BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_G10 (982 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||... 52 2e-07 SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe... 46 1e-05 SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr... 43 6e-05 SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 42 1e-04 SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Sc... 42 2e-04 SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 39 0.001 SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex p... 39 0.001 SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, wit... 38 0.002 SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||M... 38 0.003 SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family ... 34 0.027 SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1... 33 0.046 SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac... 33 0.061 SPAC140.02 |gar2||GAR family|Schizosaccharomyces pombe|chr 1|||M... 31 0.25 SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1... 31 0.33 SPBC119.05c |||Wiskott-Aldrich syndrome homolog binding protein ... 30 0.43 SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyc... 30 0.57 SPCC306.09c |cap1|cap|adenylyl cyclase-associated protein Cap1|S... 26 0.68 SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizo... 29 1.0 SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pomb... 28 1.7 SPBC215.13 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||... 28 2.3 SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccha... 28 2.3 SPAC3H1.06c |||membrane transporter |Schizosaccharomyces pombe|c... 28 2.3 SPAC19G12.15c |tpp1||trehalose-6-phosphate phosphatase Tpp1|Schi... 27 3.1 SPAC32A11.02c |||conserved fungal protein|Schizosaccharomyces po... 27 3.1 SPBC146.13c |myo1||myosin type I|Schizosaccharomyces pombe|chr 2... 23 3.8 SPBC557.04 |ppk29||Ark1/Prk1 family protein kinase Ppk29|Schizos... 27 4.0 SPCC584.04 |sup35|erf3|translation release factor eRF3 |Schizosa... 27 4.0 SPAC6G9.10c |sen1||ATP-dependent 5' to 3' DNA/RNA helicase Sen1|... 27 5.3 SPAC26A3.16 |dph1|ucp5|UBA domain protein Dph1|Schizosaccharomyc... 26 9.3 SPBC317.01 |mbx2|pvg4|MADS-box transcription factor Pvg4|Schizos... 26 9.3 SPCC1795.11 |sum3|ded1, slh3, moc2|ATP-dependent RNA helicase Su... 26 9.3 >SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1461 Score = 51.6 bits (118), Expect = 2e-07 Identities = 25/54 (46%), Positives = 25/54 (46%), Gaps = 4/54 (7%) Frame = +1 Query: 829 PPXPPP----PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PPP P P P P PP PP PP PP PPPPPP PP Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPP--PPPPPGVAGAGPPPPPPPPP 783 Score = 37.9 bits (84), Expect = 0.002 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P P P PP P PPP PP P PPP PP Sbjct: 737 PAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPP 783 Score = 37.1 bits (82), Expect = 0.004 Identities = 20/58 (34%), Positives = 21/58 (36%) Frame = +3 Query: 801 LTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 L L + PP P P PP PPP PP P PPP PP P Sbjct: 727 LLLKSPPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPP-PPPPGVAGAGPPPPPPPPP 783 Score = 34.7 bits (76), Expect = 0.020 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXP 935 P + +PT P PPP P PP PP PP P P Sbjct: 735 PPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPP 783 Score = 33.1 bits (72), Expect = 0.061 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PPP P P P PPP PP P P PP PP P Sbjct: 733 PPPPPAVIVPTPAPAPIPVPPPAPIM--GGPPPPPPPPGVAGAGPPPPPPPPP 783 Score = 32.7 bits (71), Expect = 0.081 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPS 937 P P P PPP P PPP PP P P P+ Sbjct: 746 PAPIPV-PPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPPA 784 Score = 31.1 bits (67), Expect = 0.25 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 4/57 (7%) Frame = +1 Query: 817 PXXXPPXPP----PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PP P PPPP P P G P P PP P P P P Sbjct: 748 PIPVPPPAPIMGGPPPPPPPPGVA---GAGPPPPPPPPPAVSAGGSRYYAPAPQAEP 801 Score = 28.3 bits (60), Expect = 1.7 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 6/42 (14%) Frame = +1 Query: 829 PPXPP------PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPL 936 PP PP PPPP P P A G P P P + Sbjct: 764 PPPPPGVAGAGPPPPPPPPPAVSAGGSRYYAPAPQAEPEPKI 805 >SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 273 Score = 45.6 bits (103), Expect = 1e-05 Identities = 26/56 (46%), Positives = 26/56 (46%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXW 810 GG GG GGG GG GG GG G GG G G GG GGG GG W Sbjct: 221 GGHGGFGGGPGGF-EGGPGGFGGGPGGFGGGLGG--FGGGPGGFGGGPGGHGGPGW 273 Score = 44.8 bits (101), Expect = 2e-05 Identities = 26/56 (46%), Positives = 26/56 (46%), Gaps = 2/56 (3%) Frame = -3 Query: 977 GGXGGGGG-GXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGG-GGXGGXXXG 816 GG GG GG G GG GG GG G GG G G GGG GG GG G Sbjct: 205 GGFGGFGGFGGEGHHHGGHGGFGGGPGGFEGGPGGFGGGPGGFGGGLGGFGGGPGG 260 Score = 44.0 bits (99), Expect = 3e-05 Identities = 24/54 (44%), Positives = 24/54 (44%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGG GG GG GG G G G G G G GG GG GG G Sbjct: 191 GGFGGGSGGPPPGP-GGFGGFGGFGGEGHHHGGHGGFGGGPGGFEGGPGGFGGG 243 Score = 42.3 bits (95), Expect = 1e-04 Identities = 26/60 (43%), Positives = 26/60 (43%), Gaps = 6/60 (10%) Frame = -3 Query: 977 GGXGG-GGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXG-----GGGGGXGGXXXG 816 GG GG GG G GG GG GG G GG G G G GG GG GG G Sbjct: 208 GGFGGFGGEGHHHGGHGGFGGGPGGFEGGPGGFGGGPGGFGGGLGGFGGGPGGFGGGPGG 267 >SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr 2|||Manual Length = 305 Score = 43.2 bits (97), Expect = 6e-05 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GG GGG GG GG GG G GG G GG GG GG Sbjct: 23 GGRGGFGGGRGGARGGGRGGARGGRGGRGGARGG--RGGSSGGRGGAKGG 70 Score = 41.1 bits (92), Expect = 2e-04 Identities = 24/54 (44%), Positives = 24/54 (44%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GG GG G GG GG G GG A G G GG GG GG G Sbjct: 19 GGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGG-ARG-GRGGSSGGRGGAKGG 70 Score = 39.9 bits (89), Expect = 5e-04 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GG GG GG GG GG G G A G G GG GG GG Sbjct: 9 GGRGGSRGGRGGF-NGGRGGFGGGRGGARGGGRGGARG-GRGGRGGARGG 56 Score = 38.7 bits (86), Expect = 0.001 Identities = 27/64 (42%), Positives = 27/64 (42%), Gaps = 1/64 (1%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGG-XGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRVS 800 GG GG GG G G G GG GGG G GG R GG GG GG G Sbjct: 9 GGRGGSRGGRGGFNG-GRGGFGGGRGGARGGGRGGAR--GGRGGRGGARGGRGGSSGGRG 65 Query: 799 XAXG 788 A G Sbjct: 66 GAKG 69 Score = 36.3 bits (80), Expect = 0.007 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -3 Query: 935 RGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 RGG GG GG G GG G G G GGG GG G Sbjct: 8 RGGRGGSRGGRGGFNGGRGGFGGGRG-GARGGGRGGARGG 46 Score = 34.3 bits (75), Expect = 0.027 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG GG G G G GG G GG R GG GG G GG Sbjct: 20 GFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGAR------GGRGGSSGGRGG 66 Score = 33.1 bits (72), Expect = 0.061 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 942 GXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGG 820 G G G GG G GGGR G GG G GG Sbjct: 9 GGRGGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRGG 49 Score = 26.2 bits (55), Expect = 7.1 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXG---GXXGGXGXGXXPXGGXA 870 GG GGG G RGG G G GG G G A Sbjct: 33 GGARGGGRGGARGGRGGRGGARGGRGGSSGGRGGAKGGA 71 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 41.9 bits (94), Expect = 1e-04 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXP--PXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PP PP P P A P P P P P PPL PPP P P Sbjct: 428 PPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAPAPPPAPAP 482 Score = 40.3 bits (90), Expect = 4e-04 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PPP P A PP G P P P L P PP PP Sbjct: 388 PPAPPPAIPGRSAPALPPLGNASRTSTPPVPTPPSLPPSAPPSLPPSAPP 437 Score = 40.3 bits (90), Expect = 4e-04 Identities = 20/54 (37%), Positives = 21/54 (38%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP P P + P P PP P PPL P PP PP Sbjct: 420 PPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGM--PAAPPLPP 471 Score = 37.5 bits (83), Expect = 0.003 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 12/59 (20%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXG----XXPXPXPPXXP--------PXPPLXXXXXPPPPPPXPP 978 PPPPPP PP G P PP P P PP PPPPP P Sbjct: 312 PPPPPPSRRNRGKPPIGNGSSNSSLPPPPPPPRSNAAGSIPLPPQGRSAPPPPPPRSAP 370 Score = 37.1 bits (82), Expect = 0.004 Identities = 21/59 (35%), Positives = 22/59 (37%), Gaps = 2/59 (3%) Frame = +3 Query: 807 LPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXP--XPXXPXXPPPXPPXPP 977 +PT PP PP P PP P PP PP P P P PP PP Sbjct: 417 VPTPPSLPPSAPPSLP----PSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPP 471 Score = 35.5 bits (78), Expect = 0.012 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 8/58 (13%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP--------XPPXPP 977 PP PPPPP P PPP PP P PPP PP PP Sbjct: 337 PP--PPPPPRSNAAGSIPLPPQGRSAPPPPPPRSAPSTGRQPPPLSSSRAVSNPPAPP 392 Score = 33.9 bits (74), Expect = 0.035 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 PT PP P P R P P PPP PP P PP PP P Sbjct: 224 PTSTSAPPIPPSIPSSRPPERVPSLSA---PAPPPIPP-PSNGTVSSPPNSPPRP 274 Score = 33.9 bits (74), Expect = 0.035 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PP P PP PP P P P PP PP P Sbjct: 388 PPAPPPAIPGRSAPALPPLGNASRTSTPPV-PTPPSLPPSAPPSLPPSAP 436 Score = 33.5 bits (73), Expect = 0.046 Identities = 24/60 (40%), Positives = 24/60 (40%), Gaps = 14/60 (23%) Frame = +1 Query: 841 PPPPPXPXPXAX-----PPXGXX-PXPXPPXXPPX-----PPLXXXXX---PPPPPPXPP 978 PPPPP P A PP G P P PP P PPL PP PPP P Sbjct: 337 PPPPPPPRSNAAGSIPLPPQGRSAPPPPPPRSAPSTGRQPPPLSSSRAVSNPPAPPPAIP 396 Score = 31.1 bits (67), Expect = 0.25 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = +2 Query: 806 SXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 S PP P P PP P P P P P PS P PP P P Sbjct: 410 SRTSTPPVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLP-PSAP-IAPPLPAGMP 464 Score = 30.7 bits (66), Expect = 0.33 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 15/64 (23%) Frame = +1 Query: 829 PPXPPPP------PPXPXPXAXPPXGXXPXPXPPXXPPXPP---------LXXXXXPPPP 963 PP PPP PP P P P PP PP L PPP Sbjct: 254 PPIPPPSNGTVSSPPNSPPRPIAPVSMNPAINSTSKPPLPPPSSRVSAAALAANKKRPPP 313 Query: 964 PPXP 975 PP P Sbjct: 314 PPPP 317 Score = 30.7 bits (66), Expect = 0.33 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXP 944 P + P PP P PP P P PPP P P P P Sbjct: 437 PSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAPAPPP-APAPAPAAP 487 Score = 30.3 bits (65), Expect = 0.43 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = +1 Query: 844 PPPPXPXPXAXPP--XGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PP P P + PP P PP PP P PP PP P Sbjct: 230 PPIPPSIPSSRPPERVPSLSAPAPPPIPP-PSNGTVSSPPNSPPRP 274 Score = 30.3 bits (65), Expect = 0.43 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P P PP P P P P PP P PP P P P Sbjct: 436 PPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAP----APPPAPAPAP 484 Score = 29.9 bits (64), Expect = 0.57 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 3/51 (5%) Frame = +2 Query: 839 PPPPPXXXXXXRP--PPXXXXPXXXPPXXPXPXPSXPXXXPPX-PPXXPXS 982 P PPP P PP P P P PS P PP PP P S Sbjct: 389 PAPPPAIPGRSAPALPPLGNASRTSTPPVPTP-PSLPPSAPPSLPPSAPPS 438 Score = 29.9 bits (64), Expect = 0.57 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P P P PP P PP P P P PP P PP Sbjct: 416 PVPTPPSLPPSAPPSLP---PSAPPSLPMGAPAAPPLPPSAPIAPP 458 Score = 29.9 bits (64), Expect = 0.57 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = +1 Query: 802 SLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 SL PP PP P P A P P PP P PP P P P P Sbjct: 438 SLPMGAPAAPPLPPSAPIAPPLPAGMPAA---PPLPPAAPAPPP-----APAPAPAAP 487 Score = 29.5 bits (63), Expect = 0.76 Identities = 17/55 (30%), Positives = 18/55 (32%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P+ P PP PP P P PP P P P P P P P Sbjct: 437 PSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAPAP----PPAPAPAPAAP 487 Score = 29.1 bits (62), Expect = 1.0 Identities = 17/56 (30%), Positives = 18/56 (32%), Gaps = 7/56 (12%) Frame = +3 Query: 831 PXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXP-------XPXXPXXPPPXPPXPP 977 P PPPP + P PP PP P P P PP PP Sbjct: 311 PPPPPPPSRRNRGKPPIGNGSSNSSLPPPPPPPRSNAAGSIPLPPQGRSAPPPPPP 366 Score = 27.9 bits (59), Expect = 2.3 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 4/55 (7%) Frame = +1 Query: 817 PXXXPPXP-PPPPPXPXP---XAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P P P PPP P P P P P P P + PP PPP Sbjct: 242 PERVPSLSAPAPPPIPPPSNGTVSSPPNSPPRPIAP-VSMNPAINSTSKPPLPPP 295 Score = 27.9 bits (59), Expect = 2.3 Identities = 22/68 (32%), Positives = 23/68 (33%), Gaps = 18/68 (26%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPX--------PPXXPPX---------PPLXXXXXPP 957 PP PP P P + P G P P PP PP PPL Sbjct: 354 PPQGRSAPPPPPPRSAPSTGRQPPPLSSSRAVSNPPAPPPAIPGRSAPALPPLGNASRTS 413 Query: 958 PPP-PXPP 978 PP P PP Sbjct: 414 TPPVPTPP 421 Score = 27.1 bits (57), Expect = 4.0 Identities = 15/51 (29%), Positives = 16/51 (31%), Gaps = 2/51 (3%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXP--XXPXXPP 956 P PP PP + PP PP PP P P PP Sbjct: 355 PQGRSAPPPPPPRSAPSTGRQPPPLSSSRAVSNPPAPPPAIPGRSAPALPP 405 >SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Schizosaccharomyces pombe|chr 1|||Manual Length = 1995 Score = 41.5 bits (93), Expect = 2e-04 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PPPPPP P A PP PP PP P P P P Sbjct: 1882 PPPPPPMALPKAGPPSAAPTSALPPAGPPAGATAISGNPGMPAPVP 1927 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 39.1 bits (87), Expect = 0.001 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP P P P P P G P P P PP P P PPP P Sbjct: 1169 PPVPAPSSGIP-PVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAP 1217 Score = 37.5 bits (83), Expect = 0.003 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXP---XPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP PP P P P PP P P P P P+ PP P P Sbjct: 1189 PPVPPPSEAPPVPKPSVGVPPVPPPSTAPPVPTPSAGLPPVPVPTAKAPPVPAP 1242 Score = 36.3 bits (80), Expect = 0.007 Identities = 20/58 (34%), Positives = 21/58 (36%), Gaps = 5/58 (8%) Frame = +1 Query: 817 PXXXPPXPPP---PPPXPXPXAXPPXGXXPXPXPPXXPP--XPPLXXXXXPPPPPPXP 975 P PP P P PP P P PP PP P PP+ PP P P Sbjct: 1117 PSGAPPVPKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAP 1174 Score = 36.3 bits (80), Expect = 0.007 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 8/59 (13%) Frame = +1 Query: 817 PXXXPPXPPP---PPPXPXPXAXPP-----XGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP P P PP P P PP P P P P P PP PPP Sbjct: 1136 PSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPP 1194 Score = 35.9 bits (79), Expect = 0.009 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +1 Query: 832 PXPPPPPPXP---XPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 P PPP P P P P G P P P PP P P P P Sbjct: 1060 PSAPPPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVAAPPVPKP 1107 Score = 35.9 bits (79), Expect = 0.009 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 5/54 (9%) Frame = +1 Query: 829 PPXPPPP---PPXPXPXAXPPXGXXPXPXPPXXPP--XPPLXXXXXPPPPPPXP 975 PP P P PP P P PP PP PP PP+ PP P P Sbjct: 1179 PPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPPVPTPSAGLPPVPVP 1232 Score = 35.5 bits (78), Expect = 0.012 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 P P PP PP P P P PP P P+ PP P Sbjct: 1182 PKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPPVPTPSAGLPPVP 1230 Score = 34.7 bits (76), Expect = 0.020 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P P P P P P P P PP P P P P P Sbjct: 1088 PSGIPPVPKPSVAAP-PVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAP 1140 Score = 34.7 bits (76), Expect = 0.020 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXP---PXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P P PP P P A P P G P P P P P PP P P Sbjct: 1131 PPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKP 1184 Score = 34.3 bits (75), Expect = 0.027 Identities = 21/58 (36%), Positives = 22/58 (37%), Gaps = 5/58 (8%) Frame = +1 Query: 817 PXXXPPXPPPP--PPXPXP-XAXPPXGXXPXPXPPXXPP--XPPLXXXXXPPPPPPXP 975 P PP P P PP P P A PP PP P PP+ PP P P Sbjct: 1079 PSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVP 1136 Score = 34.3 bits (75), Expect = 0.027 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 8/58 (13%) Frame = +1 Query: 829 PPXPPPP---PPXPXPXAXPPX-----GXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP P P PP P P PP P P P PP P P P P P Sbjct: 1102 PPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAP 1159 Score = 33.9 bits (74), Expect = 0.035 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 7/58 (12%) Frame = +1 Query: 817 PXXXPPXPPPP---PPXPXPXAXPPX----GXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP P P P P P PP G P P P P P PP P P Sbjct: 1060 PSAPPPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAP 1117 Score = 33.5 bits (73), Expect = 0.046 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = +1 Query: 829 PPXPPPP--PPXPXPXAXPPXGXXPXPXPPXXPPXP-PLXXXXXPPPPPPXPP 978 PP P P PP P P + PP P PP P P P P PP Sbjct: 1032 PPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAPP 1084 Score = 33.5 bits (73), Expect = 0.046 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = +2 Query: 818 PPPXPXXPP-PPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 P P PP P P P P P PP P P PP PP Sbjct: 1162 PKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPP 1212 Score = 32.7 bits (71), Expect = 0.081 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 3/52 (5%) Frame = +1 Query: 829 PPXPPPP---PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PP P P PP P P PP P P PP P P PPP P Sbjct: 1022 PPVPLPSADAPPIPVPSTAPPV-----PIPTSTPPVPK-SSSGAPSAPPPVP 1067 Score = 32.7 bits (71), Expect = 0.081 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 2/56 (3%) Frame = +1 Query: 817 PXXXPPXPPPP--PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P P PP P + P P P P P P P P P P Sbjct: 1037 PSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAPPVPAPSGIP 1092 Score = 32.7 bits (71), Expect = 0.081 Identities = 15/48 (31%), Positives = 16/48 (33%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P PP P P PP PP P + P PP P Sbjct: 1077 PAPSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVP 1124 Score = 32.3 bits (70), Expect = 0.11 Identities = 17/53 (32%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXP---XPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 P P PP P P P P G P P P P P+ P P P Sbjct: 1093 PVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPPVPKP 1145 Score = 32.3 bits (70), Expect = 0.11 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXP---PXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 P P PP P P A P P G P P P P P P P P Sbjct: 1112 PPVPAPSGAPPVPKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKP 1164 Score = 32.3 bits (70), Expect = 0.11 Identities = 18/62 (29%), Positives = 20/62 (32%), Gaps = 2/62 (3%) Frame = +3 Query: 786 LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPP--XPPXPXPXXPXXPPP 959 +P +P PP PP P P PPP PP P P P P Sbjct: 1171 VPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPPVPTPSAGLPPVP 1230 Query: 960 XP 965 P Sbjct: 1231 VP 1232 Score = 31.9 bits (69), Expect = 0.14 Identities = 21/60 (35%), Positives = 22/60 (36%), Gaps = 4/60 (6%) Frame = +1 Query: 802 SLXQXPXXXPPXPPPPPPXPX---PXAXPPXGXXPXPXPP-XXPPXPPLXXXXXPPPPPP 969 S+ P P PP P P P PP P P P PP PP PP P P Sbjct: 1165 SVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPP--PSTAPPVPTP 1222 Score = 31.1 bits (67), Expect = 0.25 Identities = 18/61 (29%), Positives = 19/61 (31%), Gaps = 4/61 (6%) Frame = +3 Query: 807 LPTXXXXPPXXPP----PPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 +P PP P PP PP PP PP P P PP P Sbjct: 1152 VPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVP 1211 Query: 975 P 977 P Sbjct: 1212 P 1212 Score = 30.7 bits (66), Expect = 0.33 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 6/51 (11%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPP--XPPXPXP--XXPXXPPP--XPPXP 974 P P P P P PPP PP P P P PPP PP P Sbjct: 1170 PVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPPVP 1220 Score = 29.9 bits (64), Expect = 0.57 Identities = 25/90 (27%), Positives = 30/90 (33%), Gaps = 4/90 (4%) Frame = +3 Query: 717 PPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXX 896 PP +PS+ S +P + +P P PPP P P Sbjct: 1022 PPVPLPSADAPPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPA------PSSEIPS 1075 Query: 897 XPXPPPXPPXPXPXX-PXXPPP---XPPXP 974 P P PP P P P P P PP P Sbjct: 1076 IPAPSGAPPVPAPSGIPPVPKPSVAAPPVP 1105 Score = 29.9 bits (64), Expect = 0.57 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PPP P P G P P P P P P P Sbjct: 1209 PVPPPSTAPPVPTPSAGLPPVPVPTAKAPPVPAPSSEAPSVSTP 1252 Score = 29.5 bits (63), Expect = 0.76 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXP-PLXXXXXPPPPPPXPP 978 P PPP P P + P P P PP P P P P PP Sbjct: 1060 PSAPPPVPAPSSEIPS----IPAPSGAPPVPAPSGIPPVPKPSVAAPP 1103 Score = 29.1 bits (62), Expect = 1.0 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP P P P P P P P P S P P P Sbjct: 1211 PPPSTAPPVPTPSAGLPPVPVPTAKAPPVPAPSSEAPSVSTPRSSVPSP 1259 Score = 28.7 bits (61), Expect = 1.3 Identities = 16/53 (30%), Positives = 17/53 (32%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 + P PP P P A P P P P PL PP P P Sbjct: 985 EPPKDHPPSAPLSKPVSTSPAAPLARVPPVPKLSSKAPPVPLPSADAPPIPVP 1037 Score = 28.7 bits (61), Expect = 1.3 Identities = 18/61 (29%), Positives = 19/61 (31%), Gaps = 4/61 (6%) Frame = +3 Query: 807 LPTXXXXPPXXPPP---PPXXXXXRXPPXXXXXXPXPP-PXPPXPXPXXPXXPPPXPPXP 974 +P PP P PP PP PP P P P P PP P Sbjct: 1133 VPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVP 1192 Query: 975 P 977 P Sbjct: 1193 P 1193 Score = 28.3 bits (60), Expect = 1.7 Identities = 16/54 (29%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Frame = +2 Query: 818 PPPXPXXPPP-PPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 P P P PP P PP P P P P + P P P P Sbjct: 1042 PVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVP 1095 Score = 28.3 bits (60), Expect = 1.7 Identities = 16/55 (29%), Positives = 17/55 (30%), Gaps = 3/55 (5%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXP---XPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 + P P PP P P P P P P P P P P P P Sbjct: 1072 EIPSIPAPSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKP 1126 Score = 28.3 bits (60), Expect = 1.7 Identities = 14/49 (28%), Positives = 14/49 (28%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 P P P P P P P P P P P PP P Sbjct: 1086 PAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVP 1134 Score = 27.1 bits (57), Expect = 4.0 Identities = 16/55 (29%), Positives = 16/55 (29%), Gaps = 2/55 (3%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP--PPPXP 975 P P PP P P P P P P P P P PP P Sbjct: 1032 PPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAPPVP 1086 Score = 26.6 bits (56), Expect = 5.3 Identities = 20/66 (30%), Positives = 21/66 (31%), Gaps = 4/66 (6%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPP---PPXXXXXRXPPXXXXXXPXPP-PXPPXPXPXXPXXPP 956 P A +P P P P PP PP PP P P P P P Sbjct: 1060 PSAPPPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVP-APS 1118 Query: 957 PXPPXP 974 PP P Sbjct: 1119 GAPPVP 1124 Score = 26.6 bits (56), Expect = 5.3 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP 958 PP P PP PP PP P P P PP Sbjct: 1150 PPVPAPSGAPPVPKPSVAAPPVPAPSSGIPP-VPKPAAGVPPVPPP 1194 Score = 26.2 bits (55), Expect = 7.1 Identities = 18/63 (28%), Positives = 21/63 (33%), Gaps = 1/63 (1%) Frame = +3 Query: 789 PXAXLTLP-TXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXP 965 P A L+ P + P PP + PP PP P P P P P Sbjct: 992 PSAPLSKPVSTSPAAPLARVPPVPKLSSKAPPVPLPSADAPPIPVPSTAPPVPI-PTSTP 1050 Query: 966 PXP 974 P P Sbjct: 1051 PVP 1053 Score = 26.2 bits (55), Expect = 7.1 Identities = 15/49 (30%), Positives = 15/49 (30%), Gaps = 3/49 (6%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPP---XPPXPXPXXPXXPPPXP 965 P PP P P P P P PP P P P P P Sbjct: 1194 PSEAPPVPKPSVGVPPVPPPSTAPPVPTPSAGLPPVPVPTAKAPPVPAP 1242 Score = 25.8 bits (54), Expect = 9.3 Identities = 14/52 (26%), Positives = 14/52 (26%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PP P PP PP P P PS P P P Sbjct: 1032 PPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAP 1083 Score = 25.8 bits (54), Expect = 9.3 Identities = 18/66 (27%), Positives = 19/66 (28%), Gaps = 4/66 (6%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPP----PPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPP 956 P +P PP P PP PP P P P P P P Sbjct: 1079 PSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVP-VPS 1137 Query: 957 PXPPXP 974 PP P Sbjct: 1138 GAPPVP 1143 >SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex protein Gar1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 194 Score = 39.1 bits (87), Expect = 0.001 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G G GG G RGG G GG G GG G G G GG GG G Sbjct: 133 GPAGRGGRGGFRGGRGGSRGGFGGNSRGGF-GGGSRGGFGGGSRGGSRGGFRGG 185 Score = 37.5 bits (83), Expect = 0.003 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 GG GG GG RGG GG G G G GG G G GG G Sbjct: 145 GGRGGSRGGFGGNSRGGFGGGSRG-GFGGGSRGGSRGGFRGGSRGGFRG 192 >SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, with EF hand and WH2 motif |Schizosaccharomyces pombe|chr 1|||Manual Length = 1794 Score = 37.9 bits (84), Expect = 0.002 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P P PP P PP P P P P PPL P P P Sbjct: 1700 PQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVPNP 1746 Score = 37.5 bits (83), Expect = 0.003 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PP A PP P P PP PP P PP PP Sbjct: 1683 PAHPVSTPPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPP 1732 Score = 35.9 bits (79), Expect = 0.009 Identities = 19/54 (35%), Positives = 21/54 (38%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 H + PP P PP PPP P PP P P P+ P PP P Sbjct: 1685 HPVSTPPVRPQSAAPPQMSAPTPPPPPMSVPP---PPSAP-PMPAGPPSAPPPP 1734 Score = 32.7 bits (71), Expect = 0.081 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 3/56 (5%) Frame = +1 Query: 817 PXXXPPXPPP---PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PP P PP P PP P PP P PP+ PPPP P Sbjct: 1686 PVSTPPVRPQSAAPPQMSAPTPPPP----PMSVPP-PPSAPPMPAGPPSAPPPPLP 1736 Score = 32.7 bits (71), Expect = 0.081 Identities = 15/48 (31%), Positives = 16/48 (33%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PP P PPP PP P P P P P+ P P Sbjct: 1699 PPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVPNP 1746 Score = 30.3 bits (65), Expect = 0.43 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 1/48 (2%) Frame = +3 Query: 828 PPXXPPPP-PXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 PP P P PP P PP PP P P PPP P Sbjct: 1690 PPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPA-GPPSAPPPPLP 1736 Score = 30.3 bits (65), Expect = 0.43 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPP 933 P P PPPP P A PP P P P P P Sbjct: 1707 PPPPPMSVPPPPSAPPMPAGPP-SAPPPPLPASSAPSVP 1744 Score = 28.7 bits (61), Expect = 1.3 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P PPP PP PP PP P P P P P Sbjct: 1705 PTPPPPPMSVPPPPSAPPMPAGPPSAPP---PPLPASSAPSVPNP 1746 Score = 28.3 bits (60), Expect = 1.7 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +3 Query: 813 TXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXP 965 T P PP PP P PP P P P P PPP P Sbjct: 1689 TPPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGP-PSAP--PPPLP 1736 Score = 28.3 bits (60), Expect = 1.7 Identities = 15/48 (31%), Positives = 17/48 (35%) Frame = +3 Query: 801 LTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXP 944 ++ PT P PPPP PP PPP P P P Sbjct: 1702 MSAPTPPPPPMSVPPPPSAPPMPAGPP-----SAPPPPLPASSAPSVP 1744 Score = 28.3 bits (60), Expect = 1.7 Identities = 14/39 (35%), Positives = 14/39 (35%), Gaps = 2/39 (5%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPP--PXXXXPXXXPPXXPXP 928 PPP PPPP PP P P P P P Sbjct: 1708 PPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVPNP 1746 Score = 27.5 bits (58), Expect = 3.1 Identities = 14/48 (29%), Positives = 14/48 (29%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P P P PP P P P P P PP P Sbjct: 1490 PNVPVPSMIPSVAQQPPSSVAPATAPSSTLPPSQSSFAHVPSPAPPAP 1537 >SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||Manual Length = 309 Score = 37.5 bits (83), Expect = 0.003 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP P PP P P P PP P P P PPP Sbjct: 154 PASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMPPKVPPP 204 Score = 36.7 bits (81), Expect = 0.005 Identities = 19/57 (33%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXP---PLXXXXXPPPPPPXPP 978 P P P P P + PP P P P PP P P PPP P P Sbjct: 124 PPSAPAPPTPQSELRPPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAP 180 Score = 36.3 bits (80), Expect = 0.007 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P PP P A P P P P P P P PP PP Sbjct: 147 PSIPPPSPASAPPIPSK-APPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMPP 199 Score = 35.1 bits (77), Expect = 0.015 Identities = 23/71 (32%), Positives = 24/71 (33%), Gaps = 8/71 (11%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP--- 959 P + L PT P PPP P PP P P PP P P PP Sbjct: 133 PQSELRPPTSAPPRPSIPPPSPASA----PPIPSKAPPIPSSLPPPAQPAAPVKSPPSAP 188 Query: 960 -----XPPXPP 977 PP PP Sbjct: 189 SLPSAVPPMPP 199 Score = 34.7 bits (76), Expect = 0.020 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXP-PXXPPXPPLXXXXXPPPPPPXP 975 P PP P PPP P + PP P P PP P PP P P Sbjct: 140 PTSAPPRPSIPPPSPA--SAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLP 191 Score = 32.7 bits (71), Expect = 0.081 Identities = 18/57 (31%), Positives = 19/57 (33%) Frame = +2 Query: 806 SXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 S + PP PP P RPP PP P P P PP P P Sbjct: 119 SASAAPPSAPAPPTP---QSELRPPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLP 172 Score = 31.9 bits (69), Expect = 0.14 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 4/59 (6%) Frame = +2 Query: 818 PPPXPXXPPP----PPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXPXS 982 PPP P PP P PP P PP P PS PP P P S Sbjct: 150 PPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSAPS-LPSAVPPMPPKVPPPPLS 207 Score = 31.5 bits (68), Expect = 0.19 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPP 882 P PPPPPP P P A P Sbjct: 3 PAPPPPPPAPAPAAAAP 19 Score = 31.1 bits (67), Expect = 0.25 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPL 936 P PP P P P + P P PP PP PPL Sbjct: 168 PSSLPPPAQPAAPVKSPPSAPSLPSAVPPMPPKVPP-PPL 206 Score = 30.7 bits (66), Expect = 0.33 Identities = 17/62 (27%), Positives = 19/62 (30%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P + P+ PP PP P PP P P P PP PP Sbjct: 145 PRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLP-SAVPPMPPKVPP 203 Query: 969 XP 974 P Sbjct: 204 PP 205 Score = 28.3 bits (60), Expect = 1.7 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 900 PXPPPXPPXPXPXXPXXPPP 959 P PPP PP P P PP Sbjct: 3 PAPPPPPPAPAPAAAAPAPP 22 Score = 27.9 bits (59), Expect = 2.3 Identities = 13/45 (28%), Positives = 13/45 (28%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXP 944 P PP P P P P PP PP P P Sbjct: 166 PIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMPPKVPPPPLSQAP 210 Score = 25.8 bits (54), Expect = 9.3 Identities = 21/70 (30%), Positives = 21/70 (30%), Gaps = 14/70 (20%) Frame = +1 Query: 802 SLXQXPXXXPPXPPPPPPXPXPXA------------XPPXGXXP--XPXPPXXPPXPPLX 939 S P PP PP PP P A PP G P P P P Sbjct: 186 SAPSLPSAVPPMPPKVPPPPLSQAPVANTSSRPSSFAPPAGHAPNVTSESPKFPNRGPSI 245 Query: 940 XXXXPPPPPP 969 PP PP Sbjct: 246 PSASVPPVPP 255 >SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 1420 Score = 34.3 bits (75), Expect = 0.027 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 6/56 (10%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPP------XGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PPPPPP A P P P P PPPP PP Sbjct: 189 PPPPPPPPPAVEDQAADANEPDDYYSSGRAVSPEIPPTYTPKQADPLPAPPPPPPP 244 Score = 31.9 bits (69), Expect = 0.14 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 844 PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PP P P P L PPPPPP PP Sbjct: 156 PTVSAPNSMVSPPPSFQP---PSAAAPATSLPSDYNPPPPPPPPP 197 Score = 29.5 bits (63), Expect = 0.76 Identities = 16/51 (31%), Positives = 17/51 (33%), Gaps = 2/51 (3%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXP--PPPPPXPP 978 P PPPPPP P P P + P P PP PP Sbjct: 236 PAPPPPPPPTLPPQSTNTSQLPMPSRNVNNLGSQVNIPPPPATPSQPPRPP 286 Score = 28.3 bits (60), Expect = 1.7 Identities = 18/66 (27%), Positives = 20/66 (30%), Gaps = 8/66 (12%) Frame = +3 Query: 804 TLPTXXXXPPXXPPPPPXXXXXR--------XPPXXXXXXPXPPPXPPXPXPXXPXXPPP 959 +LP+ PP PPPP PP P P PPP Sbjct: 182 SLPSDYNPPPPPPPPPAVEDQAADANEPDDYYSSGRAVSPEIPPTYTPKQADPLPAPPPP 241 Query: 960 XPPXPP 977 PP P Sbjct: 242 PPPTLP 247 Score = 26.2 bits (55), Expect = 7.1 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPP 924 P PP P P P P PP PP Sbjct: 221 PEIPPTYTPKQADPLPAPPPPPPPTLPP 248 >SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1|||Manual Length = 1841 Score = 33.5 bits (73), Expect = 0.046 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PPPPPP P + PPPPPP PP Sbjct: 905 PTPPPPPPLPVKTSLNTFSHPDSVNIVANDTSVAGVMPAFPPPPPPPPP 953 Score = 26.2 bits (55), Expect = 7.1 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 829 PPXPPPPPP 855 PP PPPPPP Sbjct: 945 PPPPPPPPP 953 >SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 2363 Score = 33.1 bits (72), Expect = 0.061 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXP 909 PP PPPPP P P PP P P P Sbjct: 5 PPGNPPPPP-PPPGFEPPSQPPPPPPP 30 Score = 33.1 bits (72), Expect = 0.061 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 906 PPPXPPXPXPXXPXXPPPXPP 968 PPP PP P P PPP PP Sbjct: 9 PPPPPPPPGFEPPSQPPPPPP 29 Score = 32.3 bits (70), Expect = 0.11 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 895 PXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP PP P PPPPPP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPP 29 Score = 32.3 bits (70), Expect = 0.11 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 906 PPPXPPXPXPXXPXXPPPXPPXPP 977 PP PP P P PP PP PP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPP 28 Score = 32.3 bits (70), Expect = 0.11 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 907 PPXXPPXPPLXXXXXPPPPPPXPP 978 PP PP PP PP PP PP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPP 28 Score = 31.9 bits (69), Expect = 0.14 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 900 PXPPPXPPXPXPXXPXXPPPXPPXP 974 P PP PP P P PP PP P Sbjct: 6 PGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 31.5 bits (68), Expect = 0.19 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 901 PXPPXXPPXPPLXXXXXPPPPPPXPPF 981 P P PP PP PPPPP P + Sbjct: 6 PGNPPPPPPPPGFEPPSQPPPPPPPGY 32 Score = 31.1 bits (67), Expect = 0.25 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPP 883 PP P PPPPP +PPP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPP 26 Score = 29.9 bits (64), Expect = 0.57 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +1 Query: 877 PPXGXXPXPXPPXX-PPXPPLXXXXXPPPPPP 969 PP P P PP PP P PPPPPP Sbjct: 5 PPGNPPPPPPPPGFEPPSQP------PPPPPP 30 Score = 29.5 bits (63), Expect = 0.76 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPP 912 P PPP P P P P P PP Sbjct: 6 PGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 28.3 bits (60), Expect = 1.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +3 Query: 900 PXPPPXPPXPXPXXPXXPPPXPPXPP 977 P P PP P P P PP PP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 27.9 bits (59), Expect = 2.3 Identities = 12/25 (48%), Positives = 12/25 (48%), Gaps = 3/25 (12%) Frame = +1 Query: 817 PXXXPPXPPPP---PPXPXPXAXPP 882 P PP PPPP PP P PP Sbjct: 6 PGNPPPPPPPPGFEPPSQPPPPPPP 30 >SPAC140.02 |gar2||GAR family|Schizosaccharomyces pombe|chr 1|||Manual Length = 500 Score = 31.1 bits (67), Expect = 0.25 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -3 Query: 935 RGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 RGG GG G G G GG G G G GG G G Sbjct: 450 RGGRGGFGGRGGFGG--RGGFGGGRGRGRGGARSGNPNRG 487 >SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 857 Score = 30.7 bits (66), Expect = 0.33 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P P P A P P P P P P PP PP Sbjct: 656 PVVPEAPSVPQPPAAPVVPEVPSVPQPPAVPVVPEAGQLNEPVVPPLPP 704 Score = 28.3 bits (60), Expect = 1.7 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 1/49 (2%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXP-XPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P P P P A P P P P P P PP P P Sbjct: 626 PVVPEAPSVPQPPAAPVVPEVPSVPQRPAVPVVPEAPSVPQPPAAPVVP 674 Score = 28.3 bits (60), Expect = 1.7 Identities = 16/49 (32%), Positives = 17/49 (34%), Gaps = 1/49 (2%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPX-PXPPXXPPXPPLXXXXXPPPPPPXP 975 P P P P A P P P PP P P + PP P P Sbjct: 641 PVVPEVPSVPQRPAVPVVPEAPSVPQPPAAPVVPEVPSVPQPPAVPVVP 689 Score = 27.5 bits (58), Expect = 3.1 Identities = 14/49 (28%), Positives = 15/49 (30%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P P + P P P PP P P PP Sbjct: 635 PQPPAAPVVPEVPSVPQRPAVPVVPEAPSVPQPPAAPVVPEVPSVPQPP 683 Score = 26.6 bits (56), Expect = 5.3 Identities = 15/49 (30%), Positives = 15/49 (30%), Gaps = 1/49 (2%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXP-XPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P P P P P P P P P P PP P P Sbjct: 596 PVVPEAPSVPQPPVAPVAPEVPSVPQRPAVPVVPEAPSVPQPPAAPVVP 644 >SPBC119.05c |||Wiskott-Aldrich syndrome homolog binding protein Lsb1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 296 Score = 30.3 bits (65), Expect = 0.43 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 4/47 (8%) Frame = +1 Query: 838 PPPPPPXPXPXAX----PPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 PPPPP P A PP PP P PP+ P P Sbjct: 207 PPPPPQQNYPPAASSSAPPMQYQQTAYPPQQAPYPPVQAYPQAPQQP 253 >SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 587 Score = 29.9 bits (64), Expect = 0.57 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +1 Query: 847 PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 PP P A PP P P P P P + PP P Sbjct: 522 PPMVPPGMALPPGMPAPFPGYPAVPAMPGIPGATAPPGAP 561 Score = 28.7 bits (61), Expect = 1.3 Identities = 27/129 (20%), Positives = 38/129 (29%), Gaps = 6/129 (4%) Frame = +2 Query: 608 WSSPPRATCGTLTSAWRQPTXPMRSRKL*KRPRTLSTSRDDAEFLPXXXXXXXXLXEXL- 784 W+ P + + + W+QP P + L P +L + + Sbjct: 426 WAKPASSAAPSNPAPWQQPAAPQSAPALSMNPSSLPPWQQPTQQSAVQPSNLVPSQNAPF 485 Query: 785 ---TTXXXTHSXNXPP--PXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXX 949 T+ + PP P P P P PP PP P P P P Sbjct: 486 IPGTSAPLPPTTFAPPGVPLPPIPGAPGMPNLNMSQPPMVPPGMALPPGMPAPFPGYPAV 545 Query: 950 XPPXPPXXP 976 P P P Sbjct: 546 --PAMPGIP 552 >SPCC306.09c |cap1|cap|adenylyl cyclase-associated protein Cap1|Schizosaccharomyces pombe|chr 3|||Manual Length = 551 Score = 26.2 bits (55), Expect(2) = 0.68 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 829 PPXPPPPPP 855 PP PPPPPP Sbjct: 306 PPPPPPPPP 314 Score = 26.2 bits (55), Expect = 7.1 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 952 PPPPPPXPP 978 PPPPPP PP Sbjct: 306 PPPPPPPPP 314 Score = 21.8 bits (44), Expect(2) = 0.68 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 952 PPPPPPXPPF 981 PPPPPP F Sbjct: 309 PPPPPPSNDF 318 >SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1224 Score = 29.1 bits (62), Expect = 1.0 Identities = 16/56 (28%), Positives = 16/56 (28%) Frame = +3 Query: 786 LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXP 953 LP T P PPPP PP P P P P P P Sbjct: 907 LPPPPPTASMTASAPAIASPPPPKVGETYHPPTASGTRVPPVQQPSHPNPYTPVAP 962 >SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 331 Score = 28.3 bits (60), Expect = 1.7 Identities = 16/56 (28%), Positives = 16/56 (28%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PT P P R PP P P P P P P P PP Sbjct: 85 PTSEASKPLLNELVPEEPLPREPPLPNEPVPEEPLPGEPPLPDEPVPEEPLPGEPP 140 Score = 26.6 bits (56), Expect = 5.3 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P P P P P P P P PP P P Sbjct: 99 PEEPLPREPPLPNEPVPEEPLPGEPPLPDEPVPEEPLPGEPPLPNEP 145 Score = 26.2 bits (55), Expect = 7.1 Identities = 12/40 (30%), Positives = 13/40 (32%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXP 930 + P P P P P P P P P P P P Sbjct: 106 EPPLPNEPVPEEPLPGEPPLPDEPVPEEPLPGEPPLPNEP 145 >SPBC215.13 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 534 Score = 27.9 bits (59), Expect = 2.3 Identities = 20/58 (34%), Positives = 30/58 (51%) Frame = -3 Query: 713 TAYVVASTAFAISLVXWAVSKPTSTSRTLLSVVNSISSRLTFVEVVSXGSATGLWLSS 540 TA +S++ IS + S PTSTS T+ S +S SS + +S S++ SS Sbjct: 262 TASSSSSSSSIISSSSSSSSSPTSTSSTISSSSSSSSSPTSTSSTISSSSSSSSSFSS 319 >SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccharomyces pombe|chr 2|||Manual Length = 884 Score = 27.9 bits (59), Expect = 2.3 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXP 930 P PP P P P PP P PP P Sbjct: 729 PAPPTPAPTPAVKHHPPPPPVRSSISPSMPPAP 761 >SPAC3H1.06c |||membrane transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 589 Score = 27.9 bits (59), Expect = 2.3 Identities = 18/76 (23%), Positives = 35/76 (46%), Gaps = 10/76 (13%) Frame = -3 Query: 722 WRWTAYVVASTA-FAISLVXW---AVSKPTSTSRTLL------SVVNSISSRLTFVEVVS 573 WRW ++ T +++L+ + V KPT + R L ++ + + F+ ++ Sbjct: 243 WRWIFFINLPTGGLSLALLIFFLNLVPKPTVSFRVFLRDFDFVGIITITTGVVLFLVGLN 302 Query: 572 XGSATGLWLSSXCFCF 525 GS TG W + C+ Sbjct: 303 IGSTTGHWAHANVLCY 318 >SPAC19G12.15c |tpp1||trehalose-6-phosphate phosphatase Tpp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 817 Score = 27.5 bits (58), Expect = 3.1 Identities = 15/52 (28%), Positives = 24/52 (46%) Frame = -3 Query: 737 TRHRLWRWTAYVVASTAFAISLVXWAVSKPTSTSRTLLSVVNSISSRLTFVE 582 T H + WT+ ++ S A ++ PT T LSV + S RL ++ Sbjct: 519 TTHTMQSWTSSLIRSLANKLAATKTDQRIPTLTPEHALSVYSKASKRLFMMD 570 >SPAC32A11.02c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 851 Score = 27.5 bits (58), Expect = 3.1 Identities = 16/65 (24%), Positives = 31/65 (47%) Frame = +1 Query: 202 ESMLDTHSLWSNLANEMQHLDNMMKELSLKFPSIINEGRVEGDKYQISIHLPGYEQKDIX 381 E + + +W+++ +MQ D ++L F I N G++ Q +I L G + ++ Sbjct: 104 EGSTNVNEVWNDITEDMQSQDFSTEDLKQLFLLIFNNGKLR-TLLQNAIVLLGQQTTNVA 162 Query: 382 VKAKN 396 K N Sbjct: 163 SKKLN 167 >SPBC146.13c |myo1||myosin type I|Schizosaccharomyces pombe|chr 2|||Manual Length = 1217 Score = 23.4 bits (48), Expect(2) = 3.8 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 952 PPPPPPXP 975 PPPPPP P Sbjct: 1095 PPPPPPPP 1102 Score = 21.8 bits (44), Expect(2) = 3.8 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +1 Query: 829 PPXPPPPPPXP 861 P PPPPP P Sbjct: 1091 PSAVPPPPPPP 1101 >SPBC557.04 |ppk29||Ark1/Prk1 family protein kinase Ppk29|Schizosaccharomyces pombe|chr 2|||Manual Length = 872 Score = 27.1 bits (57), Expect = 4.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXP 930 PPPPPP P P P P P P P Sbjct: 356 PPPPPPMPAPIYNVPN----VPTVPTVSPNP 382 >SPCC584.04 |sup35|erf3|translation release factor eRF3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 662 Score = 27.1 bits (57), Expect = 4.0 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +2 Query: 128 PRHSTTMARHIGRITITT-PSVLTFGKACWTHI 223 P H+TT R I +I I PS+LT G +C HI Sbjct: 553 PVHATT--RFIAQIAILELPSILTTGYSCVMHI 583 >SPAC6G9.10c |sen1||ATP-dependent 5' to 3' DNA/RNA helicase Sen1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1687 Score = 26.6 bits (56), Expect = 5.3 Identities = 18/52 (34%), Positives = 28/52 (53%) Frame = +1 Query: 166 YHHYDPFSPYVRESMLDTHSLWSNLANEMQHLDNMMKELSLKFPSIINEGRV 321 + Y F +E +T S + NL E+++L NM+ EL KFP + GR+ Sbjct: 1484 FTQYRLFDVRGKERTSNTMSTY-NL-EEVEYLVNMVDELLNKFPDVNFTGRI 1533 >SPAC26A3.16 |dph1|ucp5|UBA domain protein Dph1|Schizosaccharomyces pombe|chr 1|||Manual Length = 354 Score = 25.8 bits (54), Expect = 9.3 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGG 908 GG GG G G G G G GG GG Sbjct: 226 GGLGGAGLGGLG--GAGLGGFGG 246 >SPBC317.01 |mbx2|pvg4|MADS-box transcription factor Pvg4|Schizosaccharomyces pombe|chr 2|||Manual Length = 372 Score = 25.8 bits (54), Expect = 9.3 Identities = 11/32 (34%), Positives = 11/32 (34%) Frame = +1 Query: 865 PXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP 960 P P P PP PP P PPP Sbjct: 161 PPFPPTQHHHPHTRPPHHPPHPHFHNNNYPPP 192 >SPCC1795.11 |sum3|ded1, slh3, moc2|ATP-dependent RNA helicase Sum3|Schizosaccharomyces pombe|chr 3|||Manual Length = 636 Score = 25.8 bits (54), Expect = 9.3 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG G G RGG GG G P + G G G GG Sbjct: 570 GGNGRGGRYSGRGGRGGNAYGARDFRRPTNS-SSGYSSGPSYSGYGG 615 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,788,186 Number of Sequences: 5004 Number of extensions: 87084 Number of successful extensions: 1448 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 279 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 701 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 505288058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -