BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_G11 (998 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 38 0.010 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 36 0.051 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 36 0.051 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.090 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.21 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.21 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.36 SB_29063| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.36 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 32 0.63 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 32 0.84 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 32 0.84 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 32 0.84 SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.84 SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 31 1.1 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 31 1.1 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 31 1.5 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 31 1.5 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) 31 1.9 SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) 30 2.6 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 30 2.6 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 30 2.6 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 30 2.6 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 30 3.4 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 30 3.4 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 29 4.5 SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) 29 4.5 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 29 4.5 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) 29 4.5 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.9 SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.9 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.9 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 29 5.9 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.9 SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) 29 5.9 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 29 7.8 SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) 29 7.8 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 29 7.8 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 29 7.8 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 29 7.8 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.8 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 29 7.8 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.8 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 38.3 bits (85), Expect = 0.010 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 SP PP PP PPP P SP P PPP Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPP 398 Score = 37.9 bits (84), Expect = 0.013 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P S P P PP PP PP P P P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Query: 975 LPXXXP 992 P P Sbjct: 425 PPPPPP 430 Score = 35.1 bits (77), Expect = 0.090 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 406 PPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 34.3 bits (75), Expect = 0.16 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 S + PP PP P P P P PS PPP Sbjct: 358 SAGINMSPPPPPPPPPPPPSPPPPPPPPPPSPPPP 392 Score = 32.7 bits (71), Expect = 0.48 Identities = 19/66 (28%), Positives = 19/66 (28%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP PP P P P Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALR 435 Query: 975 LPXXXP 992 L P Sbjct: 436 LACAPP 441 Score = 30.7 bits (66), Expect = 1.9 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP P P P P P Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Query: 975 LP 980 P Sbjct: 430 PP 431 Score = 30.7 bits (66), Expect = 1.9 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P P P PP PP P P P P P Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Query: 975 LP 980 P Sbjct: 431 PP 432 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 35.9 bits (79), Expect = 0.051 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 899 GLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 G PP PP PPP P P P PPP Sbjct: 461 GQAPPPPPPPPPPPPPPPPPPPPPPPPFPPP 491 Score = 35.1 bits (77), Expect = 0.090 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPP 492 Score = 31.9 bits (69), Expect = 0.84 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P P P Sbjct: 470 PPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 29.5 bits (63), Expect = 4.5 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 876 GGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 G P P PP PP PP P P P P Sbjct: 461 GQAPPPPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 35.9 bits (79), Expect = 0.051 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 SP PP PP PPP P P P PPP Sbjct: 197 SPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPP 231 Score = 32.7 bits (71), Expect = 0.48 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP+ PPP P P PPP Sbjct: 206 PPPPRPPPSPPPPPPPPSPSPPRPPPP 232 Score = 30.3 bits (65), Expect = 2.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP P PPP P SP PPP Sbjct: 207 PPPRPPPSPPPPPPPPSPSPPRPPPPP 233 Score = 30.3 bits (65), Expect = 2.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 P PP PPP SP P PPP Sbjct: 209 PRPPPSPPPPPPPPSPSPPRPPPPPPP 235 Score = 29.1 bits (62), Expect = 5.9 Identities = 14/44 (31%), Positives = 16/44 (36%) Frame = +3 Query: 849 YPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXPLP 980 +P + S P P PP PP P P P P P P Sbjct: 194 HPTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSP 237 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 35.1 bits (77), Expect = 0.090 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 890 PXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 P G PP PP PPP +P P PPP Sbjct: 958 PPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPP 991 Score = 28.7 bits (61), Expect = 7.8 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 876 GGXXPLPXDXXXLPPXXXPPXPPLPXP 956 GG PLP P PP PP P P Sbjct: 968 GGAPPLPPPPGGSAPPPPPPPPPPPPP 994 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 34.3 bits (75), Expect = 0.16 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 914 PXXXXPPTXPPPXPXSPXXXPSXPPP 991 P PP PPP P P PS PPP Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPP 708 Score = 32.7 bits (71), Expect = 0.48 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPP 988 PP PP PPP P P P PP Sbjct: 686 PPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 32.7 bits (71), Expect = 0.48 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P +P P PP Sbjct: 689 PPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 31.9 bits (69), Expect = 0.84 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P PPP Sbjct: 685 PPPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +3 Query: 888 PLPXDXXXLPPXXXPPXPPLPXPXPXXXPLPXXXP 992 P+P PP PP PP P P P P P Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPP 709 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 891 LPXDXXXLPPXXXPPXPPLPXPXPXXXPLPXXXP 992 LP + P PP PP P P P P P P Sbjct: 674 LPIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPP 707 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 890 PXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 P L P PP PPP P P P P P Sbjct: 670 PIQILPIPIQTMVPPPPPPPPPPPPPPPPPPPQP 703 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 33.9 bits (74), Expect = 0.21 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 991 GXXXGRGXXXGXGXGRGGXGGXXXGGRXXQSXGRG 887 G GRG G GRGG GG GG GRG Sbjct: 150 GGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRG 184 Score = 29.9 bits (64), Expect = 3.4 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = -2 Query: 991 GXXXGRGXXXGXGX-GRGGXGGXXXGGRXXQSXGRG 887 G GRG G G GRG GG GG + GRG Sbjct: 167 GNGGGRGGGEGGGGRGRGTGGGSRGGGGDGRGRGRG 202 Score = 29.1 bits (62), Expect = 5.9 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = -2 Query: 991 GXXXGRGXXXGXGXGRGGXG--GXXXGGRXXQSXGRG 887 G GRG G G G GG G G GGR G G Sbjct: 144 GGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGG 180 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 33.9 bits (74), Expect = 0.21 Identities = 19/64 (29%), Positives = 23/64 (35%), Gaps = 2/64 (3%) Frame = +3 Query: 795 PXXPXPXXVXPXFXP--HXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXX 968 P P P P + P + YP + +A P PP PP P P P P Sbjct: 120 PNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPY 179 Query: 969 XPLP 980 P P Sbjct: 180 PPPP 183 Score = 33.5 bits (73), Expect = 0.27 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 840 HXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 H P SA GG P PP PP PP P P P P Sbjct: 69 HPDAPCLVSAKCGGHPPTNFSPN--PPYPPPPYPPYPPPPPYPPP 111 Score = 32.3 bits (70), Expect = 0.63 Identities = 19/62 (30%), Positives = 21/62 (33%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P+ YP +A P PP P PP P P P P Sbjct: 115 PYPPPPNAPYPP-PPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAP 173 Query: 975 LP 980 P Sbjct: 174 YP 175 Score = 32.3 bits (70), Expect = 0.63 Identities = 19/66 (28%), Positives = 22/66 (33%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P + P P + P P + PP PP PP P P P Sbjct: 149 PPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPN----PPYPPPPNPPYPPPPNAPNP 204 Query: 975 LPXXXP 992 P P Sbjct: 205 PPPNPP 210 Score = 31.9 bits (69), Expect = 0.84 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P +P P PPP Sbjct: 157 PPPLYPPPPNPPP-PNAPYPPPPYPPP 182 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +2 Query: 911 PPXXXXP-PTXPPPXPXSPXXXPSXPPP 991 PP P P PPP P P P PPP Sbjct: 92 PPYPPPPYPPYPPPPPYPPPPNPPYPPP 119 Score = 29.5 bits (63), Expect = 4.5 Identities = 19/68 (27%), Positives = 22/68 (32%), Gaps = 6/68 (8%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAX----AGGXXPLPXDXXXLPPXXXP--PXPPLPXP 956 P P P P + P YP + P P + PP P P P P P Sbjct: 90 PNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYP 149 Query: 957 XPXXXPLP 980 P P P Sbjct: 150 PPPNPPYP 157 Score = 29.5 bits (63), Expect = 4.5 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 SP PP PP PP P P PPP Sbjct: 143 SPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPP 177 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 2/29 (6%) Frame = +2 Query: 911 PPXXXXPPTXPPPXP--XSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 100 PPYPPPPPYPPPPNPPYPPPPNAPYPPPP 128 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 33.1 bits (72), Expect = 0.36 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 929 PPTXPPPXPXSPXXXPSXPPP 991 PP PPP P SP P PPP Sbjct: 1160 PPPPPPPPPSSPSPPPPPPPP 1180 Score = 31.9 bits (69), Expect = 0.84 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PP P P P PPP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPP 1183 >SB_29063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 33.1 bits (72), Expect = 0.36 Identities = 18/46 (39%), Positives = 20/46 (43%) Frame = -2 Query: 979 GRGXXXGXGXGRGGXGGXXXGGRXXQSXGRGXXPPAXAEXAXGYXQ 842 GRG G G GRGG GG GR + GRG GY + Sbjct: 26 GRGHCLGHGSGRGGRGGRGGSGR-GRGRGRGSGRGRGRGSGQGYGE 70 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 32.3 bits (70), Expect = 0.63 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P + PPP Sbjct: 308 PPPGGAPPPPPPPPPPPPGDGGAPPPP 334 Score = 29.1 bits (62), Expect = 5.9 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP P PPP P P PPP Sbjct: 295 PPADGSAPAPPPPPPPGGAPPPPPPPP 321 Score = 28.7 bits (61), Expect = 7.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP P PPP P P PPP Sbjct: 307 PPPPGGAPPPPPPPPPPPPGDGGAPPP 333 Score = 28.7 bits (61), Expect = 7.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 890 PXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 P G PP PP PPP P P PPP Sbjct: 308 PPPGGAPPP----PPPPPPPPPGDGGAPPPPPPP 337 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 31.9 bits (69), Expect = 0.84 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 914 PXXXXPPTXPPPXPXSPXXXPSXPP 988 P PPT PPP P P P PP Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPPP 83 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 876 GGXXPLPXDXXXLPPXXXPPXPPLPXPXP 962 G P+P LPP PP PPLP P P Sbjct: 58 GPTVPIPPT---LPPPPPPPPPPLPPPPP 83 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 31.9 bits (69), Expect = 0.84 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 914 PXXXXPPTXPPPXPXSPXXXPSXPP 988 P PPT PPP P P P PP Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPPP 307 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 876 GGXXPLPXDXXXLPPXXXPPXPPLPXPXP 962 G P+P LPP PP PPLP P P Sbjct: 282 GPTVPIPPT---LPPPPPPPPPPLPPPPP 307 >SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) Length = 397 Score = 31.9 bits (69), Expect = 0.84 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +2 Query: 875 WRXXSPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 W P P PPT PPP S P PPP Sbjct: 239 WTGDKPHPPSVKPSVPIPPPTKPPPRVASRRPPPPLPPP 277 >SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 246 Score = 31.9 bits (69), Expect = 0.84 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 991 GXXXGRGXXXGXGXGRGGXGGXXXGGRXXQSXGRG 887 G GRG G G GRGG G GG G G Sbjct: 120 GEGMGRGGMAGEGMGRGGMAGEGMGGGGMAGEGMG 154 >SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2346 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = +2 Query: 875 WRXXSPXXGLXXP-PXXXXPPTX-PPPXPXSPXXXPSXPPPXK 997 W P GL P P PP PPP P P PPP + Sbjct: 1331 WELPLPPSGLPLPLPRLPLPPLRLPPPHSRLPLPPPKLPPPSR 1373 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXP 985 PP PP PPP P P PS P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/48 (31%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = +2 Query: 857 RPFCXGWRXXSPXXGLXXPPXXXXPP---TXPPPXPXSPXXXPSXPPP 991 + + G+ P G PP PP T PPP +P P+ PP Sbjct: 114 KKYLGGYVPPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPP 161 Score = 29.5 bits (63), Expect = 4.5 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 876 GGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXPLPXXXP 992 GG P P LPP P P P P P P P Sbjct: 118 GGYVPPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPP 156 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +2 Query: 899 GLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 G+ PP P PPP P P P+ PPP Sbjct: 289 GMLPPPFGGHPAAAPPPPPL-PAGVPAPPPP 318 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -2 Query: 979 GRGXXXGXGXGR--GGXGGXXXGGRXXQSXGRGXXP 878 GRG G G G GG GG GG S GRG P Sbjct: 340 GRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRGPPP 375 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 31.1 bits (67), Expect = 1.5 Identities = 19/77 (24%), Positives = 25/77 (32%) Frame = +3 Query: 732 PRIIDPITLXXQ*SXXSRXXXPXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXX 911 P +I P+ + + P P P P +P GG P P Sbjct: 224 PPMIPPVGMLGHPPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPP-PGMPPP 282 Query: 912 LPPXXXPPXPPLPXPXP 962 +PP PP P P P Sbjct: 283 MPPGGMPPNMEQPPPPP 299 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 31.1 bits (67), Expect = 1.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 P PP PPP P P P PPP Sbjct: 190 PMAGMPPPPPPPPPPGFPGGAPPPPPP 216 Score = 30.3 bits (65), Expect = 2.6 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXP---PPXPXSPXXXPSXPPP 991 SP G+ PP PP P PP P P P PPP Sbjct: 189 SPMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAP--PPP 224 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 31.1 bits (67), Expect = 1.5 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 914 PXXXXPPTXPPPXPXSPXXXPSXPPP 991 P PPT PP P P P PPP Sbjct: 374 PPPPPPPTNGPPPPPPPTNGPPPPPP 399 Score = 31.1 bits (67), Expect = 1.5 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 914 PXXXXPPTXPPPXPXSPXXXPSXPPP 991 P PPT PP P P P PPP Sbjct: 384 PPPPPPPTNGPPPPPPPTNGPPPPPP 409 Score = 30.7 bits (66), Expect = 1.9 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 795 PXXPXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXP 974 P P P P P P G P P PP PP PP P P P Sbjct: 355 PSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPP------PPTNGPPPPPPPTNGPPPPP 408 Query: 975 LPXXXP 992 P P Sbjct: 409 PPTNGP 414 Score = 30.3 bits (65), Expect = 2.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 929 PPTXPPPXPXSPXXXPSXPPP 991 PPT PP P P P PPP Sbjct: 369 PPTNKPPPPPPPTNGPPPPPP 389 Score = 29.1 bits (62), Expect = 5.9 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP P PPP P P PPP Sbjct: 374 PPPPPPPTNGPPPPPPPTNGPPPPPPP 400 Score = 29.1 bits (62), Expect = 5.9 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP P PPP P P PPP Sbjct: 384 PPPPPPPTNGPPPPPPPTNGPPPPPPP 410 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 914 PXXXXPPTXPPPXPXSPXXXPSXPPP 991 P PP PPP P S P PPP Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPPP 102 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP P PPP P P P PPP Sbjct: 415 PPWQTTPGYIPPPPPGFPQFQPPPPPP 441 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P PPP Sbjct: 96 PPACCAPPPPPPPPP--PPPPPPPPPP 120 >SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) Length = 441 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXP 985 PP PPT PPP P +P PS P Sbjct: 170 PPPEILPPTAPPPQP-APAISPSAP 193 >SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) Length = 246 Score = 30.3 bits (65), Expect = 2.6 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +2 Query: 887 SPXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 +P L PP P + PPP P S PPP Sbjct: 151 TPSSSLLPPPSSSPPLSSPPPPPPSTPSSSLLPPP 185 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 30.3 bits (65), Expect = 2.6 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +2 Query: 914 PXXXXPPTXPPPXPXSPXXXPSXPPP 991 P PP PP P P P+ PPP Sbjct: 72 PAAPPPPAAPPAAPPPPPPLPAPPPP 97 Score = 29.9 bits (64), Expect = 3.4 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP P P P P+ PPP Sbjct: 51 PPPPPSPPAAAPAAPPPPAAAPAAPPP 77 Score = 29.1 bits (62), Expect = 5.9 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP P PPP P +P P PPP Sbjct: 65 PPPPAAAPAAPPP-PAAPPAAPPPPPP 90 Score = 28.7 bits (61), Expect = 7.8 Identities = 17/59 (28%), Positives = 18/59 (30%) Frame = +3 Query: 804 PXPXXVXPXFXPHXXYPXAXSAXAGGXXPLPXDXXXLPPXXXPPXPPLPXPXPXXXPLP 980 P P P P P A + A P PP P PP P P P P Sbjct: 51 PPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAP 109 Score = 28.7 bits (61), Expect = 7.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PP PPP P P P P Sbjct: 75 PPPPAAPPAAPPPPPPLPAPPPPPAQP 101 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 30.3 bits (65), Expect = 2.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -3 Query: 990 GGGXEGXXXGXXGXGGGXVGGXXXXGG 910 GGG +G G G GGG GG GG Sbjct: 771 GGGGDGGDGGGGGDGGGGGGGGGGGGG 797 Score = 30.3 bits (65), Expect = 2.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -3 Query: 990 GGGXEGXXXGXXGXGGGXVGGXXXXGG 910 GGG +G G G GGG GG GG Sbjct: 780 GGGGDGGGGGGGGGGGGGGGGGGDGGG 806 Score = 29.5 bits (63), Expect = 4.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 990 GGGXEGXXXGXXGXGGGXVGGXXXXGGXXSPXXGEXXLQPXQXG 859 GGG G G G GGG GG GG E Q G Sbjct: 847 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVIKNEESSTDQQKG 890 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 30.3 bits (65), Expect = 2.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 990 GGGXEGXXXGXXGXGGGXVGGXXXXGG 910 GGG G G G GGG GG GG Sbjct: 158 GGGYRGRGRGGGGYGGGGYGGGGYGGG 184 Score = 29.5 bits (63), Expect = 4.5 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 990 GGGXEGXXXGXXGXGGGXVGGXXXXGG 910 GGG G G G GGG GG GG Sbjct: 173 GGGYGGGGYGGGGHGGGGYGGGGYGGG 199 Score = 28.7 bits (61), Expect = 7.8 Identities = 21/68 (30%), Positives = 23/68 (33%), Gaps = 2/68 (2%) Frame = -2 Query: 991 GXXXGRGXXXG--XGXGRGGXGGXXXGGRXXQSXGRGXXPPAXAEXAXGYXQCGXNXGXT 818 G GRG G G G G GG GG + GRG G G + G Sbjct: 131 GYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGG 190 Query: 817 XXGXGXXG 794 G G G Sbjct: 191 YGGGGYGG 198 Score = 28.7 bits (61), Expect = 7.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 990 GGGXEGXXXGXXGXGGGXVGGXXXXGG 910 GGG G G G GGG GG GG Sbjct: 168 GGGYGGGGYGGGGYGGGGHGGGGYGGG 194 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 30.3 bits (65), Expect = 2.6 Identities = 17/50 (34%), Positives = 19/50 (38%) Frame = -3 Query: 990 GGGXEGXXXGXXGXGGGXVGGXXXXGGXXSPXXGEXXLQPXQXGRXDTXN 841 GGG G G G GGG GG GG + G G D+ N Sbjct: 673 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDGDVDSNN 722 Score = 28.7 bits (61), Expect = 7.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 990 GGGXEGXXXGXXGXGGGXVGGXXXXGG 910 GGG G G G GGG GG GG Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGG 688 Score = 28.7 bits (61), Expect = 7.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 990 GGGXEGXXXGXXGXGGGXVGGXXXXGG 910 GGG G G G GGG GG GG Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGG 689 Score = 28.7 bits (61), Expect = 7.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 990 GGGXEGXXXGXXGXGGGXVGGXXXXGG 910 GGG G G G GGG GG GG Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGGGGG 690 Score = 28.7 bits (61), Expect = 7.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 990 GGGXEGXXXGXXGXGGGXVGGXXXXGG 910 GGG G G G GGG GG GG Sbjct: 665 GGGGGGGGGGGGGGGGGGGGGGGGGGG 691 Score = 28.7 bits (61), Expect = 7.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 990 GGGXEGXXXGXXGXGGGXVGGXXXXGG 910 GGG G G G GGG GG GG Sbjct: 666 GGGGGGGGGGGGGGGGGGGGGGGGGGG 692 Score = 28.7 bits (61), Expect = 7.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 990 GGGXEGXXXGXXGXGGGXVGGXXXXGG 910 GGG G G G GGG GG GG Sbjct: 667 GGGGGGGGGGGGGGGGGGGGGGGGGGG 693 Score = 28.7 bits (61), Expect = 7.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 990 GGGXEGXXXGXXGXGGGXVGGXXXXGG 910 GGG G G G GGG GG GG Sbjct: 668 GGGGGGGGGGGGGGGGGGGGGGGGGGG 694 Score = 28.7 bits (61), Expect = 7.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 990 GGGXEGXXXGXXGXGGGXVGGXXXXGG 910 GGG G G G GGG GG GG Sbjct: 669 GGGGGGGGGGGGGGGGGGGGGGGGGGG 695 Score = 28.7 bits (61), Expect = 7.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 990 GGGXEGXXXGXXGXGGGXVGGXXXXGG 910 GGG G G G GGG GG GG Sbjct: 670 GGGGGGGGGGGGGGGGGGGGGGGGGGG 696 Score = 28.7 bits (61), Expect = 7.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 990 GGGXEGXXXGXXGXGGGXVGGXXXXGG 910 GGG G G G GGG GG GG Sbjct: 671 GGGGGGGGGGGGGGGGGGGGGGGGGGG 697 Score = 28.7 bits (61), Expect = 7.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 990 GGGXEGXXXGXXGXGGGXVGGXXXXGG 910 GGG G G G GGG GG GG Sbjct: 672 GGGGGGGGGGGGGGGGGGGGGGGGGGG 698 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 29.9 bits (64), Expect = 3.4 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = -2 Query: 991 GXXXGRGXXXGXGXGRGGXGGXXXGGRXXQSXGRG 887 G GRG G G G GG G GG + G+G Sbjct: 328 GGGMGRGPGGGLGRGPGGGWGRMQGGGMGRGPGQG 362 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 29.9 bits (64), Expect = 3.4 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 888 PLPXDXXXLPPXXXPPXPPLPXP 956 PLP D PP P PPLP P Sbjct: 458 PLPPDEEKPPPPPAPALPPLPLP 480 Score = 29.5 bits (63), Expect = 4.5 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = +3 Query: 867 AXAGGXXPLPXDXXX-LPPXXXPPXPPLPXPXPXXXPLPXXXP 992 A A PLP D LPP P PP P P PLP P Sbjct: 443 ASAATLPPLPSDEPPPLPPDEEKPPPP-PAPALPPLPLPPELP 484 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 29.5 bits (63), Expect = 4.5 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -3 Query: 990 GGGXEGXXXGXXGXGGGXVGGXXXXGGXXSPXXGE 886 GGG G G G GGG GG GG G+ Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGD 167 Score = 29.5 bits (63), Expect = 4.5 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -3 Query: 990 GGGXEGXXXGXXGXGGGXVGGXXXXGGXXSPXXGE 886 GGG G G G GGG GG GG G+ Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDGD 169 Score = 28.7 bits (61), Expect = 7.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 990 GGGXEGXXXGXXGXGGGXVGGXXXXGG 910 GGG G G G GGG GG GG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGG 158 >SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) Length = 295 Score = 29.5 bits (63), Expect = 4.5 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPP 988 P PPT PP P +P P+ PP Sbjct: 232 PTDPPVPPTNPPVPPTNPPAPPTNPP 257 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 29.5 bits (63), Expect = 4.5 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 932 PTXPPPXPXSPXXXPSXPPP 991 P PPP P +P P PPP Sbjct: 906 PAPPPPLPLAPEPPPPLPPP 925 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 29.5 bits (63), Expect = 4.5 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 912 LPPXXXPPXPPLPXPXPXXXPLP 980 + P PP PP P P P PLP Sbjct: 1305 IQPPESPPPPPPPPPPPPPPPLP 1327 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 29.5 bits (63), Expect = 4.5 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPPP 991 PP PPT PPP +P + PP Sbjct: 101 PPPPTMPPTPPPPQTPAPPGPDTPAPP 127 >SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) Length = 2735 Score = 29.5 bits (63), Expect = 4.5 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +2 Query: 890 PXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 P + PP PP P P +P P PPP Sbjct: 2615 PMVPMMLPPMLPLPPPGLPMQPEAPVQPPPLPPP 2648 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 29.1 bits (62), Expect = 5.9 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +3 Query: 888 PLPXDXXXLPPXXXPPXPPL--PXPXPXXXPLP 980 PLP D PP P PP P P P P P Sbjct: 1018 PLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTP 1050 >SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 650 Score = 29.1 bits (62), Expect = 5.9 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = +2 Query: 911 PPXXXXPPTXP--PPXPXS-PXXXPSXPP 988 PP PPT P PP P S P PS PP Sbjct: 531 PPPQPYPPTQPSYPPTPSSYPPTQPSYPP 559 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 29.1 bits (62), Expect = 5.9 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 990 GGGXEGXXXGXXGXGGGXVGGXXXXGGXXSPXXGE 886 GGG G G G GGG GG GG S GE Sbjct: 334 GGGATGGGGGVTGGGGGATGG---GGGPGSGGCGE 365 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +2 Query: 890 PXXGLXXPPXXXXPPTXPPPXPXSPXXXPSXPPP 991 P G+ PP P PPP P P PPP Sbjct: 349 PSMGMAPPPVGGAAPPPPPPPPVG--GPPPPPPP 380 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 991 GXXXGRGXXXGXGXGRGGXGGXXXGG 914 G GRG G G GRGG G GG Sbjct: 326 GYGGGRGGGRGYGGGRGGGGRRDYGG 351 >SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) Length = 496 Score = 29.1 bits (62), Expect = 5.9 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 911 PPXXXXPPTXPPPXPXSPXXXPSXPP 988 PP PT PP P SP P PP Sbjct: 279 PPSLIRYPTLPPRYPPSPPRYPPSPP 304 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 28.7 bits (61), Expect = 7.8 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = -3 Query: 990 GGGXEGXXXGXXGXGGGXVGGXXXXGGXXSPXXGE 886 GGG +G G G GGG GG G G+ Sbjct: 309 GGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGD 343 >SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) Length = 693 Score = 28.7 bits (61), Expect = 7.8 Identities = 13/32 (40%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +2 Query: 899 GLXXPPXXXXPPTXPP-PXPXSPXXXPSXPPP 991 G+ PP PT PP P P P PPP Sbjct: 58 GMPMPPAYPGMPTYPPQPMQFLPGTLPGMPPP 89 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 28.7 bits (61), Expect = 7.8 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -3 Query: 987 GGXEGXXXGXXGXGGGXVGGXXXXGGXXSPXXG 889 GG G G G GGG GG GG + G Sbjct: 40 GGATGGHGGATGGGGGATGGGATGGGGGATGGG 72 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 28.7 bits (61), Expect = 7.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 990 GGGXEGXXXGXXGXGGGXVGGXXXXGG 910 GGG G G G GGG GG GG Sbjct: 207 GGGGYGGGRGGGGYGGGHGGGGYGGGG 233 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 28.7 bits (61), Expect = 7.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 990 GGGXEGXXXGXXGXGGGXVGGXXXXGG 910 GGG G G G GGG GG GG Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGG 89 Score = 28.7 bits (61), Expect = 7.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 990 GGGXEGXXXGXXGXGGGXVGGXXXXGG 910 GGG G G G GGG GG GG Sbjct: 74 GGGGGGGGGGDDGDGGGGDGGGGGGGG 100 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 28.7 bits (61), Expect = 7.8 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 894 PXDXXXLPPXXXPPXPPLPXPXPXXXPLPXXXP 992 P + L P PP P P P P P P P Sbjct: 215 PPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPP 247 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 28.7 bits (61), Expect = 7.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 990 GGGXEGXXXGXXGXGGGXVGGXXXXGG 910 GGG G G G GGG GG GG Sbjct: 98 GGGFGGGGGGGFGGGGGGGGGFGGGGG 124 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 28.7 bits (61), Expect = 7.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 990 GGGXEGXXXGXXGXGGGXVGGXXXXGG 910 GGG G G G GGG GG GG Sbjct: 1763 GGGGMGGGGGMAGGGGGMGGGGMAAGG 1789 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,927,148 Number of Sequences: 59808 Number of extensions: 143967 Number of successful extensions: 2826 Number of sequences better than 10.0: 53 Number of HSP's better than 10.0 without gapping: 526 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1556 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2979300250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -