PP PP P P P P P P Sbjct: 12 PTPLSPPPPPPSPSPPPPPSPSPSPPPPPSPSPPP 46 >UniRef50_Q7QDL5 Cluster: ENSANGP00000000741; n=1; Anopheles gambiae str. PEST|Rep: ENSANGP00000000741 - Anopheles gambiae str. PEST Length = 421 Score = 33.9 bits (74), Expect = 6.6 Identities = 21/61 (34%), Positives = 22/61 (36%) Frame = -2 Query: 991 GXXXGRGXXXGXGXGRGGXGGXXXGGRXXQSXGRGXXPPAXAEXAXGYXQCGXNXGXTXX 812 G G G G G G GG GG GG G G PP+ GY Q G Sbjct: 182 GGYGGGGMSGGGGYGGGGGGGMGGGGG---GGGYGNAPPSSYNPMGGYGQNNGGPGGGPP 238 Query: 811 G 809 G Sbjct: 239 G 239 >UniRef50_Q874Y8 Cluster: DNA centromeric region sequence from BAC DP26B06, DP34F04, DP16D11, DP09G08, DP35C12 of chromosome 5 of Podospora anserina; n=18; Pezizomycotina|Rep: DNA centromeric region sequence from BAC DP26B06, DP34F04, DP16D11, DP09G08, DP35C12 of chromosome 5 of Podospora anserina - Podospora anserina Length = 516 Score = 33.9 bits (74), Expect = 6.6 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 991 GXXXGRGXXXGXGXGRGGXGGXXXGGRXXQSXG 893 G GRG G G GRGG GG GG S G Sbjct: 359 GGFGGRGGFGGGGYGRGGYGGGPGGGPGGPSFG 391 >UniRef50_Q6AHS6 Cluster: Protease-1 (PRT1) protein, putative; n=58; Pneumocystis carinii|Rep: Protease-1 (PRT1) protein, putative - Pneumocystis carinii Length = 947 Score = 33.9 bits (74), Expect = 6.6 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = +3 Query: 804 PXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXPLPX 983 P P P P A A P P PP P PP P P P P P Sbjct: 754 PAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPA 813 Query: 984 XXP 992 P Sbjct: 814 PPP 816 >UniRef50_Q2GSQ8 Cluster: Putative uncharacterized protein; n=2; Fungi/Metazoa group|Rep: Putative uncharacterized protein - Chaetomium globosum (Soil fungus) Length = 1005 Score = 33.9 bits (74), Expect = 6.6 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = -2 Query: 997 FXGXXXGRGXXXGXGXGRGGXGGXXXGGRXXQSXGRG 887 + G G G G G G GG GG GGR GRG Sbjct: 78 YQGGGGGGGGYQGGGRGGGGGGGYQGGGRGGGRGGRG 114 >UniRef50_A6R957 Cluster: Cytokinesis protein sepA; n=1; Ajellomyces capsulatus NAm1|Rep: Cytokinesis protein sepA - Ajellomyces capsulatus NAm1 Length = 1670 Score = 33.9 bits (74), Expect = 6.6 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +2 Query: 890 PXXGLXXPPXXXXPPTX--PPPXPXSPXXXPSXPPP 991 P G+ PP PP PPP P P P PPP Sbjct: 959 PPPGVGGPPPPPPPPGMGGPPPPPPPPGAGPGGPPP 994 >UniRef50_Q0GNC1 Cluster: Inverted formin-2; n=13; Euteleostomi|Rep: Inverted formin-2 - Mus musculus (Mouse) Length = 1273 Score = 33.9 bits (74), Expect = 6.6 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 888 PLPXDXXXLPPXXXPPXPPLPXPXPXXXPLPXXXP 992 PLP PP PP PPLP P P + P Sbjct: 460 PLPGSGTTSPPPPPPPPPPLPPPLPGSGTISPPPP 494 Score = 33.5 bits (73), Expect = 8.7 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P S P PPP Sbjct: 470 PPPPPPPPPLPPPLPGSGTISPPPPPP 496 >UniRef50_O95466 Cluster: Formin-like protein 1; n=39; Tetrapoda|Rep: Formin-like protein 1 - Homo sapiens (Human) Length = 1100 Score = 33.9 bits (74), Expect = 6.6 Identities = 22/69 (31%), Positives = 23/69 (33%), Gaps = 3/69 (4%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXP---PLPXPXPX 965 P P P P P P S PLP D PP PP P+P P P Sbjct: 549 PGLPSPQEAPPSAPPQAP-PLPGSPEPPPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPP 607 Query: 966 XXPLPXXXP 992 P P P Sbjct: 608 PPPPPGGPP 616 >UniRef50_UPI0000F2E662 Cluster: PREDICTED: similar to CBLL1 protein; n=1; Monodelphis domestica|Rep: PREDICTED: similar to CBLL1 protein - Monodelphis domestica Length = 608 Score = 33.5 bits (73), Expect = 8.7 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 912 LPPXXXPPXPPLPXPXPXXXPLP 980 LPP PP PPLP P P P P Sbjct: 445 LPPPFPPPPPPLPPPPPPPPPPP 467 >UniRef50_UPI0000F1EE0D Cluster: PREDICTED: hypothetical protein; n=1; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 464 Score = 33.5 bits (73), Expect = 8.7 Identities = 16/62 (25%), Positives = 21/62 (33%) Frame = +2 Query: 803 AXPXXCAPXIPTTLXVSXRPFCXGWRXXSPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSX 982 A P P P + + P W +P + PP P PP P +P Sbjct: 306 ASPVPLPPAPPAPVRLPSAPLAPVWLPPAPPAPVLLPPTPPVPVQLPPALPAAPPVPVQL 365 Query: 983 PP 988 PP Sbjct: 366 PP 367 >UniRef50_UPI0000DA3CD5 Cluster: PREDICTED: hypothetical protein; n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical protein - Rattus norvegicus Length = 311 Score = 33.5 bits (73), Expect = 8.7 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 991 GXXXGRGXXXGXGXGRGGXGGXXXGGRXXQSXGRG 887 G G G G G G GG GG GGR GRG Sbjct: 206 GGGGGGGGGGGGGGGGGGGGGGGGGGRSGGGGGRG 240 >UniRef50_UPI00006A23F9 Cluster: UPI00006A23F9 related cluster; n=1; Xenopus tropicalis|Rep: UPI00006A23F9 UniRef100 entry - Xenopus tropicalis Length = 183 Score = 33.5 bits (73), Expect = 8.7 Identities = 21/65 (32%), Positives = 23/65 (35%), Gaps = 2/65 (3%) Frame = +3 Query: 804 PXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPP-XXXPPXPPLP-XPXPXXXPL 977 P P + P F P P + PLP P P PPLP P P PL Sbjct: 34 PPPSTLAPPFHPSFQAPSLPFLPSHALPPLPSKPPPSHPFLPSPSLPPLPSKPPPSLPPL 93 Query: 978 PXXXP 992 P P Sbjct: 94 PSKPP 98 >UniRef50_Q4RSI9 Cluster: Chromosome 13 SCAF15000, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 13 SCAF15000, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 307 Score = 33.5 bits (73), Expect = 8.7 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 914 PXXXXPPTXPPPXPXSPXXXPSXPP 988 P PP PPP P SP PS PP Sbjct: 186 PLFPPPPPPPPPPPFSPPPPPSPPP 210 >UniRef50_A4QN64 Cluster: Zgc:162320 protein; n=8; Danio rerio|Rep: Zgc:162320 protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 412 Score = 33.5 bits (73), Expect = 8.7 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P S P PPP Sbjct: 187 PPPAPGPPPPPPPPPPSGGGAPPAPPP 213 >UniRef50_Q9E938 Cluster: ICP4 protein; n=2; Gallid herpesvirus 3|Rep: ICP4 protein - Gallid herpesvirus 3 (Marek's disease virus type 2) Length = 2033 Score = 33.5 bits (73), Expect = 8.7 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PPT PP P P P PPP Sbjct: 238 PPLSPPPPTPPPLSPPPPTPPPHTPPP 264 >UniRef50_Q5YFM4 Cluster: Putative uncharacterized protein; n=2; Singapore grouper iridovirus|Rep: Putative uncharacterized protein - Singapore grouper iridovirus Length = 143 Score = 33.5 bits (73), Expect = 8.7 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 Query: 902 LXXPPXXXXPPTXPPPXPXSPXXXPSXPP 988 L PP PPT PPP P SP P PP Sbjct: 60 LWQPPTPSPPPT-PPPAPKSPISQPPPPP 87 >UniRef50_Q07701 Cluster: EBNA-2; n=1; Cercopithecine herpesvirus 12|Rep: EBNA-2 - Cercopithecine herpesvirus 12 (CeHV-12) (Baboon herpesvirus) Length = 530 Score = 33.5 bits (73), Expect = 8.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 888 PLPXDXXXLPPXXXPPXPPLPXPXPXXXPLP 980 PLP PP PP PP P P P P P Sbjct: 62 PLPGPSNLPPPSPPPPPPPPPPPPPPPPPQP 92 >UniRef50_Q8VWD1 Cluster: Putative glycine-rich protein; n=2; Streptomyces|Rep: Putative glycine-rich protein - Streptomyces coelicolor Length = 710 Score = 33.5 bits (73), Expect = 8.7 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP P P P SP P PPP Sbjct: 21 PPLPPPPPGRPSPSPTSPTAPPPGPPP 47 >UniRef50_A5NR52 Cluster: Putative uncharacterized protein; n=1; Methylobacterium sp. 4-46|Rep: Putative uncharacterized protein - Methylobacterium sp. 4-46 Length = 980 Score = 33.5 bits (73), Expect = 8.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 915 PPXXXPPXPPLPXPXPXXXPLPXXXP 992 PP PP PPLP P P P P P Sbjct: 727 PPPPPPPAPPLPPPAPPPAPPPAPPP 752 >UniRef50_A5NQH0 Cluster: Putative uncharacterized protein precursor; n=1; Methylobacterium sp. 4-46|Rep: Putative uncharacterized protein precursor - Methylobacterium sp. 4-46 Length = 462 Score = 33.5 bits (73), Expect = 8.7 Identities = 22/66 (33%), Positives = 23/66 (34%), Gaps = 1/66 (1%) Frame = +3 Query: 804 PXPXXVXPX-FXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXPLP 980 P P V P H P A A A P P +PP P P P P P P P Sbjct: 373 PMPEPVPPAPLAEHGPEPAAGHAPA--HEPAPPAPEPVPPPPEPEPEPEPPPPPPPAPEP 430 Query: 981 XXXPXK 998 P K Sbjct: 431 EPEPKK 436 >UniRef50_A7QW77 Cluster: Chromosome chr3 scaffold_199, whole genome shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome chr3 scaffold_199, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 290 Score = 33.5 bits (73), Expect = 8.7 Identities = 19/57 (33%), Positives = 20/57 (35%) Frame = +2 Query: 821 APXIPTTLXVSXRPFCXGWRXXSPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 AP PTT S SP PP P T PP P P+ PPP Sbjct: 101 APPTPTTPAASPPTAVTSPPASSPPPVSAPPPATPPPATPPPATPPPATPPPATPPP 157 >UniRef50_A4S1Y9 Cluster: Predicted protein; n=1; Ostreococcus lucimarinus CCE9901|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 1065 Score = 33.5 bits (73), Expect = 8.7 Identities = 19/63 (30%), Positives = 20/63 (31%) Frame = +3 Query: 804 PXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXPLPX 983 P P P P P + P P PP PP PP P P P P P Sbjct: 487 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPP-PSPPPSPPPSPP 545 Query: 984 XXP 992 P Sbjct: 546 PSP 548 >UniRef50_Q9VZC2 Cluster: CG15021-PA; n=1; Drosophila melanogaster|Rep: CG15021-PA - Drosophila melanogaster (Fruit fly) Length = 420 Score = 33.5 bits (73), Expect = 8.7 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P PS PP Sbjct: 70 PPQTRPPPPPPPPQPTPPAPRPSYGPP 96 Score = 33.5 bits (73), Expect = 8.7 Identities = 23/73 (31%), Positives = 25/73 (34%), Gaps = 5/73 (6%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXX---LP--PXXXPPXPPLPXPX 959 P P P P P P + + G LP D P P PP PP P P Sbjct: 160 PSAPAPSYGPPQPQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQPT 219 Query: 960 PXXXPLPXXXPXK 998 P P P P K Sbjct: 220 PGYGPPPPPPPPK 232 >UniRef50_Q57WJ7 Cluster: Calpain, putative; n=3; Trypanosoma brucei|Rep: Calpain, putative - Trypanosoma brucei Length = 888 Score = 33.5 bits (73), Expect = 8.7 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPP 988 PP PP PPP P P P+ PP Sbjct: 20 PPPVVAPPPPPPPPPPEPVAPPTPPP 45 >UniRef50_Q38EF1 Cluster: Putative uncharacterized protein; n=1; Trypanosoma brucei|Rep: Putative uncharacterized protein - Trypanosoma brucei Length = 576 Score = 33.5 bits (73), Expect = 8.7 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 899 GLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 G+ PP PP PPP P P PPP Sbjct: 524 GVPPPPPPPPPPKAPPPKGPPPKVAPPPPPP 554 >UniRef50_Q3HYB9 Cluster: Proline-and threonine-rich protein; n=2; Coccidioides|Rep: Proline-and threonine-rich protein - Coccidioides posadasii Length = 281 Score = 33.5 bits (73), Expect = 8.7 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 +P PP PP PPP P +P PPP Sbjct: 134 APTTSKAAPPPPPPPPPPPPPAPPAPKPSKPAPPP 168 >UniRef50_A7TQN2 Cluster: Putative uncharacterized protein; n=1; Vanderwaltozyma polyspora DSM 70294|Rep: Putative uncharacterized protein - Vanderwaltozyma polyspora DSM 70294 Length = 767 Score = 33.5 bits (73), Expect = 8.7 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = -2 Query: 979 GRGXXXGXGXGRGGXGGXXXGGRXXQSXGRG 887 GRG G G GRGG G GG + GRG Sbjct: 12 GRGGSRGRGRGRGGSRGRGRGGSRSRGAGRG 42 >UniRef50_A4RC14 Cluster: Predicted protein; n=1; Magnaporthe grisea|Rep: Predicted protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 429 Score = 33.5 bits (73), Expect = 8.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 899 GLXXPPXXXXPPTXPPPXPXSPXXXPSXPPPXK 997 G PP PP PP SP P PPP K Sbjct: 352 GAPPPPPPPPPPPPPPASSGSPAPPPPPPPPPK 384 >UniRef50_A4R5L4 Cluster: Putative uncharacterized protein; n=1; Magnaporthe grisea|Rep: Putative uncharacterized protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 737 Score = 33.5 bits (73), Expect = 8.7 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P P PPP Sbjct: 399 PPDEPPPPSEPPPPPNEPPPPDEPPPP 425 >UniRef50_P19837 Cluster: Spidroin-1; n=50; Araneae|Rep: Spidroin-1 - Nephila clavipes (Golden silk orbweaver) Length = 747 Score = 33.5 bits (73), Expect = 8.7 Identities = 21/62 (33%), Positives = 22/62 (35%) Frame = -2 Query: 979 GRGXXXGXGXGRGGXGGXXXGGRXXQSXGRGXXPPAXAEXAXGYXQCGXNXGXTXXGXGX 800 GRG G G G GG GG Q G+G A A G G G G G Sbjct: 307 GRGGLGGQGAGAAAAGGAGQGGLGGQGAGQGAGAAAAAAGGAGQGGYG-GLGSQGAGRGG 365 Query: 799 XG 794 G Sbjct: 366 LG 367 >UniRef50_Q9Y6X0 Cluster: SET-binding protein; n=26; Tetrapoda|Rep: SET-binding protein - Homo sapiens (Human) Length = 1542 Score = 33.5 bits (73), Expect = 8.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 915 PPXXXPPXPPLPXPXPXXXPLPXXXP 992 PP PP PPLP P P P P P Sbjct: 1466 PPLPPPPPPPLPPPPPPPLPPPPPLP 1491 >UniRef50_Q70E73 Cluster: Ras-associated and pleckstrin homology domains-containing protein 1; n=21; Amniota|Rep: Ras-associated and pleckstrin homology domains-containing protein 1 - Homo sapiens (Human) Length = 1302 Score = 33.5 bits (73), Expect = 8.7 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 912 LPPXXXPPXPPLPXPXPXXXPLP 980 LPP PP PP P P P PLP Sbjct: 680 LPPPPPPPPPPPPPPPPPPPPLP 702 >UniRef50_Q9TZQ3 Cluster: P granule abnormality protein 1; n=5; Caenorhabditis|Rep: P granule abnormality protein 1 - Caenorhabditis elegans Length = 730 Score = 33.5 bits (73), Expect = 8.7 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 991 GXXXGRGXXXGXGXGRGGXGGXXXGGRXXQSXGRG 887 G GRG G GRGG GG GGR RG Sbjct: 683 GDRGGRGGYGGDRGGRGGYGGGDRGGRGGYGGDRG 717 >UniRef50_P19338 Cluster: Nucleolin; n=39; Deuterostomia|Rep: Nucleolin - Homo sapiens (Human) Length = 710 Score = 33.5 bits (73), Expect = 8.7 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 997 FXGXXXGRGXXXGXGXGRGGXGGXXXGGRXXQSXGRG 887 F G GRG G G GRGG GG GR GRG Sbjct: 653 FGGRGGGRGGFGGRGGGRGGRGGFGGRGRGG-FGGRG 688 >UniRef50_Q9FPQ6 Cluster: Vegetative cell wall protein gp1 precursor; n=14; root|Rep: Vegetative cell wall protein gp1 precursor - Chlamydomonas reinhardtii Length = 555 Score = 33.5 bits (73), Expect = 8.7 Identities = 20/66 (30%), Positives = 21/66 (31%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P A P P PP PP PP P P P Sbjct: 228 PPSPAPPSPSPPAPPSPVPPSP--APPSPAPPSPKPPAPPPPPSPPPPPPPRPPFPANTP 285 Query: 975 LPXXXP 992 +P P Sbjct: 286 MPPSPP 291 >UniRef50_Q9Y4D1 Cluster: Disheveled-associated activator of morphogenesis 1; n=37; Amniota|Rep: Disheveled-associated activator of morphogenesis 1 - Homo sapiens (Human) Length = 1078 Score = 33.5 bits (73), Expect = 8.7 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 899 GLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 G+ PP PP PPP P P PPP Sbjct: 560 GMLPPPPPPLPPGGPPPPPGPPPLGAIMPPP 590 >UniRef50_P35790 Cluster: Choline kinase alpha; n=41; Euteleostomi|Rep: Choline kinase alpha - Homo sapiens (Human) Length = 457 Score = 33.5 bits (73), Expect = 8.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 915 PPXXXPPXPPLPXPXPXXXPLPXXXP 992 PP PP PPLP P P P P P Sbjct: 53 PPLALPPPPPLPLPLPLPQPPPPQPP 78 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 414,552,063 Number of Sequences: 1657284 Number of extensions: 4859855 Number of successful extensions: 107488 Number of sequences better than 10.0: 152 Number of HSP's better than 10.0 without gapping: 23425 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 64385 length of database: 575,637,011 effective HSP length: 101 effective length of database: 408,251,327 effective search space used: 94306056537 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -