BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_G10 (982 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 75 1e-13 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 60 3e-09 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 60 4e-09 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 59 6e-09 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 55 8e-08 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-08 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 55 1e-07 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 54 1e-07 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 54 1e-07 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 53 4e-07 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 52 5e-07 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 52 7e-07 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 49 5e-06 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 7e-06 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 7e-06 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 48 9e-06 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 48 9e-06 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 48 1e-05 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 3e-05 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 47 3e-05 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 47 3e-05 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 47 3e-05 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 47 3e-05 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 46 4e-05 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 46 5e-05 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 45 8e-05 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 44 1e-04 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 44 1e-04 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 44 1e-04 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 44 2e-04 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 43 3e-04 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 43 3e-04 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 43 4e-04 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 42 8e-04 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 42 0.001 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) 40 0.002 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 40 0.003 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) 40 0.004 SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) 40 0.004 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 39 0.005 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) 39 0.005 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 39 0.007 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 39 0.007 SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) 39 0.007 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 39 0.007 SB_49744| Best HMM Match : Tubulin_C (HMM E-Value=6.7) 39 0.007 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) 38 0.009 SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) 38 0.009 SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) 38 0.009 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 38 0.012 SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) 38 0.012 SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) 38 0.012 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.016 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 38 0.016 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 38 0.016 SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.016 SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) 38 0.016 SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.022 SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.022 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 37 0.022 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 37 0.022 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 37 0.022 SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) 37 0.022 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 37 0.029 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.029 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_29930| Best HMM Match : Collagen (HMM E-Value=0.067) 36 0.038 SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) 36 0.038 SB_22536| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) 36 0.038 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 36 0.038 SB_1966| Best HMM Match : GRP (HMM E-Value=0.53) 36 0.038 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 36 0.050 SB_6248| Best HMM Match : KH_1 (HMM E-Value=1.6e-41) 36 0.050 SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) 36 0.050 SB_37025| Best HMM Match : Homeobox (HMM E-Value=1.3e-16) 36 0.050 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.066 SB_3426| Best HMM Match : Homeobox (HMM E-Value=3.4e-22) 36 0.066 SB_52656| Best HMM Match : ABC_tran (HMM E-Value=0) 35 0.088 SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.088 SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) 35 0.088 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 35 0.088 SB_51094| Best HMM Match : VWA (HMM E-Value=0) 35 0.088 SB_7859| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.088 SB_3427| Best HMM Match : Homeobox (HMM E-Value=4e-24) 35 0.088 SB_52294| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) 32 0.13 SB_53480| Best HMM Match : Sigma70_r1_1 (HMM E-Value=5.7) 34 0.15 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 34 0.15 SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) 34 0.15 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 34 0.15 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 34 0.15 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 34 0.15 SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) 34 0.15 SB_56161| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_37033| Best HMM Match : Annexin (HMM E-Value=0) 34 0.20 SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 34 0.20 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 34 0.20 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 34 0.20 SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_18739| Best HMM Match : YhhN (HMM E-Value=7.3) 26 0.23 SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) 33 0.27 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 33 0.27 SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_48388| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 33 0.35 SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26) 33 0.35 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_32409| Best HMM Match : Oxidored_q2 (HMM E-Value=0.081) 33 0.35 SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) 33 0.35 SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) 33 0.47 SB_37850| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74) 33 0.47 SB_12635| Best HMM Match : Chlam_PMP (HMM E-Value=0.018) 33 0.47 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_40954| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.62 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 32 0.62 SB_14693| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.62 SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) 31 0.65 SB_58920| Best HMM Match : GRP (HMM E-Value=0.35) 32 0.82 SB_42356| Best HMM Match : PDZ (HMM E-Value=5.7e-19) 32 0.82 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.82 SB_36422| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.82 SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) 32 0.82 SB_32850| Best HMM Match : GRP (HMM E-Value=0.089) 32 0.82 SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.82 SB_29063| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.82 SB_29025| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.82 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.82 SB_19709| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.82 SB_14242| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_51494| Best HMM Match : Drf_FH1 (HMM E-Value=2.4) 31 1.1 SB_50230| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_18836| Best HMM Match : C1_1 (HMM E-Value=7.3e-17) 31 1.1 SB_14695| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) 31 1.1 SB_1375| Best HMM Match : Extensin_2 (HMM E-Value=0.18) 31 1.1 SB_52268| Best HMM Match : SecA_PP_bind (HMM E-Value=0.33) 26 1.3 SB_59007| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_51557| Best HMM Match : Collagen (HMM E-Value=0.56) 31 1.4 SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_42661| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_27771| Best HMM Match : SH2 (HMM E-Value=8.6e-16) 31 1.4 SB_26560| Best HMM Match : 7tm_1 (HMM E-Value=6.3e-09) 31 1.4 SB_3226| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=0.021) 31 1.4 SB_43620| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_36275| Best HMM Match : Extensin_2 (HMM E-Value=0.062) 31 1.4 SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) 31 1.4 SB_23696| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_17676| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) 31 1.4 SB_10368| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_2691| Best HMM Match : Luteo_Vpg (HMM E-Value=2.1) 31 1.4 SB_51034| Best HMM Match : Extensin_2 (HMM E-Value=0.038) 31 1.9 SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) 31 1.9 SB_8802| Best HMM Match : WW (HMM E-Value=3.2e-31) 31 1.9 SB_5854| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.3e-17) 31 1.9 SB_5034| Best HMM Match : Extensin_2 (HMM E-Value=0.0055) 31 1.9 SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_15415| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 2.2 SB_56109| Best HMM Match : Collagen (HMM E-Value=0.79) 30 2.5 SB_52043| Best HMM Match : Collagen (HMM E-Value=0.77) 30 2.5 SB_49284| Best HMM Match : zf-C2H2 (HMM E-Value=0) 30 2.5 SB_48544| Best HMM Match : TSP_1 (HMM E-Value=3.1e-32) 30 2.5 SB_47181| Best HMM Match : Pkinase (HMM E-Value=7.7e-31) 30 2.5 SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) 30 2.5 SB_37296| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_33219| Best HMM Match : RhoGAP (HMM E-Value=0.0014) 30 2.5 SB_33199| Best HMM Match : Collagen (HMM E-Value=0.77) 30 2.5 SB_31707| Best HMM Match : Extensin_2 (HMM E-Value=0.19) 30 2.5 SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_58404| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_42044| Best HMM Match : ubiquitin (HMM E-Value=1.2e-06) 30 2.5 SB_29605| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_20903| Best HMM Match : Extensin_2 (HMM E-Value=0.3) 30 2.5 SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) 30 2.5 SB_7159| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_6095| Best HMM Match : 7tm_1 (HMM E-Value=0.013) 30 2.5 SB_48061| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_38159| Best HMM Match : Peptidase_M28 (HMM E-Value=4.7e-09) 30 3.3 SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_9614| Best HMM Match : GBP (HMM E-Value=1e-31) 30 3.3 SB_1944| Best HMM Match : DUF1482 (HMM E-Value=7.3) 30 3.3 SB_47680| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_4771| Best HMM Match : DEAD (HMM E-Value=0.015) 30 3.3 SB_54430| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 4.0 SB_35620| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 4.2 SB_56224| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_52684| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_51714| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_51555| Best HMM Match : ATP-cone (HMM E-Value=3.3) 29 4.4 SB_44452| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_33008| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) 29 4.4 SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) 29 4.4 SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) 29 4.4 SB_45593| Best HMM Match : ArfGap (HMM E-Value=3.3e-37) 29 4.4 SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_12281| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_5429| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_50380| Best HMM Match : PMC2NT (HMM E-Value=2.4) 29 5.8 SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_42662| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_39039| Best HMM Match : Drf_FH1 (HMM E-Value=6.4) 29 5.8 SB_38223| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 29 5.8 SB_27853| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_27662| Best HMM Match : Pentapeptide_2 (HMM E-Value=6.4) 29 5.8 SB_27284| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_20177| Best HMM Match : hATC (HMM E-Value=1e-04) 29 5.8 SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_16908| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_15833| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_9718| Best HMM Match : Metallothio_2 (HMM E-Value=1.3) 29 5.8 SB_7559| Best HMM Match : Metallothio_2 (HMM E-Value=2) 29 5.8 SB_59765| Best HMM Match : Metallothio_2 (HMM E-Value=4.3) 29 5.8 SB_55443| Best HMM Match : Homeobox (HMM E-Value=2.3e-26) 29 5.8 SB_49222| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_44477| Best HMM Match : IBR (HMM E-Value=0.00086) 29 5.8 SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) 29 5.8 SB_18074| Best HMM Match : Trypan_PARP (HMM E-Value=0.081) 29 5.8 SB_51035| Best HMM Match : Extensin_2 (HMM E-Value=0.33) 27 6.9 SB_55248| Best HMM Match : Adeno_E1A (HMM E-Value=7.5) 29 7.6 SB_53385| Best HMM Match : DUF1388 (HMM E-Value=0.66) 29 7.6 SB_53344| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.6 SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.6 SB_43492| Best HMM Match : Extensin_2 (HMM E-Value=0.34) 29 7.6 SB_39126| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.6 SB_35820| Best HMM Match : TRAP_240kDa (HMM E-Value=0.006) 29 7.6 SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) 29 7.6 SB_34754| Best HMM Match : TSP_1 (HMM E-Value=7.4e-12) 29 7.6 SB_27085| Best HMM Match : Filamin (HMM E-Value=1.5) 29 7.6 SB_26376| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.6 SB_23868| Best HMM Match : Gal_Lectin (HMM E-Value=1.4e-05) 29 7.6 SB_22690| Best HMM Match : Collagen (HMM E-Value=0.042) 29 7.6 SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.6 SB_49453| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.6 SB_47682| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.6 SB_45079| Best HMM Match : RRM_1 (HMM E-Value=0.0027) 29 7.6 SB_33549| Best HMM Match : Collagen (HMM E-Value=2e-05) 29 7.6 SB_24257| Best HMM Match : DUF583 (HMM E-Value=0.16) 29 7.6 SB_19081| Best HMM Match : Metallothio_2 (HMM E-Value=4.4) 29 7.6 SB_13398| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.6 SB_9843| Best HMM Match : LIM (HMM E-Value=8.4e-07) 29 7.6 SB_31904| Best HMM Match : Extensin_2 (HMM E-Value=0.5) 25 8.8 SB_58915| Best HMM Match : No HMM Matches (HMM E-Value=.) 23 8.8 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 74.5 bits (175), Expect = 1e-13 Identities = 29/54 (53%), Positives = 29/54 (53%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PPPPPP P P PP P P PP PP PP PPPPPP PP Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 72.1 bits (169), Expect = 6e-13 Identities = 28/54 (51%), Positives = 28/54 (51%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PPPPP P P PP P P PP PP PP PPPPPP PP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 71.3 bits (167), Expect = 1e-12 Identities = 28/54 (51%), Positives = 28/54 (51%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PPPPPP P P PP P P PP PP PP PPP PP PP Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 71.3 bits (167), Expect = 1e-12 Identities = 28/54 (51%), Positives = 28/54 (51%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PPPPP P P PP P P PP PP PP PPPPPP PP Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 71.3 bits (167), Expect = 1e-12 Identities = 28/54 (51%), Positives = 28/54 (51%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP PPP P P PP P P PP PP PP PPPPPP PP Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 68.9 bits (161), Expect = 6e-12 Identities = 27/54 (50%), Positives = 28/54 (51%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PPPPP P P + PP P P PP PP PP PPPP P PP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 68.1 bits (159), Expect = 1e-11 Identities = 28/54 (51%), Positives = 28/54 (51%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P PPPP P P PP P P PP PP PP PPPPPP PP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPP-PPPPPPPPPPPAPP 421 Score = 64.9 bits (151), Expect = 9e-11 Identities = 26/56 (46%), Positives = 26/56 (46%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PPPPP PP P PPP PP P P P PPP PP PP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 64.9 bits (151), Expect = 9e-11 Identities = 26/56 (46%), Positives = 26/56 (46%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PPPPP PP P PPP PP P P P PPP PP PP Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 62.9 bits (146), Expect = 4e-10 Identities = 25/56 (44%), Positives = 26/56 (46%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PPPP + PP P PPP PP P P P PPP PP PP Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 62.5 bits (145), Expect = 5e-10 Identities = 25/56 (44%), Positives = 26/56 (46%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P+ PP PP PP PP P PPP PP P P P PPP PP PP Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 62.1 bits (144), Expect = 7e-10 Identities = 25/56 (44%), Positives = 25/56 (44%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PPPPP PP P PPP PP P P P PPP P PP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 58.4 bits (135), Expect = 8e-09 Identities = 24/56 (42%), Positives = 24/56 (42%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PPPP PP P PPP PP P P P PPP P PP Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 58.4 bits (135), Expect = 8e-09 Identities = 24/56 (42%), Positives = 24/56 (42%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P P PPPPP PP P PPP PP P P P PP PP PP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 58.4 bits (135), Expect = 8e-09 Identities = 24/56 (42%), Positives = 24/56 (42%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PPP P PP P PPP PP P P PPP PP PP Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/56 (44%), Positives = 25/56 (44%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PPPP PP P PPP PP P P P PPP PP PP Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP-PPPPPPAPPPPPPPPPPPPP 432 Score = 57.6 bits (133), Expect = 1e-08 Identities = 23/47 (48%), Positives = 23/47 (48%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP 957 P PP PPPPPP P P PP P P PP PP P L PP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 56.8 bits (131), Expect = 3e-08 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP 960 PP PPPPPP P P PP P P PP PP PP PP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 28.7 bits (61), Expect = 7.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 911 PXXPXPXPSXPXXXPPXPPXXPXS 982 P P P P P PP PP P S Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPS 388 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 60.1 bits (139), Expect = 3e-09 Identities = 27/50 (54%), Positives = 27/50 (54%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GG GGG GG GG GG G G GG G G GGGGGG GG Sbjct: 773 GGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGG 822 Score = 57.2 bits (132), Expect = 2e-08 Identities = 26/50 (52%), Positives = 26/50 (52%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GG GGG GG GG GG G G G G G GGGGGG GG Sbjct: 779 GGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGG 828 Score = 56.8 bits (131), Expect = 3e-08 Identities = 29/54 (53%), Positives = 29/54 (53%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGGGGG GG G GG G G GG A G G GGGGGG GG G Sbjct: 812 GGGGGGGGGGGGGGDGGGYGDGGGFGDG----GGYADGDGGGGGGGGGGGGGGG 861 Score = 56.0 bits (129), Expect = 4e-08 Identities = 26/54 (48%), Positives = 26/54 (48%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGGGGG G GG G G GG G G GGGGGG GG G Sbjct: 816 GGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGG 869 Score = 54.8 bits (126), Expect = 1e-07 Identities = 26/54 (48%), Positives = 26/54 (48%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGGGG GG G GG G GG G G GGGGGG GG G Sbjct: 818 GGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGG 871 Score = 54.4 bits (125), Expect = 1e-07 Identities = 25/49 (51%), Positives = 25/49 (51%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 G GGGGGG GG GG GG G G GG G G GG GGG G Sbjct: 783 GDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYG 831 Score = 53.2 bits (122), Expect = 3e-07 Identities = 25/52 (48%), Positives = 25/52 (48%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG GG GGG G G GG GGG G GG GGGGG GG Sbjct: 771 GGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGG 822 Score = 53.2 bits (122), Expect = 3e-07 Identities = 25/52 (48%), Positives = 25/52 (48%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG GG GGG G G G GG GGG G G GGGGG GG Sbjct: 777 GDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGG 828 Score = 52.4 bits (120), Expect = 5e-07 Identities = 26/51 (50%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGG-GXGG 828 GG GGGGGG GG G GG G G GG G G G GGG G GG Sbjct: 790 GGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGG 840 Score = 52.0 bits (119), Expect = 7e-07 Identities = 27/57 (47%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXG---GXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGGG G GG G G G G G GG G G GGGGGG GG G Sbjct: 819 GGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 875 Score = 50.8 bits (116), Expect = 2e-06 Identities = 25/58 (43%), Positives = 25/58 (43%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 G GG GG GG G G G GG GGG G G GGGGG GG G Sbjct: 774 GDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYG 831 Score = 50.8 bits (116), Expect = 2e-06 Identities = 25/54 (46%), Positives = 25/54 (46%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGGGGG G G GG G G GG G G GGG G GG G Sbjct: 792 GGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADG 845 Score = 50.4 bits (115), Expect = 2e-06 Identities = 26/54 (48%), Positives = 26/54 (48%), Gaps = 3/54 (5%) Frame = -3 Query: 968 GGGGGGXXXXXRG---GXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GGGGGG G G GG GG G G GG G G G GGGG GG G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGG 822 Score = 48.4 bits (110), Expect = 9e-06 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 GG GG GG G G G GG GGG G GG G GGG GG Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGG 818 Score = 47.6 bits (108), Expect = 2e-05 Identities = 27/80 (33%), Positives = 29/80 (36%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRV 803 G GG GG GGG G G G GGG G G GGGGG GG G Sbjct: 810 GDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGG 869 Query: 802 SXAXGSQXFXQXD*SNDXNR 743 G + S D + Sbjct: 870 GGGGGGGVIKNEESSTDQQK 889 Score = 46.8 bits (106), Expect = 3e-05 Identities = 23/52 (44%), Positives = 23/52 (44%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG GG GGG G G G GGG G GG GGG G GG Sbjct: 790 GGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGG 841 Score = 46.8 bits (106), Expect = 3e-05 Identities = 24/51 (47%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = -1 Query: 976 GGXG-GXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 GG G G GGG G G G GG GGG G G GGGGG GG Sbjct: 805 GGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGG 855 Score = 45.2 bits (102), Expect = 8e-05 Identities = 24/53 (45%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXG-GXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG GG GGG G G G G G GGG G GG GGG GG Sbjct: 788 GGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGG 840 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/53 (43%), Positives = 24/53 (45%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG GG G +G G G GG G G G GGGGG G GGG Sbjct: 773 GGDGGDGGG--GGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGG 823 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/53 (41%), Positives = 22/53 (41%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG GG G G G G GG GGG GG GG G GGG Sbjct: 783 GDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGG 835 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG GG G G G G GG GGG G GG G GGG G Sbjct: 794 GGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADG 845 Score = 43.6 bits (98), Expect = 3e-04 Identities = 21/41 (51%), Positives = 22/41 (53%) Frame = -3 Query: 932 GGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXW 810 GG GG GG G G GG G G GGGGGG GG G + Sbjct: 769 GGGGGGDGGDGGGGGDGGGG--GGGGGGGGGGGGGGDGGGY 807 Score = 41.5 bits (93), Expect = 0.001 Identities = 22/53 (41%), Positives = 23/53 (43%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG GG G +G G G G G GGG G GGG G GGG Sbjct: 790 GGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGF-GDGGG 841 Score = 39.5 bits (88), Expect = 0.004 Identities = 23/55 (41%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Frame = -2 Query: 975 GXXGGXGGXXXGX-EGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGG-XXGXGGG 817 G GG GG G +G G G GG G GGG G GGG G GGG Sbjct: 795 GGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGG 849 Score = 37.9 bits (84), Expect = 0.012 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -2 Query: 966 GGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG G G G G GG G GG GGGGG G GGG Sbjct: 810 GDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGG--GGGGG 857 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 59.7 bits (138), Expect = 4e-09 Identities = 27/50 (54%), Positives = 27/50 (54%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GGGGGG GG GG G G G GG G G GGGGGG GG Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 58.4 bits (135), Expect = 8e-09 Identities = 27/53 (50%), Positives = 27/53 (50%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GGGGGG GG GG G G G GG G G GGGGGG GG G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 49.2 bits (112), Expect = 5e-06 Identities = 26/54 (48%), Positives = 26/54 (48%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGGGGG G GG GG G G GG G GGGGGG G G Sbjct: 71 GGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGG-----GGGGGGGGVGRARFG 119 Score = 46.8 bits (106), Expect = 3e-05 Identities = 23/52 (44%), Positives = 23/52 (44%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG GG GGG G G G G G G G GG GGGGG G Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 45.6 bits (103), Expect = 6e-05 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = -1 Query: 967 GGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGR 806 GG GGG G G G GG GGG G G GGG GG VGR Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGR 115 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/55 (41%), Positives = 23/55 (41%) Frame = -1 Query: 958 GGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRVSXA 794 GGG G G G GG GGG G GG GGGG GG G V A Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGRA 116 Score = 35.9 bits (79), Expect = 0.050 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXR 869 G GG G GGG G G G G GGG G G R Sbjct: 80 GGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGRAR 117 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 58.8 bits (136), Expect = 6e-09 Identities = 29/54 (53%), Positives = 29/54 (53%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGGGGG GG GG GG G G GG G G GGGGGG GG G Sbjct: 659 GGDGGGGGGGG----GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 55.2 bits (127), Expect = 8e-08 Identities = 25/49 (51%), Positives = 25/49 (51%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 GG GGGGGG GG GG GG G G GG G G GG G G G Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 52.0 bits (119), Expect = 7e-07 Identities = 27/58 (46%), Positives = 27/58 (46%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 G GG GG GGG G G G GG GGG G GG GGGGG GG G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG----GGGGGGGGGAGGAGAGAG 710 Score = 50.4 bits (115), Expect = 2e-06 Identities = 24/50 (48%), Positives = 24/50 (48%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GGGGGG GG GG GG G G GG A G G G G G Sbjct: 667 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 48.4 bits (110), Expect = 9e-06 Identities = 23/52 (44%), Positives = 23/52 (44%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG GG GGG G G G GG GGG G GG G G G G Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDG 714 Score = 45.6 bits (103), Expect = 6e-05 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG GG GGG G G G GG GGG G GG G G G Sbjct: 665 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 41.9 bits (94), Expect = 8e-04 Identities = 24/75 (32%), Positives = 30/75 (40%) Frame = -1 Query: 952 GXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRVSXAXGSQXFX 773 G G G G GG GGG G GG GGGGG GG G + A Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Query: 772 QXD*SNDXNRQELGI 728 D +N+ + +L + Sbjct: 717 DVDSNNNLSDLQLTV 731 Score = 39.1 bits (87), Expect = 0.005 Identities = 22/53 (41%), Positives = 22/53 (41%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG GG G G G G GG G GGG GGG G G G G Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG------GGGGAGGAGAGAG 710 Score = 37.1 bits (82), Expect = 0.022 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXG 823 G GG GG G G G G GG G GGG G G G G Sbjct: 666 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/51 (49%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +1 Query: 829 PPXPPPP-PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PPPP PP P P PP P P PP P PP PPP P PP Sbjct: 92 PPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPP 142 Score = 55.2 bits (127), Expect = 8e-08 Identities = 28/62 (45%), Positives = 29/62 (46%), Gaps = 7/62 (11%) Frame = +1 Query: 817 PXXXPPXPPPPP-PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP------PPPPXP 975 P PP PPPPP P P PP P P PP PP PP PP PPPP P Sbjct: 96 PPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPN-PPYPPPPNAPYPPSPNAPYPPPPNP 154 Query: 976 PF 981 P+ Sbjct: 155 PY 156 Score = 55.2 bits (127), Expect = 8e-08 Identities = 25/54 (46%), Positives = 25/54 (46%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP PPP P PP P P PP PP P PPP PP PP Sbjct: 147 PYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNP---PYPPPPNPPYPP 197 Score = 55.2 bits (127), Expect = 8e-08 Identities = 25/55 (45%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAX-PPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PPPP P P PP P P PP P PP PPP PP PP Sbjct: 159 PLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPP 213 Score = 54.8 bits (126), Expect = 1e-07 Identities = 24/56 (42%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP-PPXPPF 981 P PP PP PPP P PP P P P PP P PPPP P PP+ Sbjct: 178 PYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPY 233 Score = 54.8 bits (126), Expect = 1e-07 Identities = 25/56 (44%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP-PPPPXPPF 981 P PP PP PPP P PP P P PP PP PP PPPP P F Sbjct: 186 PYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPPNPQF 241 Score = 54.4 bits (125), Expect = 1e-07 Identities = 27/58 (46%), Positives = 28/58 (48%), Gaps = 3/58 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAX-PPXGXXPXPXPPXXPPX-PPLXXXXXPP-PPPPXPPF 981 P PP PPPP P P A PP P P PP PP PP P PPPP PP+ Sbjct: 154 PPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPY 211 Score = 54.4 bits (125), Expect = 1e-07 Identities = 23/55 (41%), Positives = 24/55 (43%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 P P PPPP P P PP P P PP P PP PPP P PP+ Sbjct: 168 PPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPY 222 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/57 (45%), Positives = 26/57 (45%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXPPPP-PPXPXP--XAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PPPP PP P P PP P P PP P PP P PPPP P Sbjct: 173 PYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAP 229 Score = 52.8 bits (121), Expect = 4e-07 Identities = 25/55 (45%), Positives = 26/55 (47%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 P PP PP PPP P PP P P PP PP PP P PPPP P+ Sbjct: 123 PYPPPPNPPYPPPPNAP--YPPSPNAPYP-PPPNPPYPPPLYPPPPNPPPPNAPY 174 Score = 52.4 bits (120), Expect = 5e-07 Identities = 27/61 (44%), Positives = 27/61 (44%), Gaps = 7/61 (11%) Frame = +1 Query: 817 PXXXPPXPPPP----PPXPXPXAXPPXG--XXPXPXPP-XXPPXPPLXXXXXPPPPPPXP 975 P PP PPPP PP P P PP P P P PP PP PPPP P P Sbjct: 110 PPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPP 169 Query: 976 P 978 P Sbjct: 170 P 170 Score = 52.4 bits (120), Expect = 5e-07 Identities = 26/57 (45%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Frame = +3 Query: 810 PTXXXXPPXXPP-PPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PP PPP PP P PPP PP P P P PPP PP PP Sbjct: 144 PNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYP-PPPYPPPPNP--PYPPPPNPPYPP 197 Score = 52.0 bits (119), Expect = 7e-07 Identities = 24/54 (44%), Positives = 24/54 (44%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP PPP P PP P P PP P P PPP PP PP Sbjct: 107 PYPPPPNPPYPPPPNAPYPPPP--NPPYPPPPNAPYPPSPNAPYPPPPNPPYPP 158 Score = 51.6 bits (118), Expect = 9e-07 Identities = 25/56 (44%), Positives = 25/56 (44%), Gaps = 2/56 (3%) Frame = +1 Query: 817 PXXXPPXPPPP--PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PPPP P P P A P P PP PP P P PPPP PP Sbjct: 126 PPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPP 181 Score = 50.8 bits (116), Expect = 2e-06 Identities = 24/54 (44%), Positives = 24/54 (44%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PP PPP P PP P P PP P PP PPP PP PP Sbjct: 85 PTNFSPNPPYPPPPYPPYPPPP----PYPPPPNPPYPPPPNAPYPPPPNPPYPP 134 Score = 50.4 bits (115), Expect = 2e-06 Identities = 22/56 (39%), Positives = 22/56 (39%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PPP PP P PP P P P P PPP PP PP Sbjct: 158 PPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPP 213 Score = 50.0 bits (114), Expect = 3e-06 Identities = 26/55 (47%), Positives = 27/55 (49%), Gaps = 4/55 (7%) Frame = +1 Query: 829 PPXPPPP-PPXPXPXAXPP-XGXXPXPXPPXXP-PXPPLXXXXXPP-PPPPXPPF 981 PP P P PP P P PP P P PP P P PP PP PPPP PP+ Sbjct: 141 PPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPY 195 Score = 49.6 bits (113), Expect = 4e-06 Identities = 23/56 (41%), Positives = 23/56 (41%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PP PP PP P PP P P P P PPP PP PP Sbjct: 104 PPPPYPPPPNPPYPPPPNAP-YPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPP 158 Score = 49.6 bits (113), Expect = 4e-06 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 1/57 (1%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPX-PXXPXXPPPXPPXPP 977 P PP P PPP PP P PP PP P P P PPP P PP Sbjct: 176 PPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPP 232 Score = 48.8 bits (111), Expect = 7e-06 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = +3 Query: 828 PPXXPPP-PPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PPP PP PP P PP P P P P PPP P PP Sbjct: 92 PPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPP 142 Score = 46.8 bits (106), Expect = 3e-05 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 1/57 (1%) Frame = +3 Query: 810 PTXXXXPPXXPP-PPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PP PPP P P PP PP P P PPP P PP Sbjct: 120 PNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPP 176 Score = 46.4 bits (105), Expect = 4e-05 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 PP P PP PP P PP P P P P PPP PP P Sbjct: 135 PPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPP 183 Score = 46.0 bits (104), Expect = 5e-05 Identities = 22/56 (39%), Positives = 22/56 (39%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PPPP PP P PP P P P P PPP P PP Sbjct: 169 PPNAPYPPPPYPPPPNPP---YPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPP 221 Score = 45.6 bits (103), Expect = 6e-05 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = +3 Query: 828 PPXXPPPP-PXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PPPP P PP P PP P P P P P P P PP Sbjct: 100 PPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPP 150 Score = 44.8 bits (101), Expect = 1e-04 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = +3 Query: 828 PPXXPPP-PPXXXXXRXPPXXXXXXPXPPP-XPPXPXPXXPXXPPPXPPXPP 977 PP PPP P P P PPP PP P P P P P PP PP Sbjct: 130 PPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPP 181 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 2/57 (3%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXP-PPXPPXPXPXXPXXPP-PXPPXP 974 P PP PP PP PP P P P PP P P PP P PP P Sbjct: 183 PNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPPNP 239 Score = 43.6 bits (98), Expect = 3e-04 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P P P PP PP PPP P P P P PPP PP PP Sbjct: 136 PNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPP--PYPPPPNPPYPP 189 Score = 43.6 bits (98), Expect = 3e-04 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = +2 Query: 812 NXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 N PPP PPPP PP P PP P P P P PP P Sbjct: 166 NPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNP 220 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP P PP PP P P PP P P PPP P PP Sbjct: 128 PNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPP 183 Score = 42.3 bits (95), Expect = 6e-04 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P P PPPP PP P PP P P P P P P PP P Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAP 139 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/59 (37%), Positives = 22/59 (37%) Frame = +2 Query: 806 SXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXPXS 982 S N P P P PP PP PP P PP P P P P PP P S Sbjct: 89 SPNPPYPPPPYPPYPPPPPY----PPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPS 143 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/40 (40%), Positives = 18/40 (45%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXP 922 ++ N PPP P PPPP PPP P PP P Sbjct: 200 NAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPPNP 239 Score = 38.3 bits (85), Expect = 0.009 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXP-PPXPPXPXPXXPXX-PPPXPPXPP 977 P PP P PP PP P P P PP P P P PP P PP Sbjct: 112 PNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPP 169 Score = 37.9 bits (84), Expect = 0.012 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPX-PPXPP 977 P PP P P PP P PPP P P P P PPP P PP Sbjct: 135 PPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPP-PNAPYPPPPYPPPPNPPYPPP 190 Score = 34.7 bits (76), Expect = 0.12 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = +1 Query: 877 PPXGXXPXPX--PPXXPPXPPLXXXXXPPPP-PPXPP 978 PP P P PP PP PP PPPP PP PP Sbjct: 84 PPTNFSPNPPYPPPPYPPYPP--PPPYPPPPNPPYPP 118 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 56.0 bits (129), Expect = 4e-08 Identities = 23/51 (45%), Positives = 23/51 (45%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P P PPPP P P P G P P P PP PP PPPPPP Sbjct: 360 PTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 54.0 bits (124), Expect = 2e-07 Identities = 26/55 (47%), Positives = 26/55 (47%), Gaps = 4/55 (7%) Frame = +1 Query: 817 PXXXPPXPPPP----PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP PPPP PP P P PP P P P PP PP PPPPPP Sbjct: 350 PTNNPPSPPPPTNNTPPPPPPTNKPP----PPPPPTNGPPPPPPPTNGPPPPPPP 400 Score = 53.2 bits (122), Expect = 3e-07 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PPPPP P PP P P PP P PP PPPPPP Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPP 389 Score = 52.8 bits (121), Expect = 4e-07 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P P PPPP P PP P P PP P PP PPPPPP Sbjct: 349 PPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPP 399 Score = 48.8 bits (111), Expect = 7e-06 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PPP PPPPP PPP P PP P P P P PP P Sbjct: 358 PPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 47.6 bits (108), Expect = 2e-05 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Frame = +2 Query: 812 NXPPPXPXXP--PPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 N PPP P PPPP PPP P PP P P P PP PP Sbjct: 345 NPPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPP 398 Score = 46.8 bits (106), Expect = 3e-05 Identities = 21/47 (44%), Positives = 21/47 (44%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PP P PP P P P P P P PP PP PPPPPP Sbjct: 347 PPPPTNNPPSPPP---PTNNTPPPPPPTNKPPPPPPPTNGPPPPPPP 390 Score = 46.8 bits (106), Expect = 3e-05 Identities = 22/58 (37%), Positives = 24/58 (41%), Gaps = 2/58 (3%) Frame = +2 Query: 800 THSXNXPPPXPX--XPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 T++ PPP PPPPP PPP P PP P P P PP PP Sbjct: 351 TNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPP 408 Score = 46.0 bits (104), Expect = 5e-05 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PPPPP P PP P P PP P P PPPP PP Sbjct: 369 PPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPP-------PPPPTNGPP 415 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPP--XPPXPXPXXPXXPPPXPP 968 PPPPP PP P PPP PP P P PPP PP Sbjct: 366 PPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 44.8 bits (101), Expect = 1e-04 Identities = 22/61 (36%), Positives = 23/61 (37%), Gaps = 5/61 (8%) Frame = +3 Query: 810 PTXXXXPPXXPP-----PPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P PP PP PPP + PP PPP PP P P P PP P Sbjct: 348 PPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPP 407 Query: 975 P 977 P Sbjct: 408 P 408 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 3/56 (5%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXP---PXPXPXXPXXPPPXPP 968 P P PPPP PP P PPP P P P P PPP PP Sbjct: 354 PPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPP 409 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 4/53 (7%) Frame = +2 Query: 812 NXPPPXPX----XPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP 958 N PPP P PPPPP PPP P PP P P P PP Sbjct: 363 NTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 43.6 bits (98), Expect = 3e-04 Identities = 23/61 (37%), Positives = 26/61 (42%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXPX 979 T++ PPP PPPPP PPP P PP P P P+ PP P P Sbjct: 361 TNNTPPPPPPTNKPPPPPPPTNGPPPPPP---PTNGPP--PPPPPTNGPPPPPPPTNGPP 415 Query: 980 S 982 S Sbjct: 416 S 416 Score = 41.9 bits (94), Expect = 8e-04 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = +3 Query: 813 TXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 T PP PPPP PP PPP PP P P P PP Sbjct: 364 TPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 36.7 bits (81), Expect = 0.029 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 886 GXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 G P P P PP PP PPPPPP Sbjct: 343 GVNPPPPPTNNPPSPPPPTNNTPPPPPP 370 Score = 35.1 bits (77), Expect = 0.088 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXP 935 P P P PPPPP PP P PPP P P Sbjct: 367 PPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 29.9 bits (64), Expect = 3.3 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPP 882 P P PPPP P P + PP Sbjct: 72 PSTPAPPPPPPPPSSGPP 89 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXG 888 P P PPPPPP P P G Sbjct: 72 PSTPAPPPPPPPPSSGPPLPPSNG 95 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 55.2 bits (127), Expect = 8e-08 Identities = 22/50 (44%), Positives = 23/50 (46%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 P PP PPPPPP PP P P PP PP+ PPPPP Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 47.2 bits (107), Expect = 2e-05 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 4/51 (7%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPP----XXPPXPPLXXXXXPPPPPP 969 P PPPPP P P G P P PP PP PP PPPPPP Sbjct: 656 PEAGPPPPPPP-PPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 895 PXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PP PP PP PPPPP P Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPP 682 Score = 31.9 bits (69), Expect = 0.82 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 900 PXPPPXPPXPXPXXPXXPPPXPPXP 974 P PPP PP PPP PP P Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPLP 684 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 55.2 bits (127), Expect = 8e-08 Identities = 26/54 (48%), Positives = 26/54 (48%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGGGGG GG G GG G G GG G G G GGGG G G Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGG 1809 Score = 51.2 bits (117), Expect = 1e-06 Identities = 25/54 (46%), Positives = 25/54 (46%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG G GGG GG GG GG G G G G G GG GGG GG G Sbjct: 1793 GGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGGG 1846 Score = 49.2 bits (112), Expect = 5e-06 Identities = 25/54 (46%), Positives = 25/54 (46%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGGGG GG GG G G G G G GGGGGG GG G Sbjct: 1771 GGMAGGGGGMGGGGMAAGGGEFGG-GEGMGGGGMAGGGGGMGGGGGGMGGGGEG 1823 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXG-GGGGXXGG 827 GG GG GGG G G G GGG G GG G GGGG GG Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGG 1806 Score = 43.6 bits (98), Expect = 3e-04 Identities = 24/68 (35%), Positives = 26/68 (38%), Gaps = 2/68 (2%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXG--GGGGXXGGXXXXVG 809 G GG GG GG G G G GG G GG G GGGG GG +G Sbjct: 1766 GMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMG 1825 Query: 808 RVSXAXGS 785 G+ Sbjct: 1826 AAGGGMGA 1833 Score = 43.2 bits (97), Expect = 3e-04 Identities = 24/60 (40%), Positives = 25/60 (41%), Gaps = 2/60 (3%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXG--GGGGXXGGXXXXVG 809 G GG GG GG G G G G GGG GG G GGGG GG +G Sbjct: 1759 GGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMG 1818 Score = 42.7 bits (96), Expect = 4e-04 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGG G G GG GG G G G G G G GG GG G Sbjct: 1789 GGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGG 1842 Score = 42.3 bits (95), Expect = 6e-04 Identities = 23/52 (44%), Positives = 23/52 (44%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG G GGG G G G GG GGG GG GG GG GG Sbjct: 1797 GMGGGGMAGGG--GGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGGG 1846 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG G G G G GG G GGG G GGG G GGG Sbjct: 1768 GGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGG 1820 Score = 40.7 bits (91), Expect = 0.002 Identities = 25/66 (37%), Positives = 25/66 (37%), Gaps = 1/66 (1%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGG-GXXGGXXXXVGR 806 G GG GG GG G G G GG G G G GGGG G GG G Sbjct: 1763 GGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGE 1822 Query: 805 VSXAXG 788 A G Sbjct: 1823 GMGAAG 1828 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/58 (36%), Positives = 21/58 (36%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 G GG GG G G G G GGG G GG GGG GG G Sbjct: 1784 GMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAG 1841 Score = 37.1 bits (82), Expect = 0.022 Identities = 21/55 (38%), Positives = 22/55 (40%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGGXL 811 G GG GG G G G GG G GGG GGGG GGG + Sbjct: 1757 GFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGM-AGGGGGM 1810 Score = 37.1 bits (82), Expect = 0.022 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 4/57 (7%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXG----XGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG G EG G G GG G GGG GGG G G GGG Sbjct: 1783 GGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGG 1839 Score = 37.1 bits (82), Expect = 0.022 Identities = 27/88 (30%), Positives = 29/88 (32%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRV 803 G G GG G G G GG GGG G G G GG GG G Sbjct: 1788 GGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGGGY 1847 Query: 802 SXAXGSQXFXQXD*SNDXNRQELGIVSG 719 S S F S+ + G SG Sbjct: 1848 SAQKSSSSFSYTS-SSSSSAARKGAYSG 1874 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 54.8 bits (126), Expect = 1e-07 Identities = 25/50 (50%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +1 Query: 829 PPXPPP-PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PP PPP PPP P P PP P P PP PP PP P PPP P Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRP-PPPPPPSPPRPLAAKLPEPPPIP 252 Score = 54.8 bits (126), Expect = 1e-07 Identities = 26/54 (48%), Positives = 26/54 (48%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PPPPPP P P PP P P PP PP P PPP P PP Sbjct: 208 PPRPPPSPPPPPPPPSP--SPP---RPPPPPPPSPPRPLAAKLPEPPPIPNMPP 256 Score = 50.8 bits (116), Expect = 2e-06 Identities = 28/87 (32%), Positives = 33/87 (37%) Frame = +3 Query: 717 PPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXX 896 PP +P + R + DQ P + + T PP PPP P P Sbjct: 172 PPTRLPGNARVNAIDQISIGTS-HPTSPSQI-TQPPPPPPRPPPSPPPPPPPPSPSPPRP 229 Query: 897 XPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PPP PP P PPP P PP Sbjct: 230 PPPPPPSPPRPLAAKLPEPPPIPNMPP 256 Score = 47.6 bits (108), Expect = 2e-05 Identities = 24/47 (51%), Positives = 25/47 (53%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PPPPPP P P + PP P P P PP PP PPPPP PP Sbjct: 204 PPPPPPRPPP-SPPP----PPPPPSPSPPRPP-------PPPPPSPP 238 Score = 44.8 bits (101), Expect = 1e-04 Identities = 19/50 (38%), Positives = 20/50 (40%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 P PP PPPP P P PP P P P PP+ PPP Sbjct: 212 PPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPP 261 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPL 936 P P PPPPP P P A P P P P P L Sbjct: 224 PSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPPTL 263 Score = 33.9 bits (74), Expect = 0.20 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP 959 P PP PPPPP P P PPP P P P PPP Sbjct: 220 PPPSPSPPRPPPPPPPSP----PRPLAAKLPEPPPIPNMP----PTLPPP 261 Score = 30.3 bits (65), Expect = 2.5 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +2 Query: 872 RPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 +PPP P PP P P P P PP PP P Sbjct: 203 QPPPPPPRP---PP-SPPPPPPPPSPSPPRPPPPP 233 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 54.4 bits (125), Expect = 1e-07 Identities = 25/49 (51%), Positives = 25/49 (51%), Gaps = 3/49 (6%) Frame = +1 Query: 832 PXPPPPPPX---PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PPPPP P P PP G P P PP PP PP PPPPPP Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPP--PPPPPPGDGGAPPPPPP 336 Score = 48.0 bits (109), Expect = 1e-05 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PPPPP PP P PP PP PP PPPP PP Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 46.0 bits (104), Expect = 5e-05 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = +3 Query: 831 PXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P PPPP PP PPP PP P P PP PP P Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 45.6 bits (103), Expect = 6e-05 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = +3 Query: 813 TXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 T P PPP PP P PPP PP P P PPP PP Sbjct: 285 TGGGAPVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 859 PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P G P P PP P P PPPPPP PP Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAP------PPPPPPPPP 323 Score = 35.5 bits (78), Expect = 0.066 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PPP P PP PPP P PP P P PP PP Sbjct: 294 PPPADGSAPAPPP------PPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPP 914 P A + P PP PPP PP P PPP Sbjct: 295 PPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 54.4 bits (125), Expect = 1e-07 Identities = 28/61 (45%), Positives = 28/61 (45%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXWXSEX 798 GG G GGGG GG G GG G G GG G G G GGGG GG G E Sbjct: 172 GGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGGGYEV 231 Query: 797 S 795 S Sbjct: 232 S 232 Score = 52.8 bits (121), Expect = 4e-07 Identities = 28/58 (48%), Positives = 28/58 (48%), Gaps = 4/58 (6%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXA----XGXGXGGGGGGXGGXXXG 816 GG GGGGG RGG G GG G G GG G G GGGGGG GG G Sbjct: 152 GGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYG 209 Score = 50.8 bits (116), Expect = 2e-06 Identities = 25/54 (46%), Positives = 25/54 (46%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG G GGGG GG G GG G G GG G GGGGG GG G Sbjct: 167 GGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYG 220 Score = 48.4 bits (110), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGG-GXGGXXXG 816 GG G GGG RG GG GG G G GG G G GGGG G GG G Sbjct: 150 GGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYG 204 Score = 47.6 bits (108), Expect = 2e-05 Identities = 26/58 (44%), Positives = 27/58 (46%), Gaps = 2/58 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGX--GXXPXGGXAXGXGXGGGGGGXGGXXXGXW 810 GG GGGGG G GG GG G G GG G G GGGG G GG G + Sbjct: 134 GGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGY 191 Score = 47.2 bits (107), Expect = 2e-05 Identities = 23/52 (44%), Positives = 23/52 (44%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG GG G G G G G GG GGG G GG GGG GG Sbjct: 177 GGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGGG 228 Score = 46.8 bits (106), Expect = 3e-05 Identities = 26/54 (48%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGG--XGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG GG GGG G G G GG GGG G GG GGGGG GG Sbjct: 165 GRGG-GGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGG 217 Score = 44.8 bits (101), Expect = 1e-04 Identities = 25/55 (45%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGG-GGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGG GGG GG G G G G G G G GGGG G GG G Sbjct: 130 GGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGG 184 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/59 (42%), Positives = 26/59 (44%), Gaps = 4/59 (6%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGX----GXXPXGGXAXGXGXGGGGGGXGGXXXGXW 810 G GG GG RGG GG G G G GG G G GGGG G GG G + Sbjct: 123 GGGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGY 181 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/56 (44%), Positives = 26/56 (46%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXW 810 GG GGGG RGG GG G G GG G G GGGG G GG G + Sbjct: 146 GGYRGGGG-----YRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGY 196 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/53 (45%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGG-XGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G GG GGG G G G GG GGG G GG G GGG GG Sbjct: 174 GGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGG 226 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGGG G G GG G G GG G G GGGG GG G Sbjct: 145 GGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGG 198 Score = 42.3 bits (95), Expect = 6e-04 Identities = 23/52 (44%), Positives = 23/52 (44%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG G GGG G G G GG GGG GG GGGG GG Sbjct: 150 GGGGYRGGGGGYRG-RGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGG 200 Score = 41.9 bits (94), Expect = 8e-04 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG G GGG G G G GGG G GG G GGG GG Sbjct: 170 GYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGG 221 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 3/56 (5%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGX---XGXGGG 817 G GG G G G G G GG G GGG GGGGG G GGG Sbjct: 156 GGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGG 211 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -2 Query: 963 GXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG G G G G GG G GGG G GG G GGG Sbjct: 165 GRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGG 213 Score = 38.7 bits (86), Expect = 0.007 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGX-GGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 GG GG GG G G GG GGG G GG GGGG GG Sbjct: 134 GGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGG 184 Score = 38.7 bits (86), Expect = 0.007 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG G G G G GG G GGG GGG G G GGG Sbjct: 147 GYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGG 199 Score = 37.9 bits (84), Expect = 0.012 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G GG GGG G G G GG G G R GGGG GG Sbjct: 129 GGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGG 180 Score = 37.5 bits (83), Expect = 0.016 Identities = 24/60 (40%), Positives = 24/60 (40%), Gaps = 2/60 (3%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGG--GGGXXGGXXXXVG 809 G G GG GG G G G G GGG G GG GG GGG GG G Sbjct: 147 GYRGGGGYRGGGGGYRGRGRG--GGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYG 204 Score = 36.3 bits (80), Expect = 0.038 Identities = 23/55 (41%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Frame = -1 Query: 982 GXGGXGG--XGGGXXGXXGXGXGGXG-GGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG GG GGG G G GG G G G GG GGGG GG Sbjct: 135 GRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGG 189 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = -2 Query: 936 EGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 + G G GG G GGG GGGG G GGG Sbjct: 121 DSGGGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGG 160 Score = 33.1 bits (72), Expect = 0.35 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 928 GXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGR 806 G G GGG G GG R GGGG GG GR Sbjct: 124 GGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGR 164 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 54.0 bits (124), Expect = 2e-07 Identities = 25/52 (48%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXP-XPXPPXXPP-XPPLXXXXXPPPPPPXPP 978 PP PPP PP P A PP P P PP PP PP PPPPP P Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQP 101 Score = 51.6 bits (118), Expect = 9e-07 Identities = 26/61 (42%), Positives = 26/61 (42%), Gaps = 7/61 (11%) Frame = +1 Query: 817 PXXXPPXPP------PPPPXPXPXAXPPXGXXPXPXPPXXP-PXPPLXXXXXPPPPPPXP 975 P PP PP PPPP P A PP P PP P P PP P PPP P Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAP 109 Query: 976 P 978 P Sbjct: 110 P 110 Score = 49.6 bits (113), Expect = 4e-06 Identities = 24/58 (41%), Positives = 24/58 (41%), Gaps = 3/58 (5%) Frame = +1 Query: 817 PXXXPPXPPPP---PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 P P PPPP P P P A PP P P P PP P PP PP PF Sbjct: 58 PAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPPHFLPF 115 Score = 46.0 bits (104), Expect = 5e-05 Identities = 24/63 (38%), Positives = 25/63 (39%), Gaps = 6/63 (9%) Frame = +2 Query: 806 SXNXPPPXPXXP-----PPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXP-PXPP 967 S + PPP P P PPP PPP P PP P P P P P P PP Sbjct: 47 SSSPPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPP 106 Query: 968 XXP 976 P Sbjct: 107 PAP 109 Score = 45.6 bits (103), Expect = 6e-05 Identities = 20/56 (35%), Positives = 21/56 (37%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P+ P PPPP PP P PPP P P P P PP PP Sbjct: 55 PSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 Score = 41.5 bits (93), Expect = 0.001 Identities = 22/67 (32%), Positives = 24/67 (35%), Gaps = 3/67 (4%) Frame = +2 Query: 785 TTXXXTHSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPP---XXPXPXPSXPXXXP 955 TT T+ + P PPP P PPP P PP P P P P Sbjct: 35 TTANFTYYPHFISSSPPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAP 94 Query: 956 PXPPXXP 976 P PP P Sbjct: 95 PPPPAQP 101 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P A P P PPPP PP P PPP P P P P PP P Sbjct: 58 PAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPL---PAPPPPPAQPAPQPPPAPPHFLP 114 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 53.6 bits (123), Expect = 2e-07 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PPPP P PP G P PP PP PPPPPP PP Sbjct: 937 PGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPP 990 Score = 52.4 bits (120), Expect = 5e-07 Identities = 26/54 (48%), Positives = 26/54 (48%), Gaps = 4/54 (7%) Frame = +1 Query: 829 PPXP----PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP P PPPPP P A PP G P PP PP PPPPPP PP Sbjct: 945 PPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPP----PPPPPPPPPPP 994 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PPPP P PP G P P P PP PPPPPP PP Sbjct: 942 PSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPP 991 Score = 44.8 bits (101), Expect = 1e-04 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = +3 Query: 795 AXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 A L P P PPPP PP P PP P P PPP PP P Sbjct: 930 APLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPP 989 Query: 975 P 977 P Sbjct: 990 P 990 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/56 (41%), Positives = 24/56 (42%), Gaps = 3/56 (5%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP---XXPPXPPLXXXXXPPPPPP 969 + P PP PPP P PP G P P PP P PP PPPPPP Sbjct: 908 ESPSASPPGGSVPPPPP-----PPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPP 958 Score = 43.6 bits (98), Expect = 3e-04 Identities = 19/53 (35%), Positives = 20/53 (37%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P+ P PPPP PP P PPP P P PPP PP Sbjct: 942 PSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/42 (47%), Positives = 21/42 (50%), Gaps = 6/42 (14%) Frame = +1 Query: 829 PPXPPP----PPPX--PXPXAXPPXGXXPXPXPPXXPPXPPL 936 PP PPP PPP P PP G P P PP PP PP+ Sbjct: 954 PPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPPM 995 Score = 39.9 bits (89), Expect = 0.003 Identities = 24/64 (37%), Positives = 24/64 (37%), Gaps = 8/64 (12%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPP-----XPPXPXPXXPXXPPP---XP 965 P PP PPPPP PP P PP PP P P PPP P Sbjct: 914 PPGGSVPP--PPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAP 971 Query: 966 PXPP 977 P PP Sbjct: 972 PLPP 975 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PPP PPPPP PP P PP P P PP PP P Sbjct: 946 PPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPP------PPPPPPPP 992 Score = 34.3 bits (75), Expect = 0.15 Identities = 20/60 (33%), Positives = 22/60 (36%) Frame = +2 Query: 788 TXXXTHSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 T + S + PP PPPPP PP P P P P P PP PP Sbjct: 903 TPGGSESPSASPPGGSVPPPPPPPGGNAPLPP--PPPGGSAPSQP-PPPGGNAPPPPPPP 959 Score = 32.3 bits (70), Expect = 0.62 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 9/47 (19%) Frame = +1 Query: 865 PXAXPPXGXXPX-PXPP----XXPPXPPLXXXXXPPPPP----PXPP 978 P A PP G P P PP PP PP PPPP P PP Sbjct: 910 PSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPP 956 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 805 LXQXPXXXPPXPPPPPPXPXP 867 L P P PPPPPP P P Sbjct: 973 LPPPPGGSAPPPPPPPPPPPP 993 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 52.8 bits (121), Expect = 4e-07 Identities = 26/56 (46%), Positives = 26/56 (46%), Gaps = 6/56 (10%) Frame = +1 Query: 829 PPXPPPPP------PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PPPPP P P P PP G P P PP P PPPPPP PP Sbjct: 696 PPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPP---PPSPQPGCAGLPPPPPPPPP 748 Score = 50.8 bits (116), Expect = 2e-06 Identities = 24/54 (44%), Positives = 24/54 (44%), Gaps = 4/54 (7%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXP----XPPXXPPXPPLXXXXXPPPPPPXPP 978 P PPPPPP P PP P P PP PP PP PPPPP P Sbjct: 710 PMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVP 763 Score = 48.8 bits (111), Expect = 7e-06 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PPPPPP P P G P P PP PP PP PPPP P P Sbjct: 694 PPPPPPPPPPLLS---GTLPMPPPP--PPPPPGCAGLPPPPPSPQP 734 Score = 48.4 bits (110), Expect = 9e-06 Identities = 24/54 (44%), Positives = 24/54 (44%), Gaps = 5/54 (9%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXX---PPXPPLXXXXXP--PPPPPXPP 978 P PPPPPP P P P P PP PP PP PPPPP PP Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPP 747 Score = 46.4 bits (105), Expect = 4e-05 Identities = 22/60 (36%), Positives = 22/60 (36%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P L T PP PPPP PP PP PP P P PPP PP Sbjct: 700 PPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPP 759 Score = 45.6 bits (103), Expect = 6e-05 Identities = 23/48 (47%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXP-PPPPPXPP 978 PPPPPP P G PP PP PPL P PPPPP PP Sbjct: 677 PPPPPPLPVIE-----GSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPP 719 Score = 44.8 bits (101), Expect = 1e-04 Identities = 22/59 (37%), Positives = 23/59 (38%), Gaps = 2/59 (3%) Frame = +2 Query: 806 SXNXPPPXPXXPPPPPXXXXXXRPPPXXXXP--XXXPPXXPXPXPSXPXXXPPXPPXXP 976 S + PPP P PPP PPP P PP P P P PP PP P Sbjct: 690 SLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPP 748 Score = 44.0 bits (99), Expect = 2e-04 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +1 Query: 844 PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PPPP P P P P PP PP PPPPPP P Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPP 720 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 6/56 (10%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXX------PXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PPPPP PP P PPP PP P PP P P Sbjct: 712 PPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPP-PPGCAGLPPPPPPIDVPMKP 766 Score = 31.9 bits (69), Expect = 0.82 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 7/57 (12%) Frame = +1 Query: 832 PXPPPPP-------PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 P PPP P P P P P P P PP P PL P P+ Sbjct: 726 PPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVPMKPLFWKRIQLKKPQPEPY 782 Score = 28.7 bits (61), Expect = 7.6 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 4/49 (8%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPX----PPPXPPXPXPXXP 944 P PP PPP P PP P PPP PP P P Sbjct: 720 PGCAGLPP--PPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVPMKP 766 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 52.4 bits (120), Expect = 5e-07 Identities = 25/52 (48%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPP--XXPPXPPLXXXXXPPPPPPXPPF 981 P PPPPPP P G P P PP PP PP PPPPP PPF Sbjct: 280 PPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPP-PPF 330 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 4/50 (8%) Frame = +3 Query: 831 PXXPPPPPXXXXXRXPPXXXXXXPXPP----PXPPXPXPXXPXXPPPXPP 968 P PPPPP P PP P PP P P PPP PP Sbjct: 280 PPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPPP 329 Score = 33.1 bits (72), Expect = 0.35 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +1 Query: 844 PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PP P A PP P P PP P PPPPPP Sbjct: 269 PPIPSASQNATPP----PPPPPPSNTPGMFASSGFQPPPPPP 306 Score = 29.1 bits (62), Expect = 5.8 Identities = 15/32 (46%), Positives = 16/32 (50%), Gaps = 4/32 (12%) Frame = +1 Query: 829 PPXPP----PPPPXPXPXAXPPXGXXPXPXPP 912 PP PP PPPP P P + P P P PP Sbjct: 302 PPPPPTDFAPPPPPPEPTSELP----PPPPPP 329 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 919 PPXPPLXXXXXPPPPPPXP 975 PP P PPPPPP P Sbjct: 269 PPIPSASQNATPPPPPPPP 287 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 52.0 bits (119), Expect = 7e-07 Identities = 24/46 (52%), Positives = 24/46 (52%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGG 840 GG GGG GG GG GG GG G G GG G G GGGGG Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGG 126 Score = 48.0 bits (109), Expect = 1e-05 Identities = 27/55 (49%), Positives = 28/55 (50%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXWXS 804 GG GGG GG GG GG G G GG G G GGGGGG GG G + S Sbjct: 81 GGRGGGF-----GGGGGFGGGGGGGFGGGGGGGFGGG-GGGGGGFGGGGGGGFGS 129 Score = 41.9 bits (94), Expect = 8e-04 Identities = 23/51 (45%), Positives = 23/51 (45%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXG 830 G GG G GGG G G G GG GGG GG GGGGG G Sbjct: 82 GRGGGFGGGGGFGGGGGGGFGGGGGG----GFGGGGGGGGGFGGGGGGGFG 128 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/48 (45%), Positives = 22/48 (45%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGG 839 G G G GGG G G G GG GGG G GG GGGGG Sbjct: 81 GGRGGGFGGGGGFG--GGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGG 126 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 51.6 bits (118), Expect = 9e-07 Identities = 24/51 (47%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = +1 Query: 829 PPXPPPPPPXPX-PXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PP PP P A PP P P P PP PP PPPPP PP Sbjct: 161 PPQPPAPPAAPFMAPAAPPA--PPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 Score = 39.1 bits (87), Expect = 0.005 Identities = 22/58 (37%), Positives = 23/58 (39%), Gaps = 2/58 (3%) Frame = +3 Query: 810 PTXXXXPPXXPPPP--PXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P+ PP P PP P P P PP PP P P PPP PP PP Sbjct: 155 PSIASQPPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGP--PSAPPP-PPAPP 209 Score = 38.3 bits (85), Expect = 0.009 Identities = 19/42 (45%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXA--XPPXGXXPXPXPPXXPPXPPL 936 P P PP PPP P A PP G P PP PP PP+ Sbjct: 171 PFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPP--PPAPPV 210 Score = 35.1 bits (77), Expect = 0.088 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PP P PP P P P PP P P PP PP Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +1 Query: 859 PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 P + PP P P P PP P PP PPF Sbjct: 155 PSIASQPPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPF 195 Score = 30.3 bits (65), Expect = 2.5 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 1/46 (2%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPP-XXXXXXPXPPPXPP 923 P A P P PPPP PP P PPP PP Sbjct: 164 PPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 50.0 bits (114), Expect = 3e-06 Identities = 26/54 (48%), Positives = 26/54 (48%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGGGGG GG GG GG G G A G GGGGGG G G Sbjct: 41 GGGGGGGGGG-----GGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDG 89 Score = 48.0 bits (109), Expect = 1e-05 Identities = 23/51 (45%), Positives = 23/51 (45%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GGGGGG GG GG G G G A G G GGGGG G G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDGDG 91 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 872 AXGXGXGGGGGGXGGXXXG 816 A G G GGGGGG GG G Sbjct: 39 ADGGGGGGGGGGGGGGGGG 57 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 49.2 bits (112), Expect = 5e-06 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PP PP PP P P A P P PP P PP PP PP P Sbjct: 188 PPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNP 236 Score = 45.2 bits (102), Expect = 8e-05 Identities = 21/54 (38%), Positives = 22/54 (40%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP P P P P P P P PP PP+ PP P PP Sbjct: 172 PETKPPKPPAPSTIPTPPTPP---APPSPPIPTAPPTPPMPETPLPPGSPHIPP 222 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PP PP P A P P P PP PP PP P PP Sbjct: 263 PASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPP 316 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 3/49 (6%) Frame = +1 Query: 829 PPXP--PPPPPXPX-PXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 PP P PP PP P P A P P P P PP PP PP PP Sbjct: 309 PPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPPAPP--NPSIPPAPP 355 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 3/52 (5%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXG---XXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PP P PP P P P G P P P PP PP P PP P Sbjct: 197 PPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPMP 248 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP P A P P P P P PP PP P PP Sbjct: 294 PYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPP 343 Score = 37.9 bits (84), Expect = 0.012 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 3/53 (5%) Frame = +1 Query: 829 PPXPPPP--PPXPXPXAXPPXGXXPXPXP-PXXPPXPPLXXXXXPPPPPPXPP 978 PP P P PP P PP P P P PP PP PP P PP Sbjct: 282 PPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIPP 334 Score = 37.5 bits (83), Expect = 0.016 Identities = 21/62 (33%), Positives = 22/62 (35%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P A T+PT PP P PP P P PP P P PP PP Sbjct: 179 PPAPSTIPT----PPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPP 234 Query: 969 XP 974 P Sbjct: 235 NP 236 Score = 37.1 bits (82), Expect = 0.022 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 6/56 (10%) Frame = +1 Query: 829 PPXPP-----PPPPXPXPXAXPPXGXXPXPXP-PXXPPXPPLXXXXXPPPPPPXPP 978 PP PP PP P PP P P P PP PP PP P PP Sbjct: 297 PPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIPP 352 Score = 36.7 bits (81), Expect = 0.029 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP--PPXPP 978 P P PP P P A P P P P P P PP P PP PP Sbjct: 246 PMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPP 301 Score = 36.3 bits (80), Expect = 0.038 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P T PP P P P P PP PP P P P PP Sbjct: 163 PVTETTTTKPETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPP 222 Query: 969 XP 974 P Sbjct: 223 AP 224 Score = 36.3 bits (80), Expect = 0.038 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP--PPXPP 978 PP P P P A P P P PP PP PP P P PP Sbjct: 245 PPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPP 292 Score = 36.3 bits (80), Expect = 0.038 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXP--XPXPSXPXXXPPXPPXXP 976 PP P PP PP PP P P P P PS P PP P P Sbjct: 291 PPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIP-PAPPNPSIPP 343 Score = 35.5 bits (78), Expect = 0.066 Identities = 20/65 (30%), Positives = 21/65 (32%), Gaps = 2/65 (3%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXP--PPX 962 P + T P P PP P P PP P P P P P PP Sbjct: 234 PNPSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPPN 293 Query: 963 PPXPP 977 P PP Sbjct: 294 PYIPP 298 Score = 35.1 bits (77), Expect = 0.088 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +1 Query: 853 PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P + PP P PP PP PP PP PP Sbjct: 154 PEPTITSKPPVTETTTTKPETKPPKPPAPSTIPTPPTPPAPP 195 Score = 34.7 bits (76), Expect = 0.12 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 3/56 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXP-XPXPPXXPP--XPPLXXXXXPPPPPPXP 975 P P PP PP P P P P PP P PP PP PP P Sbjct: 222 PAPLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNP 277 Score = 34.7 bits (76), Expect = 0.12 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 6/52 (11%) Frame = +1 Query: 829 PPXPPPP-----PPXP-XPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 PP PP P PP P P A P P P P PP PP PP P Sbjct: 315 PPAPPNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIPPAPP--NLFIPPATP 364 Score = 33.9 bits (74), Expect = 0.20 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 4/54 (7%) Frame = +1 Query: 829 PPXPP----PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PP P PP P PP P P P P P PP P P Sbjct: 271 PPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIP 324 Score = 33.1 bits (72), Expect = 0.35 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP--PPPPXPP 978 PP P PP P PP P P P PP+ PP P P PP Sbjct: 214 PPGSPHIPPAPLHPHIPP--APPNPSKAIATPNPPMPETPLPPATPNPFIPP 263 Score = 32.3 bits (70), Expect = 0.62 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 831 PXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXP 965 P PP PP PP P P P P P P PP P Sbjct: 312 PHIPPAPPNPYIPTAPPNPSIPPAPPNPSIP-PAPPNPSIPPAPP 355 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PP P P P PP PP PP PP PP P Sbjct: 162 PPVTETTTTKPETKPPKPPAPSTIPTPPT-PPAPPSPPIPTAPPTPPMP 209 Score = 31.9 bits (69), Expect = 0.82 Identities = 21/62 (33%), Positives = 22/62 (35%), Gaps = 10/62 (16%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRP-----PPXXXXPXXXPPXXPXP-----XPSXPXXXPPXPPX 970 PP P PP PP P PP P PP P P P+ P P PP Sbjct: 197 PPIPTAPPTPPMPETPLPPGSPHIPPAPLHP-HIPPAPPNPSKAIATPNPPMPETPLPPA 255 Query: 971 XP 976 P Sbjct: 256 TP 257 Score = 31.5 bits (68), Expect = 1.1 Identities = 20/65 (30%), Positives = 21/65 (32%), Gaps = 1/65 (1%) Frame = +2 Query: 785 TTXXXTHSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXP-PX 961 TT + PP P P PP PP P P P P P P P P Sbjct: 167 TTTTKPETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLP-PGSPHIPPAPL 225 Query: 962 PPXXP 976 P P Sbjct: 226 HPHIP 230 Score = 31.5 bits (68), Expect = 1.1 Identities = 20/65 (30%), Positives = 21/65 (32%), Gaps = 2/65 (3%) Frame = +3 Query: 786 LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXP-PXPXPXXPXXP-PP 959 LP +P P P PP P P PP P P P P PP Sbjct: 213 LPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIPP 272 Query: 960 XPPXP 974 PP P Sbjct: 273 APPNP 277 Score = 30.7 bits (66), Expect = 1.9 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 2/59 (3%) Frame = +3 Query: 807 LPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXP--XXPXXPPPXPPXPP 977 +PT PP P P PP P PP PP P P P P P PP Sbjct: 199 IPTAPPTPP-MPETPLPPGSPHIPP--APLHPHIPPAPPNPSKAIATPNPPMPETPLPP 254 Score = 30.3 bits (65), Expect = 2.5 Identities = 17/57 (29%), Positives = 17/57 (29%), Gaps = 2/57 (3%) Frame = +3 Query: 813 TXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXP--PPXPPXPP 977 T P PP P P P P P P P P P PP PP Sbjct: 151 TGTPEPTITSKPPVTETTTTKPETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPP 207 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +1 Query: 850 PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP P P P P P PP PP P PP Sbjct: 162 PPVTETTTTKPETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPP 204 Score = 30.3 bits (65), Expect = 2.5 Identities = 20/61 (32%), Positives = 21/61 (34%), Gaps = 5/61 (8%) Frame = +3 Query: 807 LPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXP--PPXPPXP-XPXXPXXP--PPXPPX 971 +P P P PP P P P PP PP P P P PP PP Sbjct: 261 IPPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPN 320 Query: 972 P 974 P Sbjct: 321 P 321 Score = 29.9 bits (64), Expect = 3.3 Identities = 22/70 (31%), Positives = 22/70 (31%), Gaps = 6/70 (8%) Frame = +2 Query: 776 EXLTTXXXTHSXNXPPPXP----XXPPPPPXXXXXXRPPPXXXXPXXXPPXXP--XPXPS 937 E TT T P P PP PP PP PP P P P Sbjct: 166 ETTTTKPETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPL 225 Query: 938 XPXXXPPXPP 967 P PP PP Sbjct: 226 HP-HIPPAPP 234 Score = 29.1 bits (62), Expect = 5.8 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 4/56 (7%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPP----PXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PP P P PP PP P PP P P P PP P Sbjct: 282 PPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPP 337 Score = 28.7 bits (61), Expect = 7.6 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 3/51 (5%) Frame = +1 Query: 832 PXPPPPPPXP-XPXAXP-PXGXXPXPXPP-XXPPXPPLXXXXXPPPPPPXP 975 P PP P P P A P P P PP P PP PP P P Sbjct: 218 PHIPPAPLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIPPASPNP 268 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 48.8 bits (111), Expect = 7e-06 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP 924 PP PPPPPP P P PP P P PP PP Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 46.4 bits (105), Expect = 4e-05 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PPPPPP P P PP P PP P PP+ P P P Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSP 729 Score = 46.0 bits (104), Expect = 5e-05 Identities = 25/64 (39%), Positives = 27/64 (42%) Frame = +3 Query: 786 LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXP 965 +P L +P PP PPPPP P PPP PP P P P PPP P Sbjct: 669 IPIQILPIPIQTMVPPPPPPPPP---------------PPPPPPPPPPQPSTP--PPPPP 711 Query: 966 PXPP 977 PP Sbjct: 712 STPP 715 Score = 44.8 bits (101), Expect = 1e-04 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P P PP P P PP PP PP PPPPP PP Sbjct: 667 PSIPIQILPIPIQTMVPPPPPPPPPPPPPPPPPPP-QPSTPPPPPPSTPP 715 Score = 37.9 bits (84), Expect = 0.012 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PPP P PPPPP PPP P P P P PS P P P Sbjct: 683 PPPPPPPPPPPPP------PPP----PPPQPSTPPPPPPSTPPVQQSGAPGSP 725 Score = 37.9 bits (84), Expect = 0.012 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = +1 Query: 817 PXXXPPXPPPP---PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP PPPP P P P + PP P P P PPPP Sbjct: 691 PPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSPSGTSAGNPQQQPPPP 744 Score = 35.9 bits (79), Expect = 0.050 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PP P PPPPP PPP P PP P S P P Sbjct: 683 PPPP--PPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSP 729 Score = 35.1 bits (77), Expect = 0.088 Identities = 22/53 (41%), Positives = 22/53 (41%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 P P PPPP PPP P PP P P PS P PP PP P Sbjct: 675 PIPIQTMVPPPP-------PPPPPPPP---PPPPPPPQPSTP---PPPPPSTP 714 Score = 34.3 bits (75), Expect = 0.15 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Frame = -3 Query: 977 GGXGGG---GGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GG GG GG G G G GG G GG GG G G Sbjct: 579 GGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTG 635 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GG GG G G G GG G GG GG G G Sbjct: 557 GSNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTG 609 Score = 32.7 bits (71), Expect = 0.47 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GG G GG GG G G G G GG GG G Sbjct: 562 GGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNG 614 Score = 32.7 bits (71), Expect = 0.47 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GG G GG GG G G G G GG GG G Sbjct: 588 GGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNG 640 Score = 32.3 bits (70), Expect = 0.62 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Frame = -3 Query: 968 GGGGGGXXXXXRGGX--GGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GG GG GG GG G G G GG GG G Sbjct: 571 GGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNG 623 Score = 31.9 bits (69), Expect = 0.82 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Frame = -3 Query: 977 GGXGGG---GGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GG GG G GG G G GG G G GG G G Sbjct: 562 GGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTG 618 Score = 31.9 bits (69), Expect = 0.82 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Frame = -3 Query: 977 GGXGGG---GGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GG GG G GG G G GG G G GG G G Sbjct: 588 GGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNSG 644 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 2/49 (4%) Frame = -3 Query: 968 GGGGGGXXXXXRGGX--GGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GG GG GG GG G G G GG GG Sbjct: 597 GGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNSGG 645 Score = 30.3 bits (65), Expect = 2.5 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 2/56 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGX--GGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GG GG GG G G GG G G GG GG G Sbjct: 476 GGNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNNG-GNNNGGNNNGGNNNG 530 Score = 30.3 bits (65), Expect = 2.5 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 2/56 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGG--GGGGXGGXXXG 816 GG GG G GG G G GG G GG GG GG G Sbjct: 548 GGSNNGGNDGSNNNGGNTGGNNNGGNTGGN-NGGNTGGNNNGGNTGGNNNGGNTGG 602 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 896 PXXXPPXXPXPXPSXPXXXPPXPPXXPXS 982 P PP P P P P P PP P S Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPPPS 712 Score = 29.5 bits (63), Expect = 4.4 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 2/56 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGX--GGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GG GG G GG G GG G G GG GG G Sbjct: 481 GGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNNGGNNNG-GNNNGGNNNGGNNNG 535 Score = 29.5 bits (63), Expect = 4.4 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GG G GG GG G G G GG GG G Sbjct: 545 GNNGGSNNGGNDGSNNN-GGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNG 597 Score = 29.5 bits (63), Expect = 4.4 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 2/49 (4%) Frame = -3 Query: 977 GGXGGG--GGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGG 837 GG GG GG GG G G GG G GG GG Sbjct: 597 GGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNSGG 645 Score = 29.1 bits (62), Expect = 5.8 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 3/54 (5%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGG---GGGGXGGXXXG 816 G GG G GG G GG G GG GG GG G Sbjct: 467 GNNNGGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNNGGNNNG 520 Score = 29.1 bits (62), Expect = 5.8 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGG--GGGGXGGXXXG 816 G GG G GG G GG G GG GG GG G Sbjct: 501 GENNGGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNGGSNNG 553 Score = 29.1 bits (62), Expect = 5.8 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 4/58 (6%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGG--XGGXXGGXGXGXXPXGGXAXGXGXGG--GGGGXGGXXXG 816 GG GG GG GG G G GG G GG G GG G Sbjct: 510 GGNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNGGSNNGGNDGSNNNGGNTGG 567 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 48.8 bits (111), Expect = 7e-06 Identities = 22/47 (46%), Positives = 22/47 (46%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PPPPPP PP G P PP PPL PPPPP PP Sbjct: 280 PPPPPPLTGGMLPPPFGG----HPAAAPPPPPLPAGVPAPPPPPPPP 322 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = +3 Query: 813 TXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 T P PPPPP PP PP PP P PPP PP Sbjct: 271 TNTQRPTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 Score = 37.1 bits (82), Expect = 0.022 Identities = 23/55 (41%), Positives = 24/55 (43%), Gaps = 9/55 (16%) Frame = +1 Query: 799 YSLXQXPXXXPPXPPP------PPPXPX-PXAXPPXGXXPX--PXPPXXPPXPPL 936 Y+ Q P PP PPP PPP P A PP P P PP PP P L Sbjct: 270 YTNTQRPTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPPML 324 Score = 29.9 bits (64), Expect = 3.3 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +2 Query: 788 TXXXTHSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXP 934 T T PPP PPP PP P P P P P Sbjct: 273 TQRPTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPP 321 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 48.4 bits (110), Expect = 9e-06 Identities = 18/33 (54%), Positives = 18/33 (54%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXP 930 P PPPPPP P P PP P P PP PP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 48.0 bits (109), Expect = 1e-05 Identities = 24/45 (53%), Positives = 24/45 (53%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PPPPP P P PP P P PP PP PP PPPPPP P Sbjct: 464 PPPPPPPPP---PP----PPPPPPPPPPPPPF-----PPPPPPTP 496 Score = 45.6 bits (103), Expect = 6e-05 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +3 Query: 876 PPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 PP P PPP PP P P P PPP PP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 45.2 bits (102), Expect = 8e-05 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = +3 Query: 900 PXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PPP PP P P P PPP PP PP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPP 490 Score = 45.2 bits (102), Expect = 8e-05 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = +3 Query: 900 PXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PPP PP P P P PPP PP PP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 43.2 bits (97), Expect = 3e-04 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = +1 Query: 886 GXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 G P P PP PP PP PPPPPP PPF Sbjct: 461 GQAPPPPPPPPPPPPP----PPPPPPPPPPPF 488 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +1 Query: 880 PXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P PP PP PP PPPPPP PP Sbjct: 464 PPPPPPPPPPPPPPPPPP------PPPPPPFPP 490 Score = 38.3 bits (85), Expect = 0.009 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPS 937 T PP P PPPPP PPP P PP P P P+ Sbjct: 457 TEGVGQAPPPPPPPPPPP-------PPPPPPPPPPPPPFPPPPPPT 495 Score = 36.3 bits (80), Expect = 0.038 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXP 929 P PP PPPPP PP P PPP PP P Sbjct: 464 PPPPPPPPPPPPPPP-------PPPPPPPPPFPPPPPPTP 496 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 48.4 bits (110), Expect = 9e-06 Identities = 26/53 (49%), Positives = 27/53 (50%), Gaps = 3/53 (5%) Frame = -3 Query: 977 GGXGGG---GGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 G GGG GGG +GG GG GG G G GG G G GGGG G GG Sbjct: 182 GSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGG-RGGGGYGGGHGGGGYGGGG 233 Score = 46.0 bits (104), Expect = 5e-05 Identities = 26/55 (47%), Positives = 26/55 (47%), Gaps = 2/55 (3%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGG--GGGXGGXXXG 816 G GG GG GG GG GG G G GG G G GGG GGG GG G Sbjct: 179 GGGGSQGGGYRSGGGGYGGSKGGYGGGS---GGGGYGGGRGGGGYGGGHGGGGYG 230 Score = 40.7 bits (91), Expect = 0.002 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GGG GG GG GG GG G G GG G G GGG G Sbjct: 200 GGYGGGSGG------GGYGGGRGGGGYGGGHGGGGYGGGGRHDYGGGSKG 243 Score = 39.1 bits (87), Expect = 0.005 Identities = 24/67 (35%), Positives = 25/67 (37%), Gaps = 3/67 (4%) Frame = -1 Query: 973 GXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGG---GGGXXGGXXXXVGRV 803 G G GG G G GG GG G GG GG GGG GG GR Sbjct: 176 GDSGGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRH 235 Query: 802 SXAXGSQ 782 GS+ Sbjct: 236 DYGGGSK 242 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGG 839 GG GG GG G G GG GGG G GG GGG Sbjct: 200 GGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGGGSKGGG 245 Score = 37.5 bits (83), Expect = 0.016 Identities = 26/65 (40%), Positives = 26/65 (40%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRV 803 G GG GG GG G G G GG GGG G G GGGG GG G Sbjct: 191 GGGGYGGSKGGYGG--GSGGGGYGGGRGGGGYGGGH--------GGGGYGGGGRHDYGGG 240 Query: 802 SXAXG 788 S G Sbjct: 241 SKGGG 245 Score = 33.1 bits (72), Expect = 0.35 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGX-GXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 GG GGG G G G G GGG G GG GGGG GG Sbjct: 186 GGYRSGGGGYGGSKGGYGGGSGGGGYG---GGRGGGGYGGGHGGGGYGGGG 233 Score = 32.7 bits (71), Expect = 0.47 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG G G G G G GGG GGG G GGG Sbjct: 176 GDSGGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGG 228 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 48.0 bits (109), Expect = 1e-05 Identities = 24/47 (51%), Positives = 24/47 (51%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGG 837 GG GGGG RGG GG GG G G GG G G GGG GG Sbjct: 94 GGYRSGGGGYGGSSRGGYGGGRGGGGYGGG-RGGGGYGGGRGGGYGG 139 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/55 (40%), Positives = 23/55 (41%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXW 810 G G GG R G GG GG G G G G G GGGG GG G + Sbjct: 84 GERGAGGSRAGGYRSGGGGY-GGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGY 137 Score = 38.3 bits (85), Expect = 0.009 Identities = 27/68 (39%), Positives = 27/68 (39%), Gaps = 3/68 (4%) Frame = -1 Query: 982 GXGGX--GGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGG-GGXXGGXXXXV 812 G GG GG G G G GG GGG G GG R GGG GG GG Sbjct: 87 GAGGSRAGGYRSGGGGYGGSSRGGYGGGRG--GGGYGGGRGGGGYGGGRGGGYGGGRRDY 144 Query: 811 GRVSXAXG 788 G S G Sbjct: 145 GGGSKGGG 152 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 48.0 bits (109), Expect = 1e-05 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGGGG G GG G G G GG G GGG G GG G Sbjct: 244 GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATG 297 Score = 48.0 bits (109), Expect = 1e-05 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGGGG G GG G G G GG G GGG G GG G Sbjct: 251 GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATG 304 Score = 48.0 bits (109), Expect = 1e-05 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGGGG G GG G G G GG G GGG G GG G Sbjct: 258 GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATG 311 Score = 48.0 bits (109), Expect = 1e-05 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGGGG G GG G G G GG G GGG G GG G Sbjct: 265 GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATG 318 Score = 48.0 bits (109), Expect = 1e-05 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGGGG G GG G G G GG G GGG G GG G Sbjct: 272 GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATG 325 Score = 46.8 bits (106), Expect = 3e-05 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGGGG G GG G G G GG G GGG G GG G Sbjct: 300 GGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATG 353 Score = 46.0 bits (104), Expect = 5e-05 Identities = 26/65 (40%), Positives = 26/65 (40%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRV 803 G GG G GGG G G GG GG G GG GGGGG GG G Sbjct: 242 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGG--GGGATGGGGGATGGGGGATGGG 299 Query: 802 SXAXG 788 A G Sbjct: 300 GGATG 304 Score = 46.0 bits (104), Expect = 5e-05 Identities = 27/58 (46%), Positives = 27/58 (46%), Gaps = 4/58 (6%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXG--GXGXGXXPXGGXAXGXGXG--GGGGGXGGXXXG 816 GG GGGGG G GG G G G G GG A G G G GGGGG G G Sbjct: 286 GGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGG 343 Score = 45.6 bits (103), Expect = 6e-05 Identities = 26/65 (40%), Positives = 26/65 (40%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRV 803 G GG G GGG G G GG GG G GG GGGGG GG G Sbjct: 256 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGG--GGGATGGGGGATGGGGGATGVG 313 Query: 802 SXAXG 788 A G Sbjct: 314 GGATG 318 Score = 44.8 bits (101), Expect = 1e-04 Identities = 24/58 (41%), Positives = 24/58 (41%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 G GG G GGG G G GG GG G GG GGGGG GG G Sbjct: 298 GGGGATGGGGGATGVGGGATGGGGGATGGGVGATGG--GGGATGGGGGVTGGGGGATG 353 Score = 44.8 bits (101), Expect = 1e-04 Identities = 24/51 (47%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXG--GXGXGXXPXGGXAXGXGXGGGGGGXG 831 GG GGGGG G GG G G G G GG A G G G G GG G Sbjct: 314 GGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGGPGSGGCG 364 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/68 (36%), Positives = 26/68 (38%), Gaps = 2/68 (2%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGG--GGXXGGXXXXVG 809 G GG G GGG G G GG GG G GG GGG GG G VG Sbjct: 270 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVG 329 Query: 808 RVSXAXGS 785 G+ Sbjct: 330 ATGGGGGA 337 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGGGG G G G G G GG G GGG G GG G Sbjct: 293 GGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTG 346 Score = 42.7 bits (96), Expect = 4e-04 Identities = 26/65 (40%), Positives = 26/65 (40%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRV 803 G G GG GGG G G GG GG G GG GGGGG GG G Sbjct: 250 GGGATGG-GGGATGGGGGATGGGGGATGGGGGATGG--GGGATGGGGGATGGGGGATGGG 306 Query: 802 SXAXG 788 A G Sbjct: 307 GGATG 311 Score = 42.3 bits (95), Expect = 6e-04 Identities = 25/65 (38%), Positives = 25/65 (38%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRV 803 G GG G GGG G G G GG G GG GGGGG GG G Sbjct: 291 GGGGATGGGGGATGGGGGATGVGGGATGGGGGATGG--GVGATGGGGGATGGGGGVTGGG 348 Query: 802 SXAXG 788 A G Sbjct: 349 GGATG 353 Score = 41.9 bits (94), Expect = 8e-04 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG G GGG G GG G G G GG G GGG G GG Sbjct: 307 GGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGG 356 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG G GGG G G GG G G GG GGGGG GG Sbjct: 305 GGGGATGVGGGATGGGGGATGGGVGATGGGGGATGG--GGGVTGGGGGATGG 354 Score = 39.5 bits (88), Expect = 0.004 Identities = 26/67 (38%), Positives = 26/67 (38%), Gaps = 2/67 (2%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXG--XGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 G G GG GG G G G GG GG G GG GGGGG GG G Sbjct: 278 GGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGG-----ATGGGGGATGGGVGATG 332 Query: 808 RVSXAXG 788 A G Sbjct: 333 GGGGATG 339 Score = 39.1 bits (87), Expect = 0.005 Identities = 23/64 (35%), Positives = 23/64 (35%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRVSX 797 GG G GGG G GG GG G GG GGG G G VS Sbjct: 314 GGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGGPGSGGCGEDGTENVSL 373 Query: 796 AXGS 785 GS Sbjct: 374 EFGS 377 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -3 Query: 935 RGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 R G GG GG G G GG A G G GG GG GG G Sbjct: 240 RLGGGGATGGGG-GATGGGGGATGGG-GGATGGGGGATGG 277 Score = 32.7 bits (71), Expect = 0.47 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -3 Query: 962 GGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG G G G G G GG G GGG G GG G Sbjct: 228 GGSRLSNDRSNGRLGGGGATGGGGGATGGGGGATGGGGGATGGGGGATG 276 Score = 32.3 bits (70), Expect = 0.62 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG G G G G G GG GG G GG GGG Sbjct: 269 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGG 321 Score = 31.9 bits (69), Expect = 0.82 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGG 842 G GG G GGG G G GG GGG G G G G Sbjct: 333 GGGGATGGGGGVTGGGGGATGG-GGGPGSGGCGEDGTENVSLEFGSG 378 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 47.2 bits (107), Expect = 2e-05 Identities = 21/58 (36%), Positives = 21/58 (36%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 H N PPP P PP P PPP P P P P PP PP P Sbjct: 1230 HMMNMPPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPP 1287 Score = 41.5 bits (93), Expect = 0.001 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Frame = +1 Query: 829 PPXPPPPPPXPXPX--AXPPXGXXPXPXPPXXPPXPPLXXXXXP-PPPPPXPP 978 PP PP PP P PP P PP P PP P PP PP PP Sbjct: 1235 PPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPP 1287 Score = 38.3 bits (85), Expect = 0.009 Identities = 22/65 (33%), Positives = 25/65 (38%), Gaps = 5/65 (7%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPP-----PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP 960 + ++ P PP PP PPP P PP P P PP PP P P Sbjct: 1231 MMNMPPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPP----GPPGP 1286 Query: 961 PPPXP 975 P P P Sbjct: 1287 PGPQP 1291 Score = 37.5 bits (83), Expect = 0.016 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 3/66 (4%) Frame = +2 Query: 788 TXXXTHSXNXPPPXPXXP---PPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP 958 T THS PPP PPPP PP P PP P P P PP Sbjct: 1214 TNTMTHSAPRPPPMGHHMMNMPPPPPAMPPDGPPKFMGLPP--PPPGMRPMPPQPPFMPP 1271 Query: 959 XPPXXP 976 P P Sbjct: 1272 PPRMQP 1277 Score = 33.1 bits (72), Expect = 0.35 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXP 955 PP PPPPP PP P P P P P P Sbjct: 1246 PPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGPQP 1291 Score = 33.1 bits (72), Expect = 0.35 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPS 937 PPP P P PP PP PP P P PS Sbjct: 1253 PPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGPQPS 1292 Score = 30.3 bits (65), Expect = 2.5 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 2/54 (3%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXX--RPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PP PPP RPPP PP P P P PP P Sbjct: 1204 PPTTAIPPPMTNTMTHSAPRPPPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPP 1257 Score = 28.7 bits (61), Expect = 7.6 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 1/47 (2%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXP-PPPPPXPP 978 PPP PP P PP PP P PP PP P Sbjct: 1224 PPPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMP 1270 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 46.8 bits (106), Expect = 3e-05 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG G GGG GG GG G G GG G G GGG G GG G Sbjct: 145 GGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGGDGRG 198 Score = 45.2 bits (102), Expect = 8e-05 Identities = 26/63 (41%), Positives = 27/63 (42%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXWXSEX 798 GG G GGG RGG GG GG G GG G G G GGG G G +E Sbjct: 151 GGRGRGGGEGGWGGRGGNGGGRGGGEGG----GGRGRGTGGGSRGGGGDGRGRGRGGTEE 206 Query: 797 SXR 789 R Sbjct: 207 RTR 209 Score = 43.6 bits (98), Expect = 3e-04 Identities = 25/54 (46%), Positives = 25/54 (46%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG G G GG RGG G GG G G GG G G G GGGG G G Sbjct: 137 GGEGNGAGGGIG--RGGGRGRGGGEG-GWGGRGGNGGGRGGGEGGGGRGRGTGG 187 Score = 41.5 bits (93), Expect = 0.001 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 G G GG RGG G GG G G G G G GGG GG GG Sbjct: 115 GMEGWRRGGVQRGGRGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGG 164 Score = 41.1 bits (92), Expect = 0.001 Identities = 25/56 (44%), Positives = 25/56 (44%), Gaps = 2/56 (3%) Frame = -3 Query: 977 GGXGG--GGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GG G GG GG G GG G G GG G GG GGG GG G Sbjct: 127 GGRGGWRGRGGGEGNGAGGGIGRGGGRGRG----GGEGGWGGRGGNGGGRGGGEGG 178 Score = 40.7 bits (91), Expect = 0.002 Identities = 23/55 (41%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXG-GXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG G GGG GG G G G G G GG G GGG G GG G Sbjct: 130 GGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRG 184 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXG 830 G GG G GGG G G G G G G G G GGGG G Sbjct: 148 GRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGGDGRG 198 Score = 38.7 bits (86), Expect = 0.007 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXG-GXRXXXXXGGGGGXXGG 827 G GG G GGG G G G GGG G G G R G GGG GG Sbjct: 128 GRGGWRGRGGGEGNGAGGGI-GRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGG 179 Score = 37.9 bits (84), Expect = 0.012 Identities = 23/60 (38%), Positives = 23/60 (38%), Gaps = 1/60 (1%) Frame = -1 Query: 982 GXGGXGGXGGG-XXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGR 806 G GG G GGG G G GG GG G GG GGG GG GR Sbjct: 142 GAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGGDGRGRGR 201 Score = 35.1 bits (77), Expect = 0.088 Identities = 25/66 (37%), Positives = 25/66 (37%), Gaps = 7/66 (10%) Frame = -1 Query: 982 GXGGXG--GXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGG-----GGGXXGGX 824 G GG G GGG G G GG GG G GG GG GGG GG Sbjct: 134 GRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGG 193 Query: 823 XXXVGR 806 GR Sbjct: 194 GDGRGR 199 Score = 34.7 bits (76), Expect = 0.12 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG G G G G G G G GG G GGG G G G Sbjct: 134 GRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTG 186 Score = 33.5 bits (73), Expect = 0.27 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 3/53 (5%) Frame = -2 Query: 966 GGXGGXXXGXEGXGXGXXGGXXXGXXXX-GGGRXXXXXXGGGGGXX--GXGGG 817 GG GG G G G GG G GGG GG GG G GGG Sbjct: 127 GGRGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGG 179 Score = 31.5 bits (68), Expect = 1.1 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXG-GGRXXXXXXGGGGGXXGXGGG 817 G G GG G G G GG G G GGR GGG G GGG Sbjct: 130 GGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGN---GGGRGGGEGGGG 180 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGG 839 G G GG GGG G G GGG G G G G G Sbjct: 169 GGGRGGGEGGGGRGRGTGGGSRGGGGDGRGRGRGGTEERTRIEGYGSG 216 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 46.8 bits (106), Expect = 3e-05 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGG-GGXGGXXXG 816 GG GGGGG G GG G G G GG G GGG GG GG G Sbjct: 66 GGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGG 120 Score = 46.0 bits (104), Expect = 5e-05 Identities = 27/58 (46%), Positives = 27/58 (46%), Gaps = 4/58 (6%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXG--GXGXGXXPXGGXAXGXGXG--GGGGGXGGXXXG 816 GG GGGGG G GG G G G G GG A G G G GGGGG G G Sbjct: 59 GGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGG 116 Score = 45.2 bits (102), Expect = 8e-05 Identities = 23/52 (44%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXG--XGGGGGGXGG 828 G GGGGG GG GG GG G GG G G G GGG GG Sbjct: 48 GATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGG 99 Score = 45.2 bits (102), Expect = 8e-05 Identities = 26/65 (40%), Positives = 26/65 (40%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRV 803 G GG G GGG G G GG GG G GG GGGGG GG G Sbjct: 64 GGGGATGGGGGATGGHGGATGGGGGATGDGGGATGG--GGGATGGGGGATGGHGGATGGG 121 Query: 802 SXAXG 788 A G Sbjct: 122 VGATG 126 Score = 43.6 bits (98), Expect = 3e-04 Identities = 23/55 (41%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXG-XGXGGGGGGXGGXXXG 816 GG GGGGG G GG G G G GG G GG GG GG G Sbjct: 94 GGATGGGGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGG 148 Score = 43.2 bits (97), Expect = 3e-04 Identities = 25/54 (46%), Positives = 25/54 (46%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGGG GG GG GG G G GG A G G G GGG G G Sbjct: 58 GGGATGGGG---GATGGGGGATGGHG-GATGGGGGATGDGGGATGGGGGATGGG 107 Score = 43.2 bits (97), Expect = 3e-04 Identities = 24/52 (46%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXG--XGGGGGGXGG 828 GG GG GG GG GG GG G GG G G GGGGG GG Sbjct: 112 GGHGGATGGGVGAT-GGHGGATGGHGGATGGHGGATGGGGGATGGGGGATGG 162 Score = 42.7 bits (96), Expect = 4e-04 Identities = 25/65 (38%), Positives = 25/65 (38%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRV 803 G GG G GGG G G GG GG G GG GG GG GG G Sbjct: 85 GGGGATGDGGGATGGGGGATGGGGGATGGHGGATGG--GVGATGGHGGATGGHGGATGGH 142 Query: 802 SXAXG 788 A G Sbjct: 143 GGATG 147 Score = 42.3 bits (95), Expect = 6e-04 Identities = 24/61 (39%), Positives = 25/61 (40%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRV 803 G GG G G G G G GG GG G GG GGGGG GG G V Sbjct: 113 GHGGATGGGVGATGGHGGATGGHGGATGGHGGATGG--GGGATGGGGGATGGGGGATGGV 170 Query: 802 S 800 + Sbjct: 171 T 171 Score = 41.5 bits (93), Expect = 0.001 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGGGG G GG G G GG G GG G GG G Sbjct: 101 GGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGATG 154 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGG G G GG G G GG G GGG G GG G Sbjct: 115 GGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGGGGGATGGGGGATG 168 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/53 (41%), Positives = 22/53 (41%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GGG G GG GG GG G GG G GG GG GG G Sbjct: 91 GDGGGATGGGGGATGGGGGATGGHGGATG--GGVGATGGHGGATGGHGGATGG 141 Score = 40.3 bits (90), Expect = 0.002 Identities = 24/57 (42%), Positives = 24/57 (42%), Gaps = 3/57 (5%) Frame = -3 Query: 977 GGXGGGGG--GXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXG-GGGGGXGGXXXG 816 G GGGGG G GG G GG G GG G G GGGGG G G Sbjct: 102 GATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGGGGG 158 Score = 39.9 bits (89), Expect = 0.003 Identities = 26/69 (37%), Positives = 26/69 (37%), Gaps = 4/69 (5%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXG--GGXGXXXXXXGGXR--XXXXXGGGGGXXGGXXXX 815 G G GG GG G G GG G GG G GG GGGGG GG Sbjct: 100 GGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGGGGGA 159 Query: 814 VGRVSXAXG 788 G A G Sbjct: 160 TGGGGGATG 168 Score = 39.5 bits (88), Expect = 0.004 Identities = 25/65 (38%), Positives = 25/65 (38%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRV 803 G G GG GGG G G GG GG G GG GG GG GG G Sbjct: 93 GGGATGG-GGGATGGGGGATGGHGGATGGGVGATGG--HGGATGGHGGATGGHGGATGGG 149 Query: 802 SXAXG 788 A G Sbjct: 150 GGATG 154 Score = 39.1 bits (87), Expect = 0.005 Identities = 25/64 (39%), Positives = 25/64 (39%), Gaps = 1/64 (1%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXG-XGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRVS 800 GG GG GG G G G GG GG G GG GGGGG G G Sbjct: 44 GGHGGATGGGGGATGGGATGGGGGATGGGGGATGG--HGGATGGGGGATGDGGGATGGGG 101 Query: 799 XAXG 788 A G Sbjct: 102 GATG 105 Score = 39.1 bits (87), Expect = 0.005 Identities = 24/65 (36%), Positives = 24/65 (36%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRV 803 G GG G GGG G G GG G G GG GG GG GG G Sbjct: 99 GGGGATGGGGGATGGHGGATGGGVGATGGHGGATGG--HGGATGGHGGATGGGGGATGGG 156 Query: 802 SXAXG 788 A G Sbjct: 157 GGATG 161 Score = 38.7 bits (86), Expect = 0.007 Identities = 24/56 (42%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGX-GXG-GGGGGXGGXXXG 816 GG GG GG G GG G G G GG A G G GGGGG G G Sbjct: 40 GGATGGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGG 95 Score = 38.3 bits (85), Expect = 0.009 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = -3 Query: 962 GGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GG G GG G G G GG A G G GG GG GG G Sbjct: 38 GHGGATGGHGGATGGGGGATGGGATGGGGGATGGG-GGATGGHGGATGG 85 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/58 (39%), Positives = 23/58 (39%), Gaps = 4/58 (6%) Frame = -3 Query: 977 GGXGGG---GGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXG-GGGGGXGGXXXG 816 GG GG GGG G GG G G G GG G G G GG GG G Sbjct: 77 GGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVGATGGHGGATGG 134 Score = 37.1 bits (82), Expect = 0.022 Identities = 24/65 (36%), Positives = 24/65 (36%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRV 803 G GG GGG G G GG GG G GG G GGG GG G Sbjct: 51 GGGGGA-TGGGATGGGGGATGGGGGATGGHGGATGG--GGGATGDGGGATGGGGGATGGG 107 Query: 802 SXAXG 788 A G Sbjct: 108 GGATG 112 Score = 37.1 bits (82), Expect = 0.022 Identities = 25/69 (36%), Positives = 25/69 (36%), Gaps = 4/69 (5%) Frame = -1 Query: 982 GXGGXGGXG---GGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGG-GXXGGXXXX 815 G G GG G GG G G G G GGG G G GGG G GG Sbjct: 72 GGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVGATGGHGGA 131 Query: 814 VGRVSXAXG 788 G A G Sbjct: 132 TGGHGGATG 140 Score = 36.3 bits (80), Expect = 0.038 Identities = 24/63 (38%), Positives = 24/63 (38%), Gaps = 1/63 (1%) Frame = -1 Query: 973 GXGGXGGGXXGXXGXGXGGXGGG-XGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRVSX 797 G GG GG G G G G GGG G GG GG GG GG G Sbjct: 38 GHGGATGGHGGATGGGGGATGGGATGGGGGATGG--GGGATGGHGGATGGGGGATGDGGG 95 Query: 796 AXG 788 A G Sbjct: 96 ATG 98 Score = 32.3 bits (70), Expect = 0.62 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G G GG G G G GG G GGG GGGGG G GG Sbjct: 34 GVVVGHGGAT-GGHGGATGGGGGATGGGATGGGG----GATGGGGGATGGHGG 81 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 46.8 bits (106), Expect = 3e-05 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GGGG RGG GG GG G G GG G G GGG G Sbjct: 190 GGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGGSKG 239 Score = 42.7 bits (96), Expect = 4e-04 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG G GGG G G GG G G GG G G GGGGG GG Sbjct: 183 GGGGSQGGGYRSGGGGYGGSSRGGYGGGR---GGGGYGGGRGGGGGYGGG 229 Score = 36.7 bits (81), Expect = 0.029 Identities = 19/41 (46%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -3 Query: 935 RGGXGGXXGGXGXGXXPXGGXA-XGXGXGGGGGGXGGXXXG 816 RGG G GG G GG + G G G GGGG GG G Sbjct: 182 RGGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGG 222 Score = 35.5 bits (78), Expect = 0.066 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -1 Query: 973 GXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG GG G G G G GGG G GG GGG GG Sbjct: 195 GGGGYGGSSRG--GYGGGRGGGGYGGGRGGGGGYGGGRRDYGGGSKGGG 241 Score = 33.9 bits (74), Expect = 0.20 Identities = 26/67 (38%), Positives = 26/67 (38%), Gaps = 2/67 (2%) Frame = -1 Query: 982 GXGGXGGXG--GGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 G GG G G G G G GG GGG G GG R GGGG GG G Sbjct: 183 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGY--GGGR------GGGGGYGGGRRDYG 234 Query: 808 RVSXAXG 788 S G Sbjct: 235 GGSKGGG 241 Score = 31.9 bits (69), Expect = 0.82 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Frame = -2 Query: 981 EXGXXGGXGGXXX-GXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 E G G GG G G G GG G G G G GGG GGG Sbjct: 181 ERGGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGG 236 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 46.8 bits (106), Expect = 3e-05 Identities = 25/59 (42%), Positives = 25/59 (42%), Gaps = 3/59 (5%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGG---GGGXGGXXXGXW 810 GG G G GG GG G G G G P GG G G G G GGG G G W Sbjct: 6 GGWGRGSGGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGW 64 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/50 (42%), Positives = 22/50 (44%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG G G GG +GG G G G G GG G G G G G GG Sbjct: 38 GGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGGMGRGPGGGLGRGPGGG 87 Score = 34.7 bits (76), Expect = 0.12 Identities = 20/49 (40%), Positives = 21/49 (42%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 GG G G GG +GG G G G G P GG GG G G G Sbjct: 54 GGMGRGPGGGWGRMQGGGMGRGPGGGLGRGPGGGWGR-MQEGGMGRGPG 101 Score = 31.1 bits (67), Expect = 1.4 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = -1 Query: 976 GGXG-GXGGGXXGXXGXGXG-GXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 GG G G GGG G G G G GGG G GG GG G GG Sbjct: 22 GGWGRGQGGGMGRGPGGGWGRGSGGGWG---RMQGGGMGRGPGGGWGRMQGG 70 Score = 29.9 bits (64), Expect = 3.3 Identities = 31/108 (28%), Positives = 34/108 (31%), Gaps = 4/108 (3%) Frame = -1 Query: 973 GXGGXGG-GXXGXXGXGXG---GXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGR 806 G GG G G G G G G G G G G GG G G G GG G Sbjct: 11 GSGGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGG 70 Query: 805 VSXAXGSQXFXQXD*SNDXNRQELGIVSGGGQRTWSLLQLSRSHWSCG 662 + QE G+ G GQ W + W CG Sbjct: 71 GMGRGPGGGLGRGPGGGWGRMQEGGMGRGPGQ-GWGCRGMG-CGWGCG 116 Score = 29.9 bits (64), Expect = 3.3 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 4/57 (7%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGG-GRXXXXXXG---GGGGXXGXGGG 817 G G GG G G G G G GG GR G GGG G GGG Sbjct: 23 GWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGGMGRGPGGG 79 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 46.8 bits (106), Expect = 3e-05 Identities = 25/61 (40%), Positives = 25/61 (40%), Gaps = 7/61 (11%) Frame = +1 Query: 817 PXXXPPXPPPP-------PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P PPPP PP P P A P P P P PP PPPPPP P Sbjct: 146 PATGGPPPPPPIAPATGGPPPPPPIA--PAATVPAPAVPLAAASPPPPSGGPPPPPPPPP 203 Query: 976 P 978 P Sbjct: 204 P 204 Score = 46.0 bits (104), Expect = 5e-05 Identities = 22/50 (44%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPL-XXXXXPPPPPPXPP 978 P PPPPP P A PP P PP PP+ PPPPPP P Sbjct: 124 PSPPPPPTSPATRAPPPPPPI-APATGGPPPPPPIAPATGGPPPPPPIAP 172 Score = 45.2 bits (102), Expect = 8e-05 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PP P P P P P PP PP PPPPPP PP Sbjct: 165 PPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPP-----PPPPPPPPPP 209 Score = 43.6 bits (98), Expect = 3e-04 Identities = 21/52 (40%), Positives = 23/52 (44%), Gaps = 3/52 (5%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXX--PPXPPLXXXXX-PPPPPPXPP 978 P PPPPP P + P P P PP PP+ PPPPPP P Sbjct: 108 PTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAP 159 Score = 43.6 bits (98), Expect = 3e-04 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 2/52 (3%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPX--GXXPXPXPPXXPPXPPLXXXXXPPPPP 966 P P P P P A PP G P P PP PP PP PPPP Sbjct: 168 PPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 42.7 bits (96), Expect = 4e-04 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PPPPP P P PP P P PPP PP PP Sbjct: 164 PPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPP 209 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPP-PXPPXPXPXXPXXPPPXPPXPP 977 PPPPP R PP P P PP P PPP PP P Sbjct: 126 PPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAP 172 Score = 36.7 bits (81), Expect = 0.029 Identities = 26/94 (27%), Positives = 29/94 (30%), Gaps = 7/94 (7%) Frame = +3 Query: 714 PPPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXXPP-------PPPXXXXXR 872 PPP T P++ R P + PP PP P P Sbjct: 127 PPPPTSPAT-RAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAA 185 Query: 873 XPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P P PPP PP P P P PP P Sbjct: 186 ASPPPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 35.9 bits (79), Expect = 0.050 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PPP P P P PPP P P P P PP PP P Sbjct: 110 PPPPPRAPETPSQAPS---PPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAP 159 Score = 35.5 bits (78), Expect = 0.066 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 PP P P PP PPP P P P PPP P Sbjct: 113 PPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAP 159 Score = 35.5 bits (78), Expect = 0.066 Identities = 26/72 (36%), Positives = 26/72 (36%), Gaps = 18/72 (25%) Frame = +1 Query: 817 PXXXPPXPPPPPPXP------XPXAXPPXG---XXPXPXPPXXP------PXPPLXXXXX 951 P P PPPP P P PP P P PP P P PL Sbjct: 129 PPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASP 188 Query: 952 PPP---PPPXPP 978 PPP PPP PP Sbjct: 189 PPPSGGPPPPPP 200 Score = 34.3 bits (75), Expect = 0.15 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 7/57 (12%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP-------PPXPP 978 PP P P P P P PP P P PPPP PP PP Sbjct: 86 PPLVPAGVEAPTPTPMVAQSVAPTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPP 142 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 4/59 (6%) Frame = +2 Query: 818 PPPXPXXP----PPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXPXS 982 PPP P P P P PPP P PP P P P P P P S Sbjct: 165 PPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPP--PPPPPPPPPILELAAPPPPGS 221 Score = 33.1 bits (72), Expect = 0.35 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXG 888 P PP PPPPPP A PP G Sbjct: 197 PPPPPPPPPPPPPILELAAPPPPG 220 Score = 31.5 bits (68), Expect = 1.1 Identities = 23/81 (28%), Positives = 23/81 (28%), Gaps = 18/81 (22%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXP---------------- 920 P T P PP P P PP PPP P Sbjct: 126 PPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAA 185 Query: 921 --PXPXPXXPXXPPPXPPXPP 977 P P P PPP PP PP Sbjct: 186 ASPPPPSGGPPPPPPPPPPPP 206 Score = 30.3 bits (65), Expect = 2.5 Identities = 16/55 (29%), Positives = 16/55 (29%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 PT PP P P P P PP P P P PP P Sbjct: 76 PTPQTQASTAPPLVPAGVEAPTPTPMVAQSVAPTPPPPPRAPETPSQAPSPPPPP 130 Score = 29.9 bits (64), Expect = 3.3 Identities = 18/59 (30%), Positives = 19/59 (32%), Gaps = 2/59 (3%) Frame = +3 Query: 807 LPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXP--XXPPPXPPXPP 977 +P P P PP P P PP P P P PPP PP P Sbjct: 89 VPAGVEAPTPTPMVAQSVAPTPPPPPRAPETPSQAPSPP-PPPTSPATRAPPPPPPIAP 146 Score = 29.1 bits (62), Expect = 5.8 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 7/61 (11%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPX-------PPXXPPXPPLXXXXXPPPPPPXP 975 P P P P P P P P PP P PPPPPP Sbjct: 86 PPLVPAGVEAPTPTPMVAQSVAPTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIA 145 Query: 976 P 978 P Sbjct: 146 P 146 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 46.4 bits (105), Expect = 4e-05 Identities = 20/35 (57%), Positives = 20/35 (57%) Frame = -3 Query: 932 GGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GG GG G G GG G G GGGGGG GG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 46.0 bits (104), Expect = 5e-05 Identities = 26/49 (53%), Positives = 26/49 (53%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 GG GGGGGG GG GG GG G GG G G GGGGGG G Sbjct: 132 GGGGGGGGG------GGGGGGGGGGG------GGGGGGGGGGGGGGGDG 168 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGG 875 GG GG GGG G G G GG GGG G GG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGG 875 GG GG GGG G G G GG GGG G GG Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXG 899 G GG GG GGG G G G GG GGG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 159 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXG 899 G GG GG GGG G G G GG GGG G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 160 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXG 899 G GG GG GGG G G G GG GGG G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 161 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXG 899 G GG GG GGG G G G GG GGG G Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 162 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXG 899 G GG GG GGG G G G GG GGG G Sbjct: 136 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 163 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXG 899 G GG GG GGG G G G GG GGG G Sbjct: 137 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 164 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXG 899 G GG GG GGG G G G GG GGG G Sbjct: 138 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXG 899 G GG GG GGG G G G GG GGG G Sbjct: 139 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXG 899 G GG GG GGG G G G GG GGG G Sbjct: 141 GGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 37.9 bits (84), Expect = 0.012 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGG 876 GG GGGGGG GG GG GG G G G Sbjct: 141 GGGGGGGGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 Score = 34.7 bits (76), Expect = 0.12 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -2 Query: 936 EGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXG 823 +G G G GG G GGG GGGGG G G Sbjct: 131 DGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -2 Query: 942 GXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G G G G GG G GGG GGGGG G G G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGG-------GGGGGGGGGGDG 168 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 46.4 bits (105), Expect = 4e-05 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GGGGG G G G G GG G G GGGG G GG Sbjct: 37 GGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGG 86 Score = 44.8 bits (101), Expect = 1e-04 Identities = 26/55 (47%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXG-GXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG G G GG GG GG G G G G GG G G GGGG G GG G Sbjct: 28 GGVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDG-GNGGGGAGNGGGGGG 81 Score = 44.0 bits (99), Expect = 2e-04 Identities = 25/52 (48%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGG--GGGGXGG 828 GG G GGG GG G GG G G G A G G GG GGGG GG Sbjct: 56 GGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAG-AAGAGAGGNVGGGGSGG 106 Score = 43.6 bits (98), Expect = 3e-04 Identities = 23/49 (46%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGX-GXGGGGGGXG 831 G GG GGG G G GG G G GG G G GGGGGG G Sbjct: 35 GGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAG 83 Score = 43.6 bits (98), Expect = 3e-04 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 3/57 (5%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXG---GXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG G GGG GG G G GG G G GG G G GG G G G Sbjct: 41 GGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGG 97 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/53 (43%), Positives = 23/53 (43%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GGGG G GG G G G G GG G G GG G G GG G Sbjct: 33 GVGGGGVGGGGGNGGGAGNGVGAGGCGCG--GGNDGGNGGGGAGNGGGGGGAG 83 Score = 41.5 bits (93), Expect = 0.001 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 G GG GGG GG G GG G G G GG GG GG Sbjct: 63 GNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGGNGG 112 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/55 (38%), Positives = 21/55 (38%) Frame = -1 Query: 973 GXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 G GG G G G G GG G G G GG G GG GG VG Sbjct: 54 GAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVG 108 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G G GGG G G G GG G G G GG GGG G GG Sbjct: 28 GGVGVGVGGGGVGGGGGNG-GGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGG 78 Score = 40.7 bits (91), Expect = 0.002 Identities = 23/65 (35%), Positives = 23/65 (35%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRV 803 G GG GG GGG G G G GG G GG GGGG G G Sbjct: 33 GVGG-GGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAA 91 Query: 802 SXAXG 788 G Sbjct: 92 GAGAG 96 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 2/51 (3%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXG--XXPXGGXAXGXGXGGGGGGXGG 828 G GGG G G GG GG G G G A G GGG GG GG Sbjct: 59 GCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGG 109 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXG-GXAXGXGXGGGGGGXGGXXXG 816 G G GG G GG GG G G G G G A G G GG GG G Sbjct: 52 GVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSG 105 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG G GG G G G GG G G G G GGG G GG Sbjct: 59 GCGG-GNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGG 109 Score = 36.7 bits (81), Expect = 0.029 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G G G G G G GG GGG GG G G GG Sbjct: 46 GGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGG 97 Score = 36.7 bits (81), Expect = 0.029 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGG 840 GG G G GG G G G G GG + G G GG G Sbjct: 69 GGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGGNGGSG 114 Score = 35.9 bits (79), Expect = 0.050 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGG 820 G GG GG G G G G G G G G GG GG G GG Sbjct: 63 GNDGGNGGGGAGNGGGGGGAGNGGAAG--AAGAGAGGNVGGGGSGGVGGNGG 112 Score = 33.1 bits (72), Expect = 0.35 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGG 839 G GG G GG G G G G G GG GG G Sbjct: 67 GNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGGNGGSG 114 Score = 30.3 bits (65), Expect = 2.5 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXG--GGGGXXGXGGG 817 G G G G G G GG G GGG G G G GGG Sbjct: 48 GAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGG 102 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 46.4 bits (105), Expect = 4e-05 Identities = 24/62 (38%), Positives = 25/62 (40%), Gaps = 8/62 (12%) Frame = +1 Query: 817 PXXXPPXPPPPPPX-------PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP-PPX 972 P PP PPPPPP P P P PP PP+ PPPP PP Sbjct: 916 PEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPATQVPPPPLPPL 975 Query: 973 PP 978 PP Sbjct: 976 PP 977 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 PPPP P P P P PP PP PP+ P PP Sbjct: 951 PPPPTSALPPPIPATQVPPPPLPPLPPPPPPVQTTTAPTLPP 992 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PP P P P PP P P PP PP PP+ P P Sbjct: 894 PPTTPTTPKPTTPAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTP 940 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 876 PPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP P PP P P P PPP PP PP Sbjct: 894 PPTTPTTPKPTTPAPPPPLPLAPEPPPPLPPPPP 927 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 9/66 (13%) Frame = +3 Query: 807 LPTXXXXPPXXPPPPPXXXXXRX--PPXXXXXXPXPPPXPPXP-------XPXXPXXPPP 959 LP PP PPPPP R P P PP P P PPP Sbjct: 912 LPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPATQVPPPP 971 Query: 960 XPPXPP 977 PP PP Sbjct: 972 LPPLPP 977 Score = 38.3 bits (85), Expect = 0.009 Identities = 21/58 (36%), Positives = 21/58 (36%) Frame = +3 Query: 804 TLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 T PT PPPP PP P PPP PP P P P P PP Sbjct: 938 TTPTTQASTTRPTPPPPTSALP--PPIPATQVP-PPPLPPLPPPPPPVQTTTAPTLPP 992 Score = 36.7 bits (81), Expect = 0.029 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 871 AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 A P P P P PP PL PP PPP PP Sbjct: 893 APPTTPTTPKPTTPAPPPPLPLAPEPPPPLPPPPPP 928 Score = 35.1 bits (77), Expect = 0.088 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 4/51 (7%) Frame = +1 Query: 829 PPXPPPPPPXP-XPXAXPPXGXXPXPXP---PXXPPXPPLXXXXXPPPPPP 969 P P PPPP P P PP P P P P P P PPP Sbjct: 903 PTTPAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPP 953 Score = 33.9 bits (74), Expect = 0.20 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +2 Query: 785 TTXXXTHSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXP 943 TT T PPP PPP P PPP P PP P+ P Sbjct: 941 TTQASTTRPTPPPPTSALPPPIPATQVP--PPPLPPLPPPPPPVQTTTAPTLP 991 Score = 33.5 bits (73), Expect = 0.27 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 859 PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP-PPXPP 978 P PP P P P PPL PPPP PP PP Sbjct: 888 PKTTTAPPT-TPTTPKPTTPAPPPPLPLAPEPPPPLPPPPP 927 Score = 32.3 bits (70), Expect = 0.62 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 844 PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 P PP P PP P PP PP PP PPPP Sbjct: 949 PTPPPPTSALPPPIPATQVPPPPL-PPLPP------PPPP 981 Score = 29.1 bits (62), Expect = 5.8 Identities = 16/53 (30%), Positives = 16/53 (30%), Gaps = 1/53 (1%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPP-PXPPXPXPXXPXXPPPXP 965 P PP P P PP P PP P PP P P P Sbjct: 888 PKTTTAPPTTPTTPKPTTPAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTP 940 Score = 28.7 bits (61), Expect = 7.6 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXP 953 P PT P P PP PP P PPP PP P P P Sbjct: 888 PKTTTAPPTTPTTPKPTTPAPP-------PPLPLAPEP-PPPLPPPPPPIQTTRP 934 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 46.0 bits (104), Expect = 5e-05 Identities = 24/54 (44%), Positives = 24/54 (44%), Gaps = 7/54 (12%) Frame = +1 Query: 829 PPXPPPP-----PPXPXPXAXPPX--GXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PP PPP PP P A PP G P P PP PP PPPPPP Sbjct: 326 PPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPP 379 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXX--PPXPPLXXXXXPPPPPP 969 PPPPP PP P P P PP PP PPPPPP Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPP 331 Score = 44.8 bits (101), Expect = 1e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PPPPP PP P PP PP PPPPPP P Sbjct: 326 PPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPP 370 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PPPPPP P PP P PP PP PPP P P Sbjct: 363 PPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGPMIP 410 Score = 41.9 bits (94), Expect = 8e-04 Identities = 27/68 (39%), Positives = 27/68 (39%), Gaps = 14/68 (20%) Frame = +1 Query: 817 PXXXPPXPPPP----PPXPXPXAXPP--XGXXPXPXPP---XXPPXPPLXXXXXPP---- 957 P PPPP PP P PP G P P PP PP PP PP Sbjct: 331 PSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLG 390 Query: 958 -PPPPXPP 978 PPPP PP Sbjct: 391 NPPPPPPP 398 Score = 41.9 bits (94), Expect = 8e-04 Identities = 20/62 (32%), Positives = 21/62 (33%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P + P P PPPPP PP P PP P P PPP P Sbjct: 349 PSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGPM 408 Query: 969 XP 974 P Sbjct: 409 IP 410 Score = 41.5 bits (93), Expect = 0.001 Identities = 22/56 (39%), Positives = 23/56 (41%) Frame = +1 Query: 802 SLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 S+ P PPPPP P P PP P PP PP PPPPPP Sbjct: 350 SMGMAPPPVGGAAPPPPPPP-PVGGPP------PPPPPIEGRPPSSLGNPPPPPPP 398 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/62 (33%), Positives = 23/62 (37%), Gaps = 7/62 (11%) Frame = +3 Query: 810 PTXXXXPP-------XXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P+ PP PPPPP + PP P PP P P PPP PP Sbjct: 309 PSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPP 368 Query: 969 XP 974 P Sbjct: 369 PP 370 Score = 39.5 bits (88), Expect = 0.004 Identities = 24/62 (38%), Positives = 24/62 (38%), Gaps = 12/62 (19%) Frame = +1 Query: 829 PPXP-----PPPPPXPXPXAXPPXGXXPXPXPPXX----PPXPPLXXXXXPPPP---PPX 972 PP P PPPP P P G P P P PP PP PPPP P Sbjct: 288 PPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPP 347 Query: 973 PP 978 PP Sbjct: 348 PP 349 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PPPPP P G P P P PP PPPPP Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPP 330 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPP--XXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PPP PPPPP PPP P PP P P P PP Sbjct: 298 PPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPP 349 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PP PP P PPP PP P P PPP PP Sbjct: 339 PPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGP--PPPPPPIEGRPP 386 Score = 38.3 bits (85), Expect = 0.009 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 6/55 (10%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXX-PPXPPLXXXXXPP-----PPPPXPP 978 P PPP P PP P PP P PP PP PPPP PP Sbjct: 315 PPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPP 369 Score = 37.9 bits (84), Expect = 0.012 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PPPP PP PPP PP P P P PP Sbjct: 300 PSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPP 349 Score = 37.9 bits (84), Expect = 0.012 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 8/54 (14%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXP-----PPXPPXPXPXXPXXPP---PXPPXPP 977 PPPPP R PP P P PP P P PP P PP PP Sbjct: 327 PPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPP 380 Score = 37.5 bits (83), Expect = 0.016 Identities = 24/65 (36%), Positives = 25/65 (38%), Gaps = 15/65 (23%) Frame = +1 Query: 829 PPXP-----PPPPPXPXPXAXPPX-----GXXPXPXPPXXPPXPPLXXXXXP-----PPP 963 PP P PPPPP A PP P P PP P + P PPP Sbjct: 306 PPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPP 365 Query: 964 PPXPP 978 PP PP Sbjct: 366 PPPPP 370 Score = 36.7 bits (81), Expect = 0.029 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PPP PPP PP P P P P P PP PP Sbjct: 329 PPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPP 378 Score = 36.7 bits (81), Expect = 0.029 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PPP PPPP PPP P PP P S PP PP Sbjct: 355 PPPVGGAAPPPPP------PPPVGGPPPPPPPIEGRPPSSLGNPPPPPPP 398 Score = 35.9 bits (79), Expect = 0.050 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = +2 Query: 806 SXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 S PPP PPP PPP P PP P P P PP P Sbjct: 342 SRGAPPPPSMGMAPPP--VGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPP 396 Score = 35.5 bits (78), Expect = 0.066 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Frame = +2 Query: 806 SXNXPPPXPX---XPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 S PPP P PPPPP PPP PP P P PP Sbjct: 301 SRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPP 357 Score = 35.5 bits (78), Expect = 0.066 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP--PPXPP 978 PPPPPP PP G P P PP P PPPP PP Sbjct: 363 PPPPPP-------PPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPP 404 Score = 34.7 bits (76), Expect = 0.12 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PP PPP PPP P PP PS PP PP Sbjct: 348 PPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPP 397 Score = 33.5 bits (73), Expect = 0.27 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 4/53 (7%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXP----PXXPXPXPSXPXXXPPXP 964 PPP PPPP PP P P P P PS PP P Sbjct: 289 PPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPP 341 Score = 33.5 bits (73), Expect = 0.27 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 10/60 (16%) Frame = +1 Query: 829 PPXP----PPPPPXPXPXAXPPX---GXXPXPXPPXXP---PXPPLXXXXXPPPPPPXPP 978 PP P PPPPP PP G P P PP P PP PP PP Sbjct: 297 PPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPP 356 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 46.0 bits (104), Expect = 5e-05 Identities = 22/56 (39%), Positives = 22/56 (39%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP P PPP R PP P PPP P P P P P PP P Sbjct: 1059 PRKPSPPPSEPAPPP-----RQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQP 1109 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXP---PXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PPP P P P A P P P P P PP P P PPP P Sbjct: 1035 PPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQP 1091 Score = 43.6 bits (98), Expect = 3e-04 Identities = 22/59 (37%), Positives = 23/59 (38%) Frame = +1 Query: 802 SLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 S+ P PP P P P A PP P PP P PP PPP P PP Sbjct: 1010 SIDPVPHLKPPGPTEQPVPPKRKASPPSAQ---PLPPPRKPSPPPSAVPIPPPRKPSPP 1065 Score = 42.3 bits (95), Expect = 6e-04 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 2/51 (3%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXP--PXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PP P PPP P P P P PP P PP PPP P P Sbjct: 1043 PPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDP 1093 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/63 (33%), Positives = 23/63 (36%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P + P+ PP P PP PP P PPP P P P P P P Sbjct: 1029 PKRKASPPSAQPLPPPRKPSPPPSAVPIPPP----RKPSPPPSEPAPPPRQPPPPSTSQP 1084 Query: 969 XPP 977 PP Sbjct: 1085 VPP 1087 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 6/60 (10%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXP-XAXPPXGXXPXPXP--PXXPPXPPLXXXXXPPPP---PPXPP 978 P PP P P P PP P P P P PP P PPPP P PP Sbjct: 1028 PPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPP 1087 Score = 37.9 bits (84), Expect = 0.012 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 3/52 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXP--PXXXXXXPXPPP-XPPXPXPXXPXXPPPXPPXP 974 PP P PPP P P P PPP PP P P PPP P P Sbjct: 1043 PPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQP-VPPPRQPDP 1093 Score = 37.9 bits (84), Expect = 0.012 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PP PPPP PP P P P P PP P P P Sbjct: 1071 PPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQPKPTPAPRP 1117 Score = 37.1 bits (82), Expect = 0.022 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 6/60 (10%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXP--XAXPPXGXXP----XPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PPP P P P A PP P P PP P P P PPP P Sbjct: 1050 PPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQP 1109 Score = 35.9 bits (79), Expect = 0.050 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXP 965 P PP PPPP PP P P P P P P P P P Sbjct: 1065 PPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQP-KPTPAP 1115 Score = 34.3 bits (75), Expect = 0.15 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXPXS 982 PP P P PP PP P PP P P PS PP P P S Sbjct: 1019 PPGPTEQPVPPKRKAS--PPSAQPLP---PPRKPSPPPSAVPIPPPRKPSPPPS 1067 Score = 34.3 bits (75), Expect = 0.15 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 2/57 (3%) Frame = +2 Query: 818 PPPXPXXPP--PPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXPXS 982 PP P PP PPP PPP P P P P P P P P S Sbjct: 1065 PPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPP--PRQPKPTPAPRPRS 1119 Score = 33.9 bits (74), Expect = 0.20 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 5/59 (8%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXP-PLXXXXXPP----PPPPXPP 978 P P PPP P P P P P P P P P P P PPPP P Sbjct: 1079 PSTSQPVPPPRQPDPIP-TNPAHPTEPPPRQPKPTPAPRPRSWVESQPELHRPPPPIKP 1136 Score = 31.9 bits (69), Expect = 0.82 Identities = 19/63 (30%), Positives = 19/63 (30%), Gaps = 1/63 (1%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXP-XXPXXPPPXP 965 P A P PP P P PP P PP P P P P P P Sbjct: 1036 PSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIP 1095 Query: 966 PXP 974 P Sbjct: 1096 TNP 1098 Score = 29.5 bits (63), Expect = 4.4 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 8/62 (12%) Frame = +1 Query: 817 PXXXPPXPPPPPPX--------PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPX 972 P PP P PP P P PP G P PP PP P PPP Sbjct: 991 PHPSPPMQPAKPPRQHTQCSIDPVPHLKPP-GPTEQPVPPKRKASPP----SAQPLPPPR 1045 Query: 973 PP 978 P Sbjct: 1046 KP 1047 Score = 28.7 bits (61), Expect = 7.6 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP P P P P P P P P P P PP P Sbjct: 1087 PPRQPDPIPTNPAHPTEPPPRQPKPTPAPRPRSWVESQPELHRPPPPIKP 1136 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 45.6 bits (103), Expect = 6e-05 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 2/51 (3%) Frame = +3 Query: 831 PXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXP--PPXPPXPP 977 P PPPP R PP P P PP P P P P P PP PP Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVPP 827 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPP 933 P P PP P P P PP G P P PP PP Sbjct: 792 PPNIPSRPPGARPTPPP---PPPGKPTKPTKPSLPPVPP 827 Score = 33.1 bits (72), Expect = 0.35 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PPPPP P A P PP P PP P PPP PP Sbjct: 777 PPPPPPPTKPATPRV-------PPNIPSRPP----GARPTPPPPPP 811 Score = 31.5 bits (68), Expect = 1.1 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = +2 Query: 818 PPPXPXXPPPPP--XXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PPP P P P RPP P PP P P+ P PP PP Sbjct: 778 PPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKP-TKPTKP-SLPPVPP 827 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 45.2 bits (102), Expect = 8e-05 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 P P PPPPP P PP P PP PP PP PPPPP Sbjct: 546 PAVTPSEEPPPPP-PGVDIPPPLPPSEDPKPPPPPPEPP---EECPPPPP 591 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 831 PXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPP 956 P PPPP PP P PPP PP P P PP Sbjct: 550 PSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/64 (31%), Positives = 20/64 (31%) Frame = +3 Query: 786 LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXP 965 LP T P P P PP P PP P P P P P P Sbjct: 528 LPLGHTTAHYQVPIPAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECP 587 Query: 966 PXPP 977 P PP Sbjct: 588 PPPP 591 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P P PP P P PP P PP P PP PP Sbjct: 542 PAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 37.5 bits (83), Expect = 0.016 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +1 Query: 847 PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P P P P PP P PPPPPP PP Sbjct: 540 PIPAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPP 583 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXG 888 P P PPPPP P PP G Sbjct: 569 PSEDPKPPPPPPEPPEECPPPPPG 592 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 45.2 bits (102), Expect = 8e-05 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = +3 Query: 900 PXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PPP PP P P P PPP PP PP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPP 1182 Score = 43.2 bits (97), Expect = 3e-04 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXP 930 PP PPPPPP P PP P P PP PP P Sbjct: 1157 PPPPPPPPPPPPSSPSPP----PPPPPPPPPPTP 1186 Score = 41.9 bits (94), Expect = 8e-04 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +3 Query: 900 PXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PPP PP P P PPP PP PP Sbjct: 1159 PPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 41.5 bits (93), Expect = 0.001 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +1 Query: 901 PXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP PP PPPPPP PP Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPP 1183 Score = 41.1 bits (92), Expect = 0.001 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +1 Query: 901 PXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP PP PPPPPP PP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPP 1182 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPP 933 PPPPPP P P PP P P PP PP PP Sbjct: 1157 PPPPPPPPPP---PPSSPSPPPPPPP-PPPPP 1184 Score = 40.7 bits (91), Expect = 0.002 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 895 PXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PP PP P PPPPPP PP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP 912 Q P PP PPPPP P P PP P P PP Sbjct: 1155 QIPPPPPPPPPPPPSSPSPPPPPP----PPPPPP 1184 Score = 39.1 bits (87), Expect = 0.005 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 900 PXPPPXPPXPXPXXPXXPPPXPPXP 974 P PPP P P P P PPP PP P Sbjct: 1162 PPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 37.5 bits (83), Expect = 0.016 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 895 PXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PP PP P PPPPPP P Sbjct: 1159 PPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 876 PPXXXXXXPXPPPXPPXPXPXXPXXPPPXP 965 PP P PP P P P P PPP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 33.5 bits (73), Expect = 0.27 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPS 937 PP P PPPPP PPP PP P P P+ Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPP--------PPPPPPPTPT 1187 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/58 (41%), Positives = 24/58 (41%), Gaps = 3/58 (5%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGG---GGGXGGXXXGXW 810 G G G GG GG G G G G P GG G G G G GGG G G W Sbjct: 251 GWGRGSGGGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGW 308 Score = 37.5 bits (83), Expect = 0.016 Identities = 24/61 (39%), Positives = 24/61 (39%), Gaps = 6/61 (9%) Frame = -3 Query: 974 GXGGGGG---GXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGG---GGGXGGXXXGX 813 G GGG G G GG G G G G P GG G G G G GGG G Sbjct: 303 GPGGGWGRMQGGMGRGPGGGWGRMQGGGMGRGPGGGLGRGPGGGWGRMQGGGMGRGPGQG 362 Query: 812 W 810 W Sbjct: 363 W 363 Score = 37.5 bits (83), Expect = 0.016 Identities = 22/55 (40%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXG-GGGGGXGGXXXG 816 GG G G GG +GG G G G G P GG G G G G G G G Sbjct: 313 GGMGRGPGGGWGRMQGGGMGRGPGGGLGRGPGGGWGRMQGGGMGRGPGQGWGCRG 367 Score = 36.3 bits (80), Expect = 0.038 Identities = 23/57 (40%), Positives = 24/57 (42%), Gaps = 3/57 (5%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGG---GGGXGGXXXG 816 GG G G GG +GG G G G G GG G G G G GGG G G Sbjct: 282 GGWGRGSGGGWGRMQGGGMGRGPGGGWGRM-QGGMGRGPGGGWGRMQGGGMGRGPGG 337 Score = 34.3 bits (75), Expect = 0.15 Identities = 21/49 (42%), Positives = 22/49 (44%), Gaps = 3/49 (6%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXG-GXXGGXGX--GXXPXGGXAXGXGXGGGGG 840 GG G G GG +GG G G GG G G G G G G GGG Sbjct: 298 GGMGRGPGGGWGRMQGGMGRGPGGGWGRMQGGGMGRGPGGGLGRGPGGG 346 Score = 33.9 bits (74), Expect = 0.20 Identities = 23/55 (41%), Positives = 23/55 (41%), Gaps = 5/55 (9%) Frame = -3 Query: 959 GGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXG-----GGGGGXGGXXXGXW 810 GGG RG G GG G G P GG G G G GGG G G G W Sbjct: 242 GGGMGQGPRGWGRGSGGGWGQG--PGGGWGRGQGRGMGRGPGGGWGRGS--GGGW 292 Score = 31.9 bits (69), Expect = 0.82 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 G G GGG GG G G G G P GG G GG G G GG Sbjct: 277 GRGPGGG--WGRGSGGGWGRMQGGGMGRGPGGG--WGRMQGGMGRGPGG 321 Score = 30.7 bits (66), Expect = 1.9 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = -2 Query: 957 GGXXXGXEGXGXGXXGGXXXGXXXXGG---GRXXXXXXGGGGGXXGXGGG 817 GG G G G G GG G G GR GGG G G GGG Sbjct: 243 GGMGQGPRGWGRGSGGGWGQGPGGGWGRGQGRGMGRGPGGGWGR-GSGGG 291 Score = 29.1 bits (62), Expect = 5.8 Identities = 22/66 (33%), Positives = 23/66 (34%), Gaps = 4/66 (6%) Frame = -1 Query: 973 GXGGXGG-GXXGXXGXGXG---GXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGR 806 G GG G G G G G G G G G G GG G G G GG G Sbjct: 255 GSGGGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGG 314 Query: 805 VSXAXG 788 + G Sbjct: 315 MGRGPG 320 Score = 28.7 bits (61), Expect = 7.6 Identities = 20/61 (32%), Positives = 21/61 (34%), Gaps = 1/61 (1%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGG-GXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGR 806 G G GG G G G G GG G G G G GGG G GR Sbjct: 235 GSGSPMWGGGMGQGPRGWGRGSGGGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSGGGWGR 294 Query: 805 V 803 + Sbjct: 295 M 295 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/49 (46%), Positives = 23/49 (46%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 GG GGGGGG GG GG GG G G G G G G G G G Sbjct: 311 GGDGGGGGGGG----GGGGGDGGGDGDGDGDGDGDGDGDGDGDGDGDDG 355 Score = 37.9 bits (84), Expect = 0.012 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 GG GGGGGG GG G G G G G G G G G G G Sbjct: 315 GGGGGGGGG------GGGDGGGDGDGDGDGDGDGDGDGDGDGDGDDGWG 357 Score = 37.5 bits (83), Expect = 0.016 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -1 Query: 973 GXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G GGG G G G GG GGG G G G G G G Sbjct: 304 GDGDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDGDG 352 Score = 35.1 bits (77), Expect = 0.088 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -3 Query: 902 GXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G G GG G G GGGGGG GG G Sbjct: 302 GDGDGDGGGGGDGGGGGGGGGGGGGDGGG 330 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 908 GXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G G G GG G G GGGGGG G G Sbjct: 302 GDGDGDGGGGGDGGGGGGGGGGGGGDGGGDG 332 Score = 30.7 bits (66), Expect = 1.9 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G G GGG G G G GG GGG G G G G G G Sbjct: 302 GDGDGDGGGGGDGG--GGGGGG-GGGGGDGGGDGDGDGDGDGDGDGDGDGDG 350 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 7/57 (12%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXX---PP----PPPPXPP 978 PP PPP P PP P PP PP PP PP PPPP PP Sbjct: 285 PPMTPPPAVVTAPPPAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPP 341 Score = 39.5 bits (88), Expect = 0.004 Identities = 23/58 (39%), Positives = 23/58 (39%), Gaps = 8/58 (13%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXP----XXPP----PXPPXPP 977 PP PPP PP P PPP PP P P P PP P PP PP Sbjct: 285 PPMTPPPAVVTAPPPAPPLPNFTSPSPPPPPPLP-PAMPAMDDLLPPEVLSPPPPPPP 341 Score = 35.9 bits (79), Expect = 0.050 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP-PPPXPP 978 P P PPPPPP P P P PP P P P P PP Sbjct: 304 PNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPPSEDFYSMPSSLPMPSPP 358 Score = 33.5 bits (73), Expect = 0.27 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 859 PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P PP P PP PPL P PPPP P Sbjct: 283 PVPPMTPPPAVVTAP-----PPAPPLPNFTSPSPPPPPP 316 Score = 33.5 bits (73), Expect = 0.27 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPP--LXXXXXPPPPP 966 PPPPP P P P PP P L PPPPP Sbjct: 335 PPPPPPPSEDFYSMPSSLPMPSPPEDLYDAPATLPSPIMPPPPP 378 Score = 32.3 bits (70), Expect = 0.62 Identities = 20/61 (32%), Positives = 21/61 (34%), Gaps = 13/61 (21%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPX-------------PPXXPPXPPLXXXXXPPPPPPXPP 978 PPPP P P + PP P P P PP PPP PP P Sbjct: 246 PPPPVPPPTIPSVPPGSETYVPPGSATYESMDSVNKAPVPPMTPPPAVVTAPPPAPPLPN 305 Query: 979 F 981 F Sbjct: 306 F 306 Score = 28.7 bits (61), Expect = 7.6 Identities = 14/48 (29%), Positives = 15/48 (31%) Frame = +2 Query: 824 PXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 P P PPP PP PP P P+ P PP Sbjct: 283 PVPPMTPPPAVVTAPPPAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPP 330 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 44.0 bits (99), Expect = 2e-04 Identities = 24/56 (42%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXG--GXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGGGGG G G G G G GG G G GGG G GG G Sbjct: 48 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDG 103 Score = 41.9 bits (94), Expect = 8e-04 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 G GGG GG GG G GG G G GG G G GGGG G Sbjct: 70 GDDGGGDGGGCDG--GGGDGDGGGGGDGDGGGGGDGGGGGDGGGGNDDDG 117 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/47 (44%), Positives = 21/47 (44%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGG 837 G G GGG GG G GG G G GG G G G GGGG Sbjct: 67 GNVGDDGGGDGGGCDGGGGDGDGG-GGGDGDGGGGGDGGGGGDGGGG 112 Score = 38.3 bits (85), Expect = 0.009 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Frame = -1 Query: 982 GXGGXGGXGGG-XXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G G GGG G G G G GGG G GG GGGG G Sbjct: 65 GDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGGNDDDG 117 Score = 35.9 bits (79), Expect = 0.050 Identities = 22/55 (40%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXG--GXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG GG G + G G G G G GGG GGGGG GGG Sbjct: 49 GDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGG---GDGDGGGGGDGDGGGG 100 Score = 35.9 bits (79), Expect = 0.050 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 4/54 (7%) Frame = -1 Query: 976 GGXGGXGGGXX----GXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 GG GG G G G G GG GGG G GGGGG GG Sbjct: 52 GGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGG 105 Score = 33.1 bits (72), Expect = 0.35 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = -2 Query: 957 GGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G G +G G G G GGG GG GG G GGG Sbjct: 65 GDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGG 111 Score = 32.3 bits (70), Expect = 0.62 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -2 Query: 963 GXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGG 820 G G G G G GG G GG GGGG G GG Sbjct: 65 GDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGG 112 Score = 32.3 bits (70), Expect = 0.62 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -2 Query: 966 GGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXG 823 GG GG G G G G GG G GGG GGGG G Sbjct: 74 GGDGGGCDGGGGDGDGGGGGDGDG----GGGGDGGGGGDGGGGNDDDG 117 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 44.0 bits (99), Expect = 2e-04 Identities = 24/56 (42%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXG--GXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGGGGG G G G G G GG G G GGG G GG G Sbjct: 63 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDG 118 Score = 41.9 bits (94), Expect = 8e-04 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 G GGG GG GG G GG G G GG G G GGGG G Sbjct: 85 GDDGGGDGGGCDG--GGGDGDGGGGGDGDGGGGGDGGGGGDGGGGNDDDG 132 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/47 (44%), Positives = 21/47 (44%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGG 837 G G GGG GG G GG G G GG G G G GGGG Sbjct: 82 GNVGDDGGGDGGGCDGGGGDGDGG-GGGDGDGGGGGDGGGGGDGGGG 127 Score = 38.3 bits (85), Expect = 0.009 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Frame = -1 Query: 982 GXGGXGGXGGG-XXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G G GGG G G G G GGG G GG GGGG G Sbjct: 80 GDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGGNDDDG 132 Score = 35.9 bits (79), Expect = 0.050 Identities = 22/55 (40%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXG--GXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG GG G + G G G G G GGG GGGGG GGG Sbjct: 64 GDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGG---GDGDGGGGGDGDGGGG 115 Score = 35.9 bits (79), Expect = 0.050 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 4/54 (7%) Frame = -1 Query: 976 GGXGGXGGGXX----GXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 GG GG G G G G GG GGG G GGGGG GG Sbjct: 67 GGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGG 120 Score = 33.1 bits (72), Expect = 0.35 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = -2 Query: 957 GGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G G +G G G G GGG GG GG G GGG Sbjct: 80 GDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGG 126 Score = 32.3 bits (70), Expect = 0.62 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -2 Query: 963 GXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGG 820 G G G G G GG G GG GGGG G GG Sbjct: 80 GDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGG 127 Score = 32.3 bits (70), Expect = 0.62 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -2 Query: 966 GGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXG 823 GG GG G G G G GG G GGG GGGG G Sbjct: 89 GGDGGGCDGGGGDGDGGGGGDGDG----GGGGDGGGGGDGGGGNDDDG 132 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 43.6 bits (98), Expect = 3e-04 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXP---XPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PPPP PP G P P PP P PP PP P PP Sbjct: 451 PPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPPPP 507 Score = 41.9 bits (94), Expect = 8e-04 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 4/51 (7%) Frame = +1 Query: 838 PPPP----PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PPPP PP P P P G P PP PP P PPP PP Sbjct: 428 PPPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPP 478 Score = 36.7 bits (81), Expect = 0.029 Identities = 22/58 (37%), Positives = 23/58 (39%), Gaps = 7/58 (12%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXP--PXGXXPXPXPPXXPPXPPLXXXXXP---PPPP--PXPPF 981 PP P PP P P P P P P PP+ P PPPP P PPF Sbjct: 436 PPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPF 493 Score = 33.9 bits (74), Expect = 0.20 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 4/49 (8%) Frame = +1 Query: 829 PPXP----PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 PP P PPP P P PP P PP P PP PP Sbjct: 469 PPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPPPPRQRMPSQGPP 517 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/61 (32%), Positives = 21/61 (34%), Gaps = 4/61 (6%) Frame = +3 Query: 807 LPTXXXXPPXXP--PPPPXXXXXRXPPXXXXXXPXP--PPXPPXPXPXXPXXPPPXPPXP 974 +P P P PPPP PP P PP P P P PPP P Sbjct: 445 MPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMP 504 Query: 975 P 977 P Sbjct: 505 P 505 Score = 31.9 bits (69), Expect = 0.82 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 6/53 (11%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPX---PPPX-PPXPXPXXPXXP--PPXPP 968 PP PPPP PP P PPP PP P P P P PP Sbjct: 455 PPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPPPP 507 Score = 30.3 bits (65), Expect = 2.5 Identities = 19/63 (30%), Positives = 20/63 (31%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P A + LP PP PP P PP PP P PPP Sbjct: 421 PAANMRLP-----PPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGM 475 Query: 969 XPP 977 PP Sbjct: 476 YPP 478 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPP 933 P PP P PPP PP G P P PP Sbjct: 479 PRGFPPPPFGPPPPFYRGPPPPRGMPPPPRQRMPSQGPP 517 Score = 28.7 bits (61), Expect = 7.6 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPP PP P PP P P PP P Sbjct: 460 PPPGGMRGMPPPPMGMYP-PPRGFPPPPFGPPPPFYRGPPPPRGMPPPP 507 Score = 28.7 bits (61), Expect = 7.6 Identities = 14/49 (28%), Positives = 15/49 (30%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PP P PPPP + PP P P P PP Sbjct: 497 PPPPRGMPPPPRQRMPSQGPPQVHYPSQDPQRLGAVKAMEKGEPPKAPP 545 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 43.6 bits (98), Expect = 3e-04 Identities = 21/46 (45%), Positives = 22/46 (47%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGG 840 GG GGGG RGG GG GG G G GG + G G GG Sbjct: 99 GGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGGRRDYGG 144 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG G GGG G G GG G G GG G G GGGG GG Sbjct: 92 GGGGSQGGGYRSGGGGYGGSSRGGYGGGR---GGGGYGGGRGGGGSYGGG 138 Score = 38.3 bits (85), Expect = 0.009 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXG-GGGGGXGG 828 G GGGG R G GG GG G G G G G GGGG GG Sbjct: 89 GERGGGGSQGGGYRSGGGGY-GGSSRGGYGGGRGGGGYGGGRGGGGSYGG 137 Score = 36.7 bits (81), Expect = 0.029 Identities = 19/41 (46%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -3 Query: 935 RGGXGGXXGGXGXGXXPXGGXA-XGXGXGGGGGGXGGXXXG 816 RGG G GG G GG + G G G GGGG GG G Sbjct: 91 RGGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGG 131 Score = 35.9 bits (79), Expect = 0.050 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GGG GG GG GG GG G G GG G GGG G Sbjct: 312 GGGRGGGYRS--GGGGGYGGGRGGGRGYGGGRGGGGRRDYGGGSRSG 356 Score = 33.5 bits (73), Expect = 0.27 Identities = 25/63 (39%), Positives = 25/63 (39%), Gaps = 2/63 (3%) Frame = -1 Query: 982 GXGGXGGXG--GGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 G GG G G G G G GG GGG G GG R GGGG GG G Sbjct: 92 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGY--GGGR------GGGGSYGGGRRDYG 143 Query: 808 RVS 800 S Sbjct: 144 GAS 146 Score = 33.5 bits (73), Expect = 0.27 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGG 905 GG GG GGG G G G G GGG Sbjct: 322 GGGGGYGGGRGGGRGYGGGRGGGG 345 Score = 32.7 bits (71), Expect = 0.47 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -3 Query: 935 RGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 RGG G G G GG G G GGG GG G G Sbjct: 311 RGGGRGGGYRSGGGGGYGGGRGGGRGYGGGRGGGGRRDYG 350 Score = 32.7 bits (71), Expect = 0.47 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -2 Query: 957 GGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 GG G G G GG G GGGR GGGG GGG Sbjct: 313 GGRGGGYRSGGGGGYGGGRGGGRGYGGGR-------GGGGRRDYGGG 352 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXG 894 GG GGGG RGG G GG G G Sbjct: 317 GGYRSGGGGGYGGGRGGGRGYGGGRGGG 344 Score = 29.9 bits (64), Expect = 3.3 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -2 Query: 942 GXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G G G GG G GG G GGG G G G Sbjct: 89 GERGGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRG 130 >SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2631 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GG GG GG G GG G G A G G GG GG Sbjct: 777 GGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGG 826 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/54 (35%), Positives = 20/54 (37%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GG G GG G GG G G + G GG G GG G Sbjct: 784 GGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASGG 837 Score = 38.7 bits (86), Expect = 0.007 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGG 849 GG GG GG GG GG GG G G A G GG Sbjct: 799 GGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASGGADGG 841 Score = 37.5 bits (83), Expect = 0.016 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 G G G GG GG GG G G A G G GG GG Sbjct: 766 GHASSGAGSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGG 815 Score = 37.5 bits (83), Expect = 0.016 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG G GG G GG GG G G A G GG GG Sbjct: 792 GGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASGGADGG 841 Score = 37.5 bits (83), Expect = 0.016 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 GG G GG G G GG GG G G G GG GG Sbjct: 792 GGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASGGADGG 841 Score = 37.1 bits (82), Expect = 0.022 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G G GG G GG GG G G A G GG GG GG G Sbjct: 771 GAGSSSGGASGGAGGSSGGANGGAGSSSGGASGGA-GGSSGGASGGAGGSSGG 822 Score = 35.5 bits (78), Expect = 0.066 Identities = 19/54 (35%), Positives = 20/54 (37%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG G G GG G GG G G + G GG GG GG G Sbjct: 763 GGDGHASSGAGSSS-GGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGG 815 Score = 34.3 bits (75), Expect = 0.15 Identities = 21/81 (25%), Positives = 24/81 (29%) Frame = -1 Query: 973 GXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRVSXA 794 G G GG G G GG GG G G G GG G G + Sbjct: 771 GAGSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSS 830 Query: 793 XGSQXFXQXD*SNDXNRQELG 731 G SN + + G Sbjct: 831 SGGASGGADGGSNKSSTNQSG 851 Score = 33.5 bits (73), Expect = 0.27 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRVS 800 GG G GG G G G GG G G GG GG G S Sbjct: 777 GGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGAS 835 Score = 33.5 bits (73), Expect = 0.27 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG G G G G GG G GG GG G GG Sbjct: 789 GANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASGGADGG 841 Score = 33.5 bits (73), Expect = 0.27 Identities = 19/62 (30%), Positives = 20/62 (32%) Frame = -1 Query: 967 GGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRVSXAXG 788 GG GG G G GG GG G G G GG G S + Sbjct: 799 GGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASGGADGGSNKSSTNQSGNSSESSA 858 Query: 787 SQ 782 SQ Sbjct: 859 SQ 860 Score = 33.1 bits (72), Expect = 0.35 Identities = 19/66 (28%), Positives = 19/66 (28%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRV 803 G G G G G GG GG G G GG GG G Sbjct: 764 GDGHASSGAGSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGA 823 Query: 802 SXAXGS 785 S GS Sbjct: 824 SGGAGS 829 Score = 32.3 bits (70), Expect = 0.62 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG G G G G G GG G GG G GG Sbjct: 782 GAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGG 833 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 43.2 bits (97), Expect = 3e-04 Identities = 28/70 (40%), Positives = 28/70 (40%), Gaps = 14/70 (20%) Frame = +1 Query: 802 SLXQXPXXXPPX----PPPPPPXPXPXAX------PPXGXXPXP--XPPXXPP--XPPLX 939 S Q P PP PPPPP P PP G P P PP PP PP Sbjct: 324 SRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSG 383 Query: 940 XXXXPPPPPP 969 PPPPPP Sbjct: 384 KINPPPPPPP 393 Score = 42.3 bits (95), Expect = 6e-04 Identities = 24/63 (38%), Positives = 24/63 (38%), Gaps = 4/63 (6%) Frame = +1 Query: 802 SLXQXPXXXPPX---PPPPPPXPXPXAXPPXGXXPXPXPPXXP-PXPPLXXXXXPPPPPP 969 S Q P PP PPPPPP PP PP P PP PPPPP Sbjct: 303 SRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPG 362 Query: 970 XPP 978 P Sbjct: 363 RAP 365 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PPP P P P P P PP P PPPP PP Sbjct: 241 PAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPP 289 Score = 39.9 bits (89), Expect = 0.003 Identities = 24/61 (39%), Positives = 24/61 (39%), Gaps = 14/61 (22%) Frame = +1 Query: 829 PPXP---PPPP------PXPXPXAXPPXGXXPXPXPPXXP-----PXPPLXXXXXPPPPP 966 PP P PPPP P P P PP PP P P PP PPPPP Sbjct: 263 PPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPP 322 Query: 967 P 969 P Sbjct: 323 P 323 Score = 39.1 bits (87), Expect = 0.005 Identities = 25/64 (39%), Positives = 26/64 (40%), Gaps = 10/64 (15%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPX----AXPPXGXX-PXPXPPXXP--PXPPL---XXXXXPPPPP 966 P PPPPPP P A PP G P P PP P PP+ PPPP Sbjct: 208 PPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPK 267 Query: 967 PXPP 978 PP Sbjct: 268 NAPP 271 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 1/57 (1%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXP-PXPPLXXXXXPPPPPPXPP 978 Q P P P P P A PP P P P P PPL PPPPP P Sbjct: 296 QGPPLPPSRDQAPAPPPPLNATPP---PPPPSRDQVPLPPPPLRGQIAPPPPPISKP 349 Score = 37.5 bits (83), Expect = 0.016 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 5/55 (9%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXX-----PPXPPLXXXXXPPPPPPXPP 978 PP PP P P PP P P PP PP P PPPP PP Sbjct: 298 PPLPPSRDQAPAPP--PPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPP 350 Score = 35.1 bits (77), Expect = 0.088 Identities = 26/85 (30%), Positives = 27/85 (31%) Frame = +3 Query: 714 PPPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXX 893 PPP P S F + Q A P P PPPPP PP Sbjct: 282 PPPTRGPPSNSFTT--QGPPLPPSRDQAPAPPPPLNATP---PPPPPSRDQVPLPPPPLR 336 Query: 894 XXPXPPPXPPXPXPXXPXXPPPXPP 968 PPP P P PP PP Sbjct: 337 GQIAPPPPPISKPPTSTRSAPPPPP 361 Score = 34.7 bits (76), Expect = 0.12 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 7/57 (12%) Frame = +2 Query: 818 PPPXPX---XP-PPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPS---XPXXXPPXPP 967 PPP P P PPPP PPP P P P P P PP PP Sbjct: 319 PPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPP 375 Score = 34.3 bits (75), Expect = 0.15 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 9/63 (14%) Frame = +2 Query: 806 SXNXPPPXPXXPPPPPXXXXXXRPPPXXXXP-----XXXPPXXP----XPXPSXPXXXPP 958 S PPP PPPP PPP P PP P P P P P Sbjct: 259 SGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATP 318 Query: 959 XPP 967 PP Sbjct: 319 PPP 321 Score = 33.5 bits (73), Expect = 0.27 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 5/51 (9%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP-----PPPXPP 978 PPPPP + PP PP P P PPP P P PP Sbjct: 194 PPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPP 244 Score = 33.1 bits (72), Expect = 0.35 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 5/48 (10%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPXP-----PXPXPXXPXXPPPXPP 968 PPPPP R PP PP P P P P PPP PP Sbjct: 280 PPPPPT----RGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPP 323 Score = 32.3 bits (70), Expect = 0.62 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 4/55 (7%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P P PPPP P G P P PP PPPPPP Sbjct: 166 PPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPP 220 Score = 31.9 bits (69), Expect = 0.82 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPP 883 PPP P PPPP +PPP Sbjct: 4 PPPPPGPPPPPSAPSGPVKPPP 25 Score = 31.5 bits (68), Expect = 1.1 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 5/60 (8%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXX----PPXXPXPXPSXPXXXPPXPP-XXPXS 982 PPP P P RPPP P PP P P PP PP P S Sbjct: 231 PPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPS 290 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPP 912 PPPPPP P P P G P PP Sbjct: 3 PPPPPPGPPPPPSAPSG--PVKPPP 25 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P P P R PP P PP P P PP PP Sbjct: 239 PLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPP 284 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 7/53 (13%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPX-------PPXPXPXXPXXPPPXPPXPP 977 PP PP PP P PPP PP P PPP PP Sbjct: 298 PPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPP 350 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPP 882 P PP PPPPP P PP Sbjct: 3 PPPPPPGPPPPPSAPSGPVKPP 24 Score = 30.7 bits (66), Expect = 1.9 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXPXS 982 H PPP PPPP P P P P P PP P P S Sbjct: 202 HGSAPPPPERSSGPPPPPPGRG--PSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTS 259 Score = 30.7 bits (66), Expect = 1.9 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PPPP PP G P PP PPP PP Sbjct: 206 PPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPP 251 Score = 30.3 bits (65), Expect = 2.5 Identities = 22/71 (30%), Positives = 22/71 (30%), Gaps = 12/71 (16%) Frame = +2 Query: 806 SXNXPPPXPXXPP-----------PPPXXXXXXRPPPXXXXPXXXPP-XXPXPXPSXPXX 949 S N PPP PP PP PPP P PP P P P Sbjct: 277 SSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLR 336 Query: 950 XPPXPPXXPXS 982 PP P S Sbjct: 337 GQIAPPPPPIS 347 Score = 30.3 bits (65), Expect = 2.5 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 PPPPP R P P PP P P PPP PP Sbjct: 357 PPPPPG----RAPQPLGGPPPPPPGRRPPSGKINP--PPPPPP 393 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXP 903 P PPPPP P P + P P P Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 909 PPXPPXPXPXXPXXPPPXPPXPP 977 PP PP P P P P P PP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPP 24 Score = 29.9 bits (64), Expect = 3.3 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 2/58 (3%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXR--XPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PPPP R PP P P P P P P P PP Sbjct: 209 PERSSGPP--PPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPP 264 Score = 29.9 bits (64), Expect = 3.3 Identities = 16/50 (32%), Positives = 17/50 (34%), Gaps = 6/50 (12%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXX------PXPXPPXXPPXPPLXXXXXPPPPPP 969 PPP P P P P P PP+ PPPPPP Sbjct: 429 PPPEPYQDTPKTYPSKNQQKANRGNPRPASSSRGAPPPVPPSRGPPPPPP 478 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 900 PXPPPXPPXPXPXXPXXPPPXPP 968 P PPP P P P P P PP Sbjct: 3 PPPPPPGPPPPPSAPSGPVKPPP 25 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PP P PP P PP PPPP P Sbjct: 133 PPPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKP 182 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +2 Query: 812 NXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPS 937 N PP P PPPP P PP P PS Sbjct: 137 NSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPS 178 Score = 29.1 bits (62), Expect = 5.8 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 5/57 (8%) Frame = +2 Query: 812 NXPPPXPXXP-----PPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 N PPP P PPPP PP PP P S PP PP Sbjct: 248 NRPPPPMRGPTSGGEPPPPKNAPP--PPKRGSSNPPPPPTRGPPSNSFTTQGPPLPP 302 Score = 29.1 bits (62), Expect = 5.8 Identities = 18/59 (30%), Positives = 18/59 (30%), Gaps = 5/59 (8%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP-----PXPP 978 P P PPP P G P PP P PP PP P PP Sbjct: 253 PMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPP 311 Score = 29.1 bits (62), Expect = 5.8 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 T PP P PPP PPP P P P PP PP Sbjct: 295 TQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLP-----PPPLRGQIAPPPPP 345 Score = 28.7 bits (61), Expect = 7.6 Identities = 16/53 (30%), Positives = 17/53 (32%), Gaps = 4/53 (7%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPP----XPXPXXPXXPPPXPPXP 974 PP PP + PP P P PP P P P PP P Sbjct: 282 PPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPP 334 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 43.2 bits (97), Expect = 3e-04 Identities = 28/70 (40%), Positives = 28/70 (40%), Gaps = 14/70 (20%) Frame = +1 Query: 802 SLXQXPXXXPPX----PPPPPPXPXPXAX------PPXGXXPXP--XPPXXPP--XPPLX 939 S Q P PP PPPPP P PP G P P PP PP PP Sbjct: 236 SRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSG 295 Query: 940 XXXXPPPPPP 969 PPPPPP Sbjct: 296 KINPPPPPPP 305 Score = 42.3 bits (95), Expect = 6e-04 Identities = 24/63 (38%), Positives = 24/63 (38%), Gaps = 4/63 (6%) Frame = +1 Query: 802 SLXQXPXXXPPX---PPPPPPXPXPXAXPPXGXXPXPXPPXXP-PXPPLXXXXXPPPPPP 969 S Q P PP PPPPPP PP PP P PP PPPPP Sbjct: 215 SRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPG 274 Query: 970 XPP 978 P Sbjct: 275 RAP 277 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PPP P P P P P PP P PPPP PP Sbjct: 153 PAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPP 201 Score = 39.9 bits (89), Expect = 0.003 Identities = 24/61 (39%), Positives = 24/61 (39%), Gaps = 14/61 (22%) Frame = +1 Query: 829 PPXP---PPPP------PXPXPXAXPPXGXXPXPXPPXXP-----PXPPLXXXXXPPPPP 966 PP P PPPP P P P PP PP P P PP PPPPP Sbjct: 175 PPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPP 234 Query: 967 P 969 P Sbjct: 235 P 235 Score = 39.1 bits (87), Expect = 0.005 Identities = 25/64 (39%), Positives = 26/64 (40%), Gaps = 10/64 (15%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPX----AXPPXGXX-PXPXPPXXP--PXPPL---XXXXXPPPPP 966 P PPPPPP P A PP G P P PP P PP+ PPPP Sbjct: 120 PPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPK 179 Query: 967 PXPP 978 PP Sbjct: 180 NAPP 183 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 1/57 (1%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXP-PXPPLXXXXXPPPPPPXPP 978 Q P P P P P A PP P P P P PPL PPPPP P Sbjct: 208 QGPPLPPSRDQAPAPPPPLNATPP---PPPPSRDQVPLPPPPLRGQIAPPPPPISKP 261 Score = 37.5 bits (83), Expect = 0.016 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 5/55 (9%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXX-----PPXPPLXXXXXPPPPPPXPP 978 PP PP P P PP P P PP PP P PPPP PP Sbjct: 210 PPLPPSRDQAPAPP--PPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPP 262 Score = 35.1 bits (77), Expect = 0.088 Identities = 26/85 (30%), Positives = 27/85 (31%) Frame = +3 Query: 714 PPPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXX 893 PPP P S F + Q A P P PPPPP PP Sbjct: 194 PPPTRGPPSNSFTT--QGPPLPPSRDQAPAPPPPLNATP---PPPPPSRDQVPLPPPPLR 248 Query: 894 XXPXPPPXPPXPXPXXPXXPPPXPP 968 PPP P P PP PP Sbjct: 249 GQIAPPPPPISKPPTSTRSAPPPPP 273 Score = 34.7 bits (76), Expect = 0.12 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 7/57 (12%) Frame = +2 Query: 818 PPPXPX---XP-PPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPS---XPXXXPPXPP 967 PPP P P PPPP PPP P P P P P PP PP Sbjct: 231 PPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPP 287 Score = 34.3 bits (75), Expect = 0.15 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 9/63 (14%) Frame = +2 Query: 806 SXNXPPPXPXXPPPPPXXXXXXRPPPXXXXP-----XXXPPXXP----XPXPSXPXXXPP 958 S PPP PPPP PPP P PP P P P P P Sbjct: 171 SGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATP 230 Query: 959 XPP 967 PP Sbjct: 231 PPP 233 Score = 33.5 bits (73), Expect = 0.27 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 5/51 (9%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP-----PPPXPP 978 PPPPP + PP PP P P PPP P P PP Sbjct: 106 PPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPP 156 Score = 33.1 bits (72), Expect = 0.35 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 5/48 (10%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPXP-----PXPXPXXPXXPPPXPP 968 PPPPP R PP PP P P P P PPP PP Sbjct: 192 PPPPPT----RGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPP 235 Score = 32.3 bits (70), Expect = 0.62 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 4/55 (7%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P P PPPP P G P P PP PPPPPP Sbjct: 78 PPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPP 132 Score = 31.5 bits (68), Expect = 1.1 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 5/60 (8%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXX----PPXXPXPXPSXPXXXPPXPP-XXPXS 982 PPP P P RPPP P PP P P PP PP P S Sbjct: 143 PPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPS 202 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P P P R PP P PP P P PP PP Sbjct: 151 PLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPP 196 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 7/53 (13%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPX-------PPXPXPXXPXXPPPXPPXPP 977 PP PP PP P PPP PP P PPP PP Sbjct: 210 PPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPP 262 Score = 30.7 bits (66), Expect = 1.9 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXPXS 982 H PPP PPPP P P P P P PP P P S Sbjct: 114 HGSAPPPPERSSGPPPPPPGRG--PSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTS 171 Score = 30.7 bits (66), Expect = 1.9 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PPPP PP G P PP PPP PP Sbjct: 118 PPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPP 163 Score = 30.3 bits (65), Expect = 2.5 Identities = 22/71 (30%), Positives = 22/71 (30%), Gaps = 12/71 (16%) Frame = +2 Query: 806 SXNXPPPXPXXPP-----------PPPXXXXXXRPPPXXXXPXXXPP-XXPXPXPSXPXX 949 S N PPP PP PP PPP P PP P P P Sbjct: 189 SSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLR 248 Query: 950 XPPXPPXXPXS 982 PP P S Sbjct: 249 GQIAPPPPPIS 259 Score = 30.3 bits (65), Expect = 2.5 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 PPPPP R P P PP P P PPP PP Sbjct: 269 PPPPPG----RAPQPLGGPPPPPPGRRPPSGKINP--PPPPPP 305 Score = 29.9 bits (64), Expect = 3.3 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 2/58 (3%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXR--XPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PPPP R PP P P P P P P P PP Sbjct: 121 PERSSGPP--PPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPP 176 Score = 29.9 bits (64), Expect = 3.3 Identities = 16/50 (32%), Positives = 17/50 (34%), Gaps = 6/50 (12%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXX------PXPXPPXXPPXPPLXXXXXPPPPPP 969 PPP P P P P P PP+ PPPPPP Sbjct: 341 PPPEPYQDTPKTYPSKNQQKANRGNPRPASSSRGAPPPVPPSRGPPPPPP 390 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PP P PP P PP PPPP P Sbjct: 45 PPPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKP 94 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +2 Query: 812 NXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPS 937 N PP P PPPP P PP P PS Sbjct: 49 NSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPS 90 Score = 29.1 bits (62), Expect = 5.8 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 5/57 (8%) Frame = +2 Query: 812 NXPPPXPXXP-----PPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 N PPP P PPPP PP PP P S PP PP Sbjct: 160 NRPPPPMRGPTSGGEPPPPKNAPP--PPKRGSSNPPPPPTRGPPSNSFTTQGPPLPP 214 Score = 29.1 bits (62), Expect = 5.8 Identities = 18/59 (30%), Positives = 18/59 (30%), Gaps = 5/59 (8%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP-----PXPP 978 P P PPP P G P PP P PP PP P PP Sbjct: 165 PMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPP 223 Score = 29.1 bits (62), Expect = 5.8 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 T PP P PPP PPP P P P PP PP Sbjct: 207 TQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLP-----PPPLRGQIAPPPPP 257 Score = 28.7 bits (61), Expect = 7.6 Identities = 16/53 (30%), Positives = 17/53 (32%), Gaps = 4/53 (7%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPP----XPXPXXPXXPPPXPPXP 974 PP PP + PP P P PP P P P PP P Sbjct: 194 PPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPP 246 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 42.7 bits (96), Expect = 4e-04 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 1/52 (1%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPX-PPXXPPXPPLXXXXXPPPPPP 969 P PP PPP P P P G P P PP PP PPPPPP Sbjct: 250 PGMPPPGMMPPPGFP-PMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPPPPPP 300 Score = 41.9 bits (94), Expect = 8e-04 Identities = 25/68 (36%), Positives = 25/68 (36%), Gaps = 10/68 (14%) Frame = +1 Query: 805 LXQXPXXXPPXPP--PPPPXPXPXAXPPXGXXPX--------PXPPXXPPXPPLXXXXXP 954 L P PP P PPP P P PP G P P P PP PP Sbjct: 233 LGHPPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNM 292 Query: 955 PPPPPXPP 978 PPP PP Sbjct: 293 EQPPPPPP 300 Score = 33.1 bits (72), Expect = 0.35 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 H PP P PPP PPP P P P P P PP PP Sbjct: 235 HPPMGAPPPPHSMPPPGMPPPGMMPPP-GFPPMGMPGMGGMPPPGMP---PPMPP 285 Score = 30.3 bits (65), Expect = 2.5 Identities = 23/69 (33%), Positives = 24/69 (34%), Gaps = 12/69 (17%) Frame = +3 Query: 807 LPTXXXXPPXXPP------PP---PXXXXXRXPPXXXXXXPXPPP-XPPXPXPXXPXXPP 956 + T PP PP PP P PP PPP PP P PP Sbjct: 217 IQTSTSLPPMIPPVGMLGHPPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPP 276 Query: 957 P--XPPXPP 977 P PP PP Sbjct: 277 PGMPPPMPP 285 Score = 30.3 bits (65), Expect = 2.5 Identities = 23/72 (31%), Positives = 23/72 (31%), Gaps = 12/72 (16%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXX--PPP--------PPXXXXXRXPPXXXXXXP--XPPPXPPXPX 932 P L P PP PPP PP P P PPP PP Sbjct: 229 PVGMLGHPPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGM 288 Query: 933 PXXPXXPPPXPP 968 P PPP PP Sbjct: 289 PPNMEQPPPPPP 300 Score = 28.7 bits (61), Expect = 7.6 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 HS P P PPP P P PP P P P P PP Sbjct: 245 HSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMP-PGGMPPNMEQPPPP 298 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 42.7 bits (96), Expect = 4e-04 Identities = 25/52 (48%), Positives = 26/52 (50%), Gaps = 6/52 (11%) Frame = -3 Query: 965 GGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGG------GGXGG 828 GGGG RGG GG GG G G GG + G G GGGG GG GG Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYG---GGGRSYGGGGGGGGFYQDSYGGGGG 140 Score = 39.1 bits (87), Expect = 0.005 Identities = 23/49 (46%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = -1 Query: 982 GXGGXGGXGGGXX-GXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGG 839 G GG GG GGG G G GG GGG G GG GGGGG Sbjct: 101 GRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGG-------GGGGG 142 Score = 37.9 bits (84), Expect = 0.012 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGG 840 GG GGGGG GG G GG G G G G GGGGG Sbjct: 100 GGRGGGGGYGGGGGYGGGGRSYGGGGGGG---GFYQDSYGGGGGGG 142 Score = 33.5 bits (73), Expect = 0.27 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXG 830 G GG GG G G GG GGG GG GGGG G Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGGG 142 Score = 31.9 bits (69), Expect = 0.82 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 4/48 (8%) Frame = -2 Query: 936 EGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGG----GXXGXGGGXLXE 805 E G G GG G GGGR GGGG G GGG E Sbjct: 98 ERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGGGCYE 145 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 882 GGGRXXXXXXGGGGGXXGXGG 820 GGGR GGGGG G GG Sbjct: 93 GGGRRERGGRGGGGGYGGGGG 113 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 42.3 bits (95), Expect = 6e-04 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = -3 Query: 935 RGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGG 840 R G GG GG G G P GG G G GGGGG Sbjct: 23 RDGGGGHGGGHGYGGGPNGGGGGGGGGGGGGG 54 Score = 35.5 bits (78), Expect = 0.066 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGG 905 G GG G GGG G G G GG GGG Sbjct: 28 GHGGGHGYGGGPNGGGGGGGGGGGGG 53 Score = 32.7 bits (71), Expect = 0.47 Identities = 17/41 (41%), Positives = 19/41 (46%) Frame = -3 Query: 911 GGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXWXSEXSXR 789 GG G G GG G G GGGGG GG G + S + Sbjct: 25 GGGGHG----GGHGYGGGPNGGGGGGGGGGGGGGDEDDSGK 61 Score = 31.9 bits (69), Expect = 0.82 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXG 894 GG GGG G GG GG GG G G Sbjct: 26 GGGHGGGHGYGGGPNGGGGGGGGGGGGG 53 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 973 GXGGXGGGXXGXXGXGXGGXGGGXG 899 G GG GGG G GG GGG G Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGGGG 49 Score = 29.1 bits (62), Expect = 5.8 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 958 GGGXXGXXGXGXGGXGGGXGXXXXXXGG 875 GGG G G G G GGG G GG Sbjct: 26 GGGHGGGHGYGGGPNGGGGGGGGGGGGG 53 Score = 28.7 bits (61), Expect = 7.6 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGG 840 GG G GGG GG GG GG G G GG Sbjct: 31 GGHGYGGGPNGGGGGGGGGGGGGGDEDDSGKNGKEYSGKNKWNNGG 76 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 42.3 bits (95), Expect = 6e-04 Identities = 20/49 (40%), Positives = 21/49 (42%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PP PPPPPP P P PP P + PPPPPP P Sbjct: 102 PPPPPPPPPPPPPPPPPP----PITLHHEQHVVSHVMHPAPPPPPPPPP 146 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PPPPP PP P P P PPP P PP Sbjct: 97 PACCAPPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAPCMPP 152 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 11/54 (20%) Frame = +1 Query: 850 PPXPXPXAXPPXGXXPXPXPPXXPPXPPL-----------XXXXXPPPPPPXPP 978 P P PP P P PP PP PP+ PPPPPP PP Sbjct: 93 PACPPACCAPPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPP 146 Score = 36.7 bits (81), Expect = 0.029 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXX-PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPP 956 P A P PP PPPPP P P PP P P P PP Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAPCMPP 152 Score = 36.7 bits (81), Expect = 0.029 Identities = 21/50 (42%), Positives = 22/50 (44%), Gaps = 3/50 (6%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXP---PXPPLXXXXXPPPPPPXPP 978 PPPPPP P P PP P P PP + P PPPP PP Sbjct: 102 PPPPPPPPPP---PP----PPPPPPPITLHHEQHVVSHVMHPAPPPPPPP 144 Score = 35.9 bits (79), Expect = 0.050 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +1 Query: 853 PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P A PP P P PP PP PPPPPP PP Sbjct: 88 PTSCAPACPPACCAPPPPPPPPPP---------PPPPPPPPP 120 Score = 35.5 bits (78), Expect = 0.066 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PPPPPP P PP PP PP P P PP Sbjct: 136 PAPPPPPPPPPAPCMPPCHQTQVVHSVQLHASPP----GPPPAPMPAPP 180 >SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 519 Score = 41.9 bits (94), Expect = 8e-04 Identities = 24/53 (45%), Positives = 24/53 (45%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GGG G GG GG GG G G GG G GGGGG GG G Sbjct: 167 GDGGGSNGSGGGDDGGDGGDDGG-GSG----GGGDDGGSDGGGGGNDGGRDDG 214 Score = 36.7 bits (81), Expect = 0.029 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G G GGG G G G G GG G G GGGG G G Sbjct: 149 GDGDGDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDGGDDGGGSGGGGDDGGSDG 202 Score = 35.9 bits (79), Expect = 0.050 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GGG G GG G G G G G G GGGG G G Sbjct: 151 GDGDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDGGDDGGGSGGGGDDGGSDGGG 204 Score = 32.3 bits (70), Expect = 0.62 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXG-GGGGXXGG 827 G G G GGG G GG G GG G GGGG GG Sbjct: 147 GDGDGDGDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDGGDDGGGSGGGGDDGG 199 Score = 32.3 bits (70), Expect = 0.62 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGG--XGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG GG G G G GGG G GG GG G GG Sbjct: 153 GDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDGGDDGGGSGGGGDDGGSDGGGGG 206 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXG 899 G GG G G G G G GG GG G Sbjct: 182 GDGGDDGGGSGGGGDDGGSDGGGGGNDG 209 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 41.9 bits (94), Expect = 8e-04 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = +1 Query: 838 PPPPPP--XPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PPPPP P P PP G P PP P PP+ PP PP Sbjct: 122 PPPPPTGTLPPPPVTPPPG--PETPPPPDTPAPPVPPTEAPPTAPP 165 Score = 36.3 bits (80), Expect = 0.038 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +3 Query: 843 PPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXP--XXPPPXPP 968 PPPP PP P PP P P P P PP PP Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPP 165 Score = 34.3 bits (75), Expect = 0.15 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 2/61 (3%) Frame = +1 Query: 787 YLXLYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP--XXPPXPPLXXXXXPPP 960 YL Y P P PP PP P P PP P PP P PP P Sbjct: 116 YLGGYVPPPPPTGTLPPPPVTPP-PGPETPPPPDTPAPPVPPTEAPPTAPPTGGSCVSKP 174 Query: 961 P 963 P Sbjct: 175 P 175 Score = 33.1 bits (72), Expect = 0.35 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 906 PPPXPPXPXPXXPXXPPPXPPXPP 977 PPP P P P PPP P PP Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPP 145 Score = 31.9 bits (69), Expect = 0.82 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 2/52 (3%) Frame = +2 Query: 818 PPPXPXXPPPP--PXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PPP PPPP P PPP P P P P PP Sbjct: 124 PPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPPTGGSCVSKPP 175 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 877 PPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP P PP PP P P PP PP Sbjct: 123 PPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPP 156 Score = 29.1 bits (62), Expect = 5.8 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 4/35 (11%) Frame = +1 Query: 886 GXXPXPXPPXXPPXPPLXXXXXP--PPPP--PXPP 978 G P P P P PP+ P PPPP P PP Sbjct: 119 GYVPPPPPTGTLPPPPVTPPPGPETPPPPDTPAPP 153 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 41.9 bits (94), Expect = 8e-04 Identities = 24/51 (47%), Positives = 24/51 (47%), Gaps = 3/51 (5%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGG-XGGXXGGXGXGXXPXGGXAXGXGXGGG--GGGXG 831 G GGGGG RGG GG GG G GG G G GGG GG G Sbjct: 138 GRDGGGGGYRGGYRGGYRGGYRGGRDRGGGYGGGGEGGYGMGGGDYSGGCG 188 Score = 39.9 bits (89), Expect = 0.003 Identities = 23/55 (41%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGG-XGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GG GG RGG GG G G G GG G G GG G G G Sbjct: 141 GGGGGYRGGYRGGYRGGYRGGRDRGGGYGGGGEGGYGMGGGDYSGGCGYGSSYGG 195 Score = 39.9 bits (89), Expect = 0.003 Identities = 24/54 (44%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXG-GGGGGXGGXXXG 816 G G GGGG GG G GG G G GG G G G GGG G G G Sbjct: 165 GGGYGGGGEGGYGMGG-GDYSGGCGYGSSYGGGGDYGGGPGYGGGQGYGSYSGG 217 Score = 37.5 bits (83), Expect = 0.016 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG GGG G G G G GG G GG G GGG G Sbjct: 161 GRDRGGGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGGDYGGGPGYGGGQGYG 212 Score = 35.9 bits (79), Expect = 0.050 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXG-GXGGGXGXXXXXXGGXRXXXXXGGGGG 839 G GG G GG G G G G GG G GG GGGGG Sbjct: 172 GEGGYGMGGGDYSGGCGYGSSYGGGGDYGGGPGYGGGQGYGSYSGGGGG 220 Score = 31.9 bits (69), Expect = 0.82 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGG 820 G GG G G G G GG G GG GGGG G G Sbjct: 153 GYRGGYRGGRDRGGGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGGDYGGGPG 204 >SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) Length = 315 Score = 41.5 bits (93), Expect = 0.001 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 2/59 (3%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP--XPPLXXXXXPPPPPPXPPF 981 Q P P PP P P P PP P P PP PP PP PP P P F Sbjct: 167 QPPPIFPIDPPRTQPPPIPPIDPPR-TQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIF 224 Score = 38.7 bits (86), Expect = 0.007 Identities = 23/58 (39%), Positives = 23/58 (39%), Gaps = 4/58 (6%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP--XPPLXXXXXPP--PPPPXPP 978 P P PP P P PP P P PP PP PP PP PPP PP Sbjct: 156 PPISPIDPPRTQPPPIFPIDPPR-TQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPP 212 Score = 37.9 bits (84), Expect = 0.012 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 3/53 (5%) Frame = +1 Query: 829 PPXPPPPP--PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP-PPXPP 978 PP PPP P P PP P PP PP+ PPP PP P Sbjct: 163 PPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPPIDP 215 Score = 37.5 bits (83), Expect = 0.016 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PP PP PP P PP P PP PP P PPP P P Sbjct: 182 PPIPPIDPPRTQPPPIPPI-DPPRTQPPPIPPIDP--PRTQPPPIFPQP 227 Score = 37.1 bits (82), Expect = 0.022 Identities = 23/65 (35%), Positives = 24/65 (36%), Gaps = 2/65 (3%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPX--PPPXPPXPXPXXPXXPPPX 962 P T P PP P PP + PP P PPP PP P PPP Sbjct: 143 PVMTPTTPAPMTLPPISPIDPPRT---QPPPIFPIDPPRTQPPPIPPIDPPRTQ--PPPI 197 Query: 963 PPXPP 977 PP P Sbjct: 198 PPIDP 202 Score = 37.1 bits (82), Expect = 0.022 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP---XPPLXXXXXPPPP 963 Q P P PP P P P PP P P PP PP PP+ P P Sbjct: 180 QPPPIPPIDPPRTQPPPIPPIDPPR-TQPPPIPPIDPPRTQPPPIFPQPTTPAP 232 Score = 36.3 bits (80), Expect = 0.038 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP P PP PP PPP PP P PPP PP P Sbjct: 163 PPRTQPPPIFPIDPPRTQPPPIPP-IDPPRTQPPPIPPIDPPR--TQPPPIPPIDP 215 Score = 34.7 bits (76), Expect = 0.12 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP-PPXPP 978 P PP P P PP P PP PP+ PPP PP P Sbjct: 152 PMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDP 202 Score = 34.3 bits (75), Expect = 0.15 Identities = 24/66 (36%), Positives = 25/66 (37%), Gaps = 8/66 (12%) Frame = +3 Query: 795 AXLTLPTXXXX-PPXXPPPP--PXXXXXRXPPXXXXXXPX---PPPXPPXPXPXX--PXX 950 A +TLP PP PPP P PP P PPP PP P P Sbjct: 151 APMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPI 210 Query: 951 PPPXPP 968 PP PP Sbjct: 211 PPIDPP 216 Score = 32.7 bits (71), Expect = 0.47 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 5/60 (8%) Frame = +3 Query: 810 PTXXXXPPXXPPPP--PXXXXXRXPPXXXXXXPX---PPPXPPXPXPXXPXXPPPXPPXP 974 P PP PPP P PP P PPP PP P PPP P P Sbjct: 170 PIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPR--TQPPPIFPQP 227 Score = 30.7 bits (66), Expect = 1.9 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 3/50 (6%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPX---PPXXPPXPPLXXXXXPPPPPPXPP 978 P P P P PP P PP P PP PPP PP P Sbjct: 143 PVMTPTTPAPMTLPPISPIDPPRTQPPPIFPIDPP---RTQPPPIPPIDP 189 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/47 (46%), Positives = 22/47 (46%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGG 837 GG GG GGG RGG GG GG G GG G G G GG Sbjct: 421 GGRGGPGGGYEGRGRGGRGGPRGGGPRGY--DGGYGQGGGYEGYSGG 465 Score = 36.3 bits (80), Expect = 0.038 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -2 Query: 966 GGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 GG GG G EG G G GG G G R G GGG G GG Sbjct: 421 GGRGGPGGGYEGRGRGGRGGPRGG-----GPRGYDGGYGQGGGYEGYSGG 465 Score = 35.5 bits (78), Expect = 0.066 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -3 Query: 962 GGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGG-GGXGG 828 GGG RGG GG GG G P G G GGG GG GG Sbjct: 493 GGGPPRGGPRGGRGGSRGGPPRGA-PRGRSGPPRGRGGGDFGGRGG 537 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 40.7 bits (91), Expect = 0.002 Identities = 23/52 (44%), Positives = 23/52 (44%), Gaps = 3/52 (5%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPX--PPLXXXXXPPPP-PPXPP 978 P PPPP P P P G P PP PPL PPPP PP PP Sbjct: 680 PSSAPPPPAPPPP--PIGGGDPTIWVSGGPPLSAPPLSSTLGPPPPAPPPPP 729 Score = 38.3 bits (85), Expect = 0.009 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP PPP P P PP PPL PPPP P PP Sbjct: 680 PSSAPP-PPAPPPPPIGGGDPT--IWVSGGPPL--SAPPLSSTLGPPPPAPPPP 728 Score = 37.5 bits (83), Expect = 0.016 Identities = 27/106 (25%), Positives = 33/106 (31%), Gaps = 8/106 (7%) Frame = +3 Query: 681 RESCRSDHVRCPPPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXXPPPPP-- 854 +++ R PP P D + P + L + PP PPPPP Sbjct: 672 QDNARKSSPSSAPPPPAPPPPPIGGGDPTIWVSGGPPLSAPPLSSTLGPPPPAPPPPPLG 731 Query: 855 ----XXXXXRXPPXXXXXXP--XPPPXPPXPXPXXPXXPPPXPPXP 974 P PPP PP P PPP PP P Sbjct: 732 RDSAAVFMLTWTPLTNTSSAANVPPPPPPPAVPGEGARPPPPPPPP 777 Score = 37.1 bits (82), Expect = 0.022 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 6/56 (10%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAX------PPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PPPPP A P P PP P + PPPPP PP Sbjct: 722 PPAPPPPPLGRDSAAVFMLTWTPLTNTSSAANVPPPPPPPAVPGEGARPPPPPPPP 777 Score = 34.7 bits (76), Expect = 0.12 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PPPPP P P PP P PPP PP PP Sbjct: 685 PPPAPPPPPIGGGD---PTIWVSGGPPLSAPPLSSTLGP--PPPAPPPPP 729 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 40.3 bits (90), Expect = 0.002 Identities = 28/86 (32%), Positives = 31/86 (36%), Gaps = 4/86 (4%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXG----GGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXX 815 G GG GG GGG G G G G G GG G G R GG G GG Sbjct: 761 GGGGYGGGGGGYRGGGGYGGGHRGGGGYGGGGHRGGSYSGYRGSYKSGGYGQGSGGYGQG 820 Query: 814 VGRVSXAXGSQXFXQXD*SNDXNRQE 737 G + G + N RQ+ Sbjct: 821 SGGYNRNTGYNTYGSY--GNQNQRQQ 844 Score = 38.3 bits (85), Expect = 0.009 Identities = 25/60 (41%), Positives = 25/60 (41%), Gaps = 6/60 (10%) Frame = -3 Query: 977 GGXGGGGGGXXXXXR----GGXGGXXGGXGXGXXPXGGXAXGXGXGG--GGGGXGGXXXG 816 GG GGGG G R GG G GG G GG G GG GGG GG G Sbjct: 730 GGRGGGGYGGGYNDRRMQQGGYGNRSGGGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYG 789 Score = 38.3 bits (85), Expect = 0.009 Identities = 24/60 (40%), Positives = 25/60 (41%), Gaps = 2/60 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGG--GGXGGXXXGXWXS 804 GG G GG GG GG GG G GG G G GGGG GG G + S Sbjct: 749 GGYGNRSGGGYRGG-GGYGGGGGGYRGGGGYGGGHRGGGGYGGGGHRGGSYSGYRGSYKS 807 Score = 36.7 bits (81), Expect = 0.029 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = -1 Query: 976 GGXGGX-GGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXG 830 GG G GGG G G G GG GGG GG R GGGG G Sbjct: 749 GGYGNRSGGGYRG--GGGYGGGGGGYRGGGGYGGGHRGGGGYGGGGHRGG 796 Score = 35.9 bits (79), Expect = 0.050 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 10/57 (17%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGG----------XGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GG RGG GG G G G GG G G GGGGGG G Sbjct: 718 GGRGGWQKDYQRGGRGGGGYGGGYNDRRMQQGGYGNRSGGGYRGGGGYGGGGGGYRG 774 Score = 33.9 bits (74), Expect = 0.20 Identities = 27/75 (36%), Positives = 27/75 (36%), Gaps = 9/75 (12%) Frame = -1 Query: 982 GXGGXGGXGGGXX------GXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGG---GGXXG 830 G G GG GGG G G GG G G GG R GGG GG G Sbjct: 730 GGRGGGGYGGGYNDRRMQQGGYGNRSGGGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYG 789 Query: 829 GXXXXVGRVSXAXGS 785 G G S GS Sbjct: 790 GGGHRGGSYSGYRGS 804 Score = 30.3 bits (65), Expect = 2.5 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 4/54 (7%) Frame = -2 Query: 966 GGXGGXXXGXE--GXGXGXXGGXXXGXXXXGGGRXXXXXXG--GGGGXXGXGGG 817 GG GG + G G G GG GG G GGGG G GGG Sbjct: 718 GGRGGWQKDYQRGGRGGGGYGGGYNDRRMQQGGYGNRSGGGYRGGGGYGGGGGG 771 >SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) Length = 2735 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 2/59 (3%) Frame = +1 Query: 811 QXPXXXPPXPPPP--PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 Q P P PPP PP P P P PP P P PP PPP PF Sbjct: 2594 QPPFFGPQLPPPDMFPPQMMPPMVPMMLPPMLPLPPPGLPMQPEAPVQPPPLPPPGGPF 2652 Score = 35.5 bits (78), Expect = 0.066 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 843 PPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PPP PP P P PP P P P PP PP Sbjct: 2603 PPPDMFPPQMMPPMVPMMLPPMLPLPPPGLPMQPEAPVQPPPLPP 2647 Score = 30.7 bits (66), Expect = 1.9 Identities = 24/89 (26%), Positives = 28/89 (31%) Frame = +3 Query: 702 HVRCPPPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPP 881 +V PPP+ ++ P LP PP PP P Sbjct: 2567 NVEQPPPQPQMNAAMSPDRRWPIVAPMQPPFFGPQLPPPDMFPPQMMPP-------MVPM 2619 Query: 882 XXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P PPP P P P PPP PP Sbjct: 2620 MLPPMLPLPPPGLPM-QPEAPVQPPPLPP 2647 Score = 29.9 bits (64), Expect = 3.3 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +2 Query: 830 PXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 P P P PPP P PP P P PP P P Sbjct: 2588 PIVAPMQPPFFGPQLPPPDMFPPQMMPPMVPMMLPPMLPLPPPGLPMQP 2636 Score = 29.9 bits (64), Expect = 3.3 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPL 936 P PP P PPP P P P P PP P PP+ Sbjct: 2618 PMMLPPMLPLPPPG-LPMQ-PEAPVQPPPLPPPGGPFPPV 2655 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPL 936 PP PPPPPP P PP P P P PP P L Sbjct: 195 PPPPPPPPPPGFPGGAPP----PPPPPFGAPPPPAL 226 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXP 954 P P PPPPPP P P G P P PP P PP P Sbjct: 190 PMAGMPPPPPPPPPP----GFPGGAPPPPPPPFGAPPPPALNGGPP 231 Score = 36.7 bits (81), Expect = 0.029 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 906 PPPXPPXPXPXXPXXPPPXPPXP 974 PPP PP P P P PP PP P Sbjct: 195 PPPPPPPPPPGFPGGAPPPPPPP 217 Score = 34.7 bits (76), Expect = 0.12 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +2 Query: 812 NXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXP 943 N P P PPPPP PPP P PP P P + P Sbjct: 186 NKPSPMAGMPPPPP-------PPPPPGFPGGAPPPPPPPFGAPP 222 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 871 AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 A P P PP PP P PPPPPP Sbjct: 185 ANKPSPMAGMPPPPPPPPPPGFPGGAPPPPPPP 217 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 907 PPXXPPXPPLXXXXXPPPPPPXPPF 981 PP PP PP PPPPP PPF Sbjct: 195 PPPPPPPPPPGFPGGAPPPPP-PPF 218 Score = 32.3 bits (70), Expect = 0.62 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 3/29 (10%) Frame = +3 Query: 900 PXPPPXPPXPXPXXPXXPPPXP---PXPP 977 P PPP PP P PPP P P PP Sbjct: 196 PPPPPPPPPGFPGGAPPPPPPPFGAPPPP 224 Score = 31.9 bits (69), Expect = 0.82 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPP 914 P PP PPPPP PP PPP Sbjct: 190 PMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPPPP 224 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 5/59 (8%) Frame = +1 Query: 817 PXXXPPXPP----PPPPXPXPXAXPPXGXXPXPXPPXXP-PXPPLXXXXXPPPPPPXPP 978 P PP P PPP P P PP P PP P P P P PPP P Sbjct: 429 PRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 487 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 5/59 (8%) Frame = +1 Query: 817 PXXXPPXPP----PPPPXPXPXAXPPXGXXPXPXPPXXP-PXPPLXXXXXPPPPPPXPP 978 P PP P PPP P P PP P PP P P P P PPP P Sbjct: 439 PRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 497 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 5/59 (8%) Frame = +1 Query: 817 PXXXPPXPP----PPPPXPXPXAXPPXGXXPXPXPPXXP-PXPPLXXXXXPPPPPPXPP 978 P PP P PPP P P PP P PP P P P P PPP P Sbjct: 489 PRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 547 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 5/59 (8%) Frame = +1 Query: 817 PXXXPPXPP----PPPPXPXPXAXPPXGXXPXPXPPXXP-PXPPLXXXXXPPPPPPXPP 978 P PP P PPP P P PP P PP P P P P PPP P Sbjct: 509 PRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAP 567 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 5/59 (8%) Frame = +1 Query: 817 PXXXPPXPP----PPPPXPXPXAXPPXGXXPXPXPPXXP-PXPPLXXXXXPPPPPPXPP 978 P PP P PPP P P PP P PP P P P P PPP P Sbjct: 529 PRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTP 587 Score = 39.1 bits (87), Expect = 0.005 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 8/61 (13%) Frame = +1 Query: 817 PXXXPPXPP----PPPPXPXPXAXPPXGXXPXPXPPXXP----PXPPLXXXXXPPPPPPX 972 P PP P PPP P P PP P PP P P P PPP P Sbjct: 449 PRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPH 508 Query: 973 P 975 P Sbjct: 509 P 509 Score = 39.1 bits (87), Expect = 0.005 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 8/61 (13%) Frame = +1 Query: 817 PXXXPPXPP----PPPPXPXPXAXPPXGXXPXPXPPXXP----PXPPLXXXXXPPPPPPX 972 P PP P PPP P P PP P PP P P P PPP P Sbjct: 459 PRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPH 518 Query: 973 P 975 P Sbjct: 519 P 519 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +1 Query: 844 PPPPXPXPXAXPPXGXXPXPXPPXXP-PXPPLXXXXXPPPPPPXPPF 981 PPP P P PP P PP P P P P PPP P+ Sbjct: 562 PPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPPGAPY 608 Score = 37.5 bits (83), Expect = 0.016 Identities = 20/61 (32%), Positives = 21/61 (34%), Gaps = 2/61 (3%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP--XPPXX 973 +H PP P PPP PPP P PP P P P P PP Sbjct: 417 SHQRVRPPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGA 476 Query: 974 P 976 P Sbjct: 477 P 477 Score = 37.5 bits (83), Expect = 0.016 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 4/57 (7%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXP----PXPPLXXXXXPPPPPPXP 975 P P PPP P P PP P PP P P P PPP P P Sbjct: 423 PPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHP 479 Score = 37.1 bits (82), Expect = 0.022 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 3/58 (5%) Frame = +3 Query: 810 PTXXXXPPXXPPP---PPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P PP P P PP R PP PPP P P P P P P P Sbjct: 467 PHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPP 524 Score = 37.1 bits (82), Expect = 0.022 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 3/58 (5%) Frame = +3 Query: 810 PTXXXXPPXXPPP---PPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P PP P P PP R PP PPP P P P P P P P Sbjct: 497 PHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 554 Score = 36.7 bits (81), Expect = 0.029 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 2/60 (3%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP--XPPXXP 976 H PP P PPP PPP P PP P P P P PP P Sbjct: 438 HPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 497 Score = 36.7 bits (81), Expect = 0.029 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 5/59 (8%) Frame = +1 Query: 817 PXXXPPXPP----PPPPXPXPXAXPPXGXXPXPXPPXXP-PXPPLXXXXXPPPPPPXPP 978 P PP P PPP P P PP PP P P P P PPP P Sbjct: 469 PRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAP 527 Score = 36.7 bits (81), Expect = 0.029 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 2/60 (3%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP--XPPXXP 976 H PP P PPP PPP P PP P P P P PP P Sbjct: 478 HPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 537 Score = 36.7 bits (81), Expect = 0.029 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 2/60 (3%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP--XPPXXP 976 H PP P PPP PPP P PP P P P P PP P Sbjct: 488 HPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 547 Score = 36.7 bits (81), Expect = 0.029 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 H PP P PPP PPP P PP P P P P P Sbjct: 498 HQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVP 552 Score = 36.7 bits (81), Expect = 0.029 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = +1 Query: 817 PXXXPPXP-PPPPPXPXPXAXPPXGXXPXPXPPXXP-PXPPLXXXXXPPPPPP 969 P P P PPP P P PP P PP P P P P PPP Sbjct: 502 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 554 Score = 36.7 bits (81), Expect = 0.029 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 2/60 (3%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP--XPPXXP 976 H PP P PPP PPP P PP P P P P PP P Sbjct: 508 HPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAP 567 Score = 36.7 bits (81), Expect = 0.029 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 5/59 (8%) Frame = +1 Query: 817 PXXXPPXPP----PPPPXPXPXAXPPXGXXPXPXPPXXP-PXPPLXXXXXPPPPPPXPP 978 P PP P PPP P P PP P PP P P P PPP P Sbjct: 519 PRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAP 577 Score = 36.7 bits (81), Expect = 0.029 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 2/60 (3%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP--XPPXXP 976 H PP P PPP PPP P PP P P P P PP P Sbjct: 528 HPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTP 587 Score = 36.7 bits (81), Expect = 0.029 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 2/60 (3%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP--XPPXXP 976 H PP P PPP PPP P PP P P P P PP P Sbjct: 538 HPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAP 597 Score = 36.7 bits (81), Expect = 0.029 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 5/59 (8%) Frame = +1 Query: 817 PXXXPPXPP----PPPPXPXPXAXPPXGXXPXPXPPXXP-PXPPLXXXXXPPPPPPXPP 978 P PP P PPP P PP P PP P P P P PPP P Sbjct: 539 PRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAP 597 Score = 36.7 bits (81), Expect = 0.029 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 8/59 (13%) Frame = +1 Query: 817 PXXXPPXPP----PPPPXPXPXAXPPXGXXPXPXPPXXP----PXPPLXXXXXPPPPPP 969 P PP P PPP P P PP P PP P P PPP PP Sbjct: 569 PRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPPGAPYQRLPYSGAYHPRLPPPGPP 627 Score = 35.9 bits (79), Expect = 0.050 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 2/60 (3%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP--XPPXXP 976 H PP P PPP PPP P PP P P P P PP P Sbjct: 428 HPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 487 Score = 35.9 bits (79), Expect = 0.050 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 3/61 (4%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXP---XPXPSXPXXXPPXPPXX 973 H PP P PPP PPP P PP P P P P P PP Sbjct: 458 HPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVP-PPGA 516 Query: 974 P 976 P Sbjct: 517 P 517 Score = 35.9 bits (79), Expect = 0.050 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 8/61 (13%) Frame = +1 Query: 817 PXXXPPXPP----PPPPXPXPXAXPPXGXXPXPXPPXXP----PXPPLXXXXXPPPPPPX 972 P PP P PPP P PP P PP P P P PPP P Sbjct: 479 PRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPH 538 Query: 973 P 975 P Sbjct: 539 P 539 Score = 35.9 bits (79), Expect = 0.050 Identities = 24/70 (34%), Positives = 25/70 (35%), Gaps = 15/70 (21%) Frame = +1 Query: 817 PXXXPPXPP----PPPPXPXPXAXPPXGXXPXPXPPXXP----PXP-------PLXXXXX 951 P PP P PPP P P PP P PP P P P P Sbjct: 559 PRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPPGAPYQRLPYSGAYH 618 Query: 952 PPPPPPXPPF 981 P PPP PP+ Sbjct: 619 PRLPPPGPPY 628 Score = 35.5 bits (78), Expect = 0.066 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 3/56 (5%) Frame = +2 Query: 818 PPPXPXXPP-PPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP--XPPXXP 976 PPP P PPP PPP P PP P P P P PP P Sbjct: 552 PPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPPGAP 607 Score = 34.7 bits (76), Expect = 0.12 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXP-PXPPLXXXXXPPPPPPXPP 978 P P PPP P P PP P PP P P P P PPP P Sbjct: 424 PGAPHPR-VPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 477 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXP 943 +H PP P PPP PPP P PP P P P Sbjct: 557 SHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPP 604 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 PP PPP P P P P P PP PPP P+ Sbjct: 318 PPGMGPPPRIPPPPIRAPVDVYPPRAPQGASQTPPYPGSHYSRVPPPDGPY 368 Score = 33.9 bits (74), Expect = 0.20 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 3/58 (5%) Frame = +3 Query: 810 PTXXXXPPXXPPP---PPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P PP P P PP R PP PPP P P P P P P Sbjct: 447 PHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPP 504 Score = 33.9 bits (74), Expect = 0.20 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 1/59 (1%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXP-XPSXPXXXPPXPPXXP 976 H PP P PPP PPP P PP P P P PP P Sbjct: 568 HPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPPGAPYQRLPYSGAYHPRLPPPGP 626 Score = 33.5 bits (73), Expect = 0.27 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 2/60 (3%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP--XPPXXP 976 H PP P PPP PPP PP P P P P PP P Sbjct: 468 HPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAP 527 Score = 33.5 bits (73), Expect = 0.27 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 2/60 (3%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP--XPPXXP 976 H PP P PPP PPP P PP P P P PP P Sbjct: 518 HPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAP 577 Score = 33.1 bits (72), Expect = 0.35 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +3 Query: 807 LPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 +P P PPP R PP PPP P P P P P P P Sbjct: 551 VPPPGASHPRV--PPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPP 604 Score = 32.7 bits (71), Expect = 0.47 Identities = 19/61 (31%), Positives = 20/61 (32%), Gaps = 2/61 (3%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP--XPPXX 973 +H PP P PPP PP P PP P P P P PP Sbjct: 397 SHPRVPPPGAPHPRVPPPGASHQRVRPPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGA 456 Query: 974 P 976 P Sbjct: 457 P 457 Score = 32.7 bits (71), Expect = 0.47 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 8/61 (13%) Frame = +1 Query: 817 PXXXPPXPP----PPPPXPXPXAXPPXGXXPXPXPPXXP----PXPPLXXXXXPPPPPPX 972 P PP P PPP PP P PP P P P PPP P Sbjct: 399 PRVPPPGAPHPRVPPPGASHQRVRPPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPH 458 Query: 973 P 975 P Sbjct: 459 P 459 Score = 32.3 bits (70), Expect = 0.62 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXP-PXPPLXXXXXPPPPPPXPP 978 P P PPP P PP P PP P P P P PPP P Sbjct: 484 PGAPHPR-VPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 537 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP P P P PP G P PP PP P PP P Sbjct: 297 PGYPPPQYMPHPRMRPPTRIPPPGMGP---PPRIPPPPIRAPVDVYPPRAP 344 Score = 31.1 bits (67), Expect = 1.4 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 10/64 (15%) Frame = +1 Query: 817 PXXXPPXPPP---------PPPXPXPXAXPPXGXXPXPXPPXXP-PXPPLXXXXXPPPPP 966 P P PP PP P P PP P PP P P P P PP Sbjct: 404 PGAPHPRVPPPGASHQRVRPPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPP 463 Query: 967 PXPP 978 P P Sbjct: 464 PGAP 467 Score = 30.7 bits (66), Expect = 1.9 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 5/52 (9%) Frame = +2 Query: 818 PPPXPXXPPP-----PPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP 958 PP P PPP PP PP P PP P P PP Sbjct: 697 PPVAPRVPPPSPRMQPPASGFLRMHPPASGFPRMHPPASGFPRMHPPASGPP 748 Score = 29.9 bits (64), Expect = 3.3 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXP 943 PP P PPP P P P PP P P P Sbjct: 373 PPGEPYARMPPPGATHPRVPSPGASHPRVPPPGAPHPRVPPP 414 Score = 29.9 bits (64), Expect = 3.3 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 844 PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 PPP P P PP PP P PPP P P F Sbjct: 402 PPPGAPHPRVPPPGASHQRVRPPGAP------HPRVPPPGAPHPRF 441 Score = 29.9 bits (64), Expect = 3.3 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 5/58 (8%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXX----PXPXPP-XXPPXPPLXXXXXPPPPPPXP 975 P P P PPP PP G P P P P P PPP P P Sbjct: 542 PPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHP 599 Score = 29.5 bits (63), Expect = 4.4 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 3/58 (5%) Frame = +3 Query: 810 PTXXXXPPXXPPP---PPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P PP P P PP R P PPP PP P P P P Sbjct: 587 PHPRVPPPGAPHPKVPPPGAPYQRLPYSGAYHPRLPPPGPPYQRVPPPGAPIQRVPLP 644 Score = 29.1 bits (62), Expect = 5.8 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 3/56 (5%) Frame = +2 Query: 818 PPPXPXXPP-PPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP--XPPXXP 976 P P P PPP PPP PP P P P P PP P Sbjct: 392 PSPGASHPRVPPPGAPHPRVPPPGASHQRVRPPGAPHPRVPPPGAPHPRFPPPGAP 447 Score = 28.7 bits (61), Expect = 7.6 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 5/48 (10%) Frame = +3 Query: 846 PPPXXXXXRXPPXXXXXXPXPPPXP-----PXPXPXXPXXPPPXPPXP 974 PPP R P PPP P P P PPP P P Sbjct: 362 PPPDGPYTRALPPGEPYARMPPPGATHPRVPSPGASHPRVPPPGAPHP 409 Score = 28.7 bits (61), Expect = 7.6 Identities = 17/57 (29%), Positives = 17/57 (29%), Gaps = 3/57 (5%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXP---XPXPSXPXXXPPXP 964 H PP P PPP P P PP P P P P P P Sbjct: 588 HPRVPPPGAPHPKVPPPGAPYQRLPYSGAYHPRLPPPGPPYQRVPPPGAPIQRVPLP 644 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXW 810 GG GG GG G G G G P GG G GG GG G G W Sbjct: 1265 GGSSGGGMHGGGGGYGNYGGYGGYGGNPQGGYGFA-GYGGQYGGPRGGGSGVW 1316 Score = 30.3 bits (65), Expect = 2.5 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 965 GGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 G GG RGG GG G G G GG G GG G Sbjct: 793 GWGGNRDNYSRGGGGGYNRGYGSGGGYGGGGYNKRGGRYSGGSNWG 838 Score = 29.9 bits (64), Expect = 3.3 Identities = 21/53 (39%), Positives = 22/53 (41%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXW 810 GGGG R GG GG G GG G G GG GG GG G + Sbjct: 1250 GGGGAFSSRDYRQHRGGSSGG---GMHGGGG---GYGNYGGYGGYGGNPQGGY 1296 >SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) Length = 292 Score = 39.5 bits (88), Expect = 0.004 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGG GG GG GG G GG G G GGG GG G Sbjct: 136 GGMSMGGGMGGGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMGGGMGGGMGGG 189 Score = 38.7 bits (86), Expect = 0.007 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = -3 Query: 977 GGXGGG-GGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 GG GGG GGG GG GG G GG G G GGG G G Sbjct: 176 GGMGGGMGGGMGGGMEGGMGGGMMEGMQGMGSMGGGMMGGGMGGGMGFNG 225 Score = 38.3 bits (85), Expect = 0.009 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G G GGG GG GG GG G G G G GGG GG G Sbjct: 141 GGGMGGGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMGGGMGGGMGGGMEGG 193 Score = 36.3 bits (80), Expect = 0.038 Identities = 25/60 (41%), Positives = 25/60 (41%), Gaps = 6/60 (10%) Frame = -3 Query: 977 GGXGG-GGGGXXXXXRGG---XGGXXGGXG--XGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GG GGG GG GG GG G G GG GG GGG GG G Sbjct: 129 GGEGGMGGGMSMGGGMGGGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMGGGMGGGMGG 188 Score = 35.5 bits (78), Expect = 0.066 Identities = 26/80 (32%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = -1 Query: 967 GGXGGGXXGXXGXG-XGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRVSXAX 791 GG GGG G G G GG GGG G GG GG G G Sbjct: 176 GGMGGGMGGGMGGGMEGGMGGGMMEGMQGMGSMGGGMMGGGMGGGMGFNGMEDGGKEGGM 235 Query: 790 GSQXFXQXD*SNDXNRQELG 731 G D SN E+G Sbjct: 236 GGGMLQMGD-SNGGGMSEMG 254 Score = 32.3 bits (70), Expect = 0.62 Identities = 21/60 (35%), Positives = 22/60 (36%), Gaps = 3/60 (5%) Frame = -2 Query: 981 EXGXXGGX---GGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGGXL 811 E G GG GG G G G G G GGG G GGG G GG + Sbjct: 131 EGGMGGGMSMGGGMGGGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMGGGMGGGMGGGM 190 Score = 32.3 bits (70), Expect = 0.62 Identities = 24/59 (40%), Positives = 24/59 (40%), Gaps = 10/59 (16%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGX--------GXGGG--GGGXGG 828 G G GGG GG GG GG G G GG G GGG GGG GG Sbjct: 162 GGGSMGGGMMSMAGGGMGGGMGG-GMGGGMEGGMGGGMMEGMQGMGSMGGGMMGGGMGG 219 Score = 29.5 bits (63), Expect = 4.4 Identities = 20/54 (37%), Positives = 21/54 (38%) Frame = -2 Query: 966 GGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGGXLXE 805 GG GG G G G GG GGG G GGG G GG + E Sbjct: 151 GGMGGGMGGM--MGGGSMGGGMMSMA--GGGMGGGMGGGMGGGMEGGMGGGMME 200 >SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) Length = 293 Score = 39.5 bits (88), Expect = 0.004 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 7/54 (12%) Frame = +1 Query: 829 PPXPPPP----PPXPXPXA---XPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PP P P PP P P A PP G P PP P P PP PPP Sbjct: 126 PPQVPYPGAAGPPMPHPTASVYPPPGGYPPTSYPPQPYPAQPYPQQGYPPQPPP 179 Score = 35.9 bits (79), Expect = 0.050 Identities = 26/119 (21%), Positives = 39/119 (32%) Frame = +1 Query: 625 SNVRDVDVGLETAHXTNEIAKAVEATTYAVHLQRRCRVLADSYHXINLXVXXTDYLXLYS 804 S + + VG + K ++ V ++R ++A+S + + Sbjct: 52 SECKRIAVGNSVGDGVQKAPKDIDTLFSVVSIERTWFLVAESASDASTMTTGPPTSQPVA 111 Query: 805 LXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 PP P PP P P A P P P PP PP P P P+ Sbjct: 112 YGYPTGPPPPYSPIPPQVPYPGAAGPP--MPHPTASVYPPPGGYPPTSYPPQPYPAQPY 168 Score = 29.1 bits (62), Expect = 5.8 Identities = 23/71 (32%), Positives = 24/71 (33%), Gaps = 14/71 (19%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPX----PXPXAXPPXGXXPXPXPPXX------PPXPPLXXXXXP-- 954 Q P PP P P P P PP P P P PP PP P Sbjct: 128 QVPYPGAAGPPMPHPTASVYPPPGGYPPTSYPPQPYPAQPYPQQGYPPQPPPQAYPQPGY 187 Query: 955 PPP--PPXPPF 981 PP PP P+ Sbjct: 188 PPQGYPPTGPY 198 Score = 29.1 bits (62), Expect = 5.8 Identities = 16/56 (28%), Positives = 16/56 (28%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PT PP PP P PP PP P P PP P Sbjct: 142 PTASVYPPPGGYPPTSYPPQPYPAQPYPQQGYPPQPPPQAYPQPGYPPQGYPPTGP 197 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/55 (38%), Positives = 22/55 (40%) Frame = +1 Query: 802 SLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 S + P PP PPPP P P G P P P P PP PP PP Sbjct: 24 SCCETPPPPPPYEAPPPPPGPPGPDGPPG-FPGPQGPNGPKGPP--GLPGPPGPP 75 Score = 37.1 bits (82), Expect = 0.022 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 3/49 (6%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPXPPXP-XPXXPXXPP--PXPPXPP 977 PPPPP PP P PP P P P P PP P PP PP Sbjct: 30 PPPPPY---EAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPP 75 Score = 36.3 bits (80), Expect = 0.038 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PPPP P P PP P P P P P PP P Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGP 74 Score = 34.7 bits (76), Expect = 0.12 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PPPPPP A PP P P P P P PP P PP Sbjct: 29 PPPPPP---YEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPP 72 Score = 33.9 bits (74), Expect = 0.20 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXP-PXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 P PP PP PP P P P G PP P P PP P Sbjct: 34 PYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNP 84 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Frame = +1 Query: 811 QXPXXXP-PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 Q P P P P PP P PP P P P PP PP P PP Sbjct: 173 QGPNGLPGPNGPLGPPGPPGDMGPPG--LPGPQGPQMPPGPPGLPGAPGPKGPP 224 Score = 33.1 bits (72), Expect = 0.35 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP 924 PP P PP P P P P P P PP Sbjct: 712 PPGPASPPSPPGPPGPPGPNGPPGPNGPLGPP 743 Score = 32.3 bits (70), Expect = 0.62 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP 924 PP P PP P P P P P P PP Sbjct: 627 PPGPASPPSPPGPPGPPGPKGPPGPNGPLGPP 658 Score = 32.3 bits (70), Expect = 0.62 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP 924 PP P PP P P P P P P PP Sbjct: 797 PPGPASPPSPPGPPGPPGPKGPPGPNGPLGPP 828 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PP P PP G P PP P PP PP PP Sbjct: 111 PPGPPGPPGPQMPP-GPPGLPGPP-GPAGPPGTNGELGPPGDVGPP 154 Score = 31.5 bits (68), Expect = 1.1 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 2/58 (3%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPP-XPXPXXPXXPP-PXPPXPP 977 P PP PP P P PP PP P P P PP P P P Sbjct: 685 PNGQPGPPGINGPPGQIGEMGPPGLPGPPGPASPPSPPGPPGPPGPNGPPGPNGPLGP 742 Score = 31.5 bits (68), Expect = 1.1 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 2/58 (3%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPP-XPXPXXPXXPP-PXPPXPP 977 P PP PP P P PP PP P P P PP P P P Sbjct: 770 PNGQPGPPGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGP 827 Score = 30.7 bits (66), Expect = 1.9 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = +1 Query: 832 PXPPP--PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP PP P PP P P P PP PP P PP Sbjct: 349 PGPPGINGPPGPLGDVGPPG--LPGPPGPQMPPGPPGLPGAPGPKGPP 394 Score = 30.7 bits (66), Expect = 1.9 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PP PP P P P P PP PP PP P P Sbjct: 776 PPGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGP 824 Score = 30.3 bits (65), Expect = 2.5 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = +1 Query: 832 PXPPP--PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP PP P PP P P P PP PP P PP Sbjct: 434 PGPPGINGPPGPLGDVGPPG--LPGPPGPQMPPGPPGLPGAPGPNGPP 479 Score = 30.3 bits (65), Expect = 2.5 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = +1 Query: 832 PXPPP--PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP PP P PP P P P PP PP P PP Sbjct: 519 PGPPGINGPPGPLGDVGPPG--LPGPPGPQMPPGPPGLPGAPGPNGPP 564 Score = 29.9 bits (64), Expect = 3.3 Identities = 16/50 (32%), Positives = 16/50 (32%), Gaps = 1/50 (2%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPP-XPXPXXPXXPP 956 P PP PP P P PP PP P P P PP Sbjct: 855 PNGQPGPPGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGPKGPP 904 Score = 29.9 bits (64), Expect = 3.3 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 4/54 (7%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXP--PLXXXXXP--PPPPPXPP 978 PP P PP P P P P P PP P P PP PP Sbjct: 882 PPGPASPPSPPGPPGPPGPKGPPGPNGCLGPPGDAGPAGNTGGAGCQPAPPCPP 935 Score = 29.5 bits (63), Expect = 4.4 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Frame = +1 Query: 832 PXPPP--PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PP PP PP P P P PP PP P PP P Sbjct: 859 PGPPGINGPPGQVGEMGPPG--LPGPPGPASPPSPPGPPGPPGPKGPPGP 906 Score = 29.1 bits (62), Expect = 5.8 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP P P P P P P P PP PP P PP Sbjct: 90 PPGLPGPNGVNGPPGELGDMGPPGPPGPPGPQMPPGPPGLPGPPGPAGPP 139 Score = 29.1 bits (62), Expect = 5.8 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 850 PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PP P PP P P P PP PP P PP Sbjct: 272 PPGPPGDMGPPG--LPGPPGPQMPPGPPGLPGAPGPKGPP 309 Score = 29.1 bits (62), Expect = 5.8 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 PP PP P P P P PP PP PP P Sbjct: 861 PPGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGPKGPPGP 906 Score = 28.7 bits (61), Expect = 7.6 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 4/53 (7%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXP----PXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PP PP P P P P P G PP P P P P P Sbjct: 463 PPGPPGLPGAPGPNGPPGINGPLGPPGEAGPPGNPGGPGYQGNHGNPAGPQGP 515 Score = 28.7 bits (61), Expect = 7.6 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 4/53 (7%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXP----PXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PP PP P P P P P G PP P P P P P Sbjct: 548 PPGPPGLPGAPGPNGPPGINGPLGPPGEAGPPGNPGGPGYQGNHGNPAGPQGP 600 Score = 28.7 bits (61), Expect = 7.6 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PP P P P P PP PP P PP P Sbjct: 604 PGPPGVNGPPGEIGEIGPAGLPGPPGPASPPSPPGPPGPPGPKGPPGP 651 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PPPP P P P PP PP PPPPPP Sbjct: 398 PGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPPP 441 Score = 37.1 bits (82), Expect = 0.022 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP PP + PP P P PP P PPPPPP Sbjct: 400 PPPPGPPMLNMAPSIPPWQTTPGYIP---PPPPGFPQFQPPPPPPP 442 Score = 36.3 bits (80), Expect = 0.038 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 859 PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P P A P P P P PP P PPPP P Sbjct: 308 PPPAASEPAAFAPAPPPSQAPPPPKTIPSTLPPPPVP 344 Score = 35.5 bits (78), Expect = 0.066 Identities = 25/72 (34%), Positives = 25/72 (34%), Gaps = 13/72 (18%) Frame = +1 Query: 805 LXQXPXXXPPXPPPP-----PPXPXPXAXPPXGXXPXPXPP------XXPPXPP--LXXX 945 L P PP PP P P P P G P P PP P PP Sbjct: 363 LMSTPVQRPPGMRPPGAGNGPGGPPPPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPG 422 Query: 946 XXPPPPPPXPPF 981 PPPPP P F Sbjct: 423 YIPPPPPGFPQF 434 Score = 33.5 bits (73), Expect = 0.27 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +2 Query: 830 PXXPPP-PPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 P PPP PP PP P PP P P P PP PP Sbjct: 398 PGPPPPGPPMLNMAPSIPPWQTTPGYIPP----PPPGFPQFQPPPPP 440 Score = 32.7 bits (71), Expect = 0.47 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 6/53 (11%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPP------XXPXPXPSXPXXXPP 958 P P P PPPP PPP PP P P S P PP Sbjct: 320 PAPPPSQAPPPPKTIPSTLPPPPVPSATSAPPPWATSNSGPKPLMSTPVQRPP 372 Score = 31.9 bits (69), Expect = 0.82 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 831 PXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP 959 P P PP PP PPP P P P PPP Sbjct: 400 PPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPPPP 442 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXP-PXXPPXPPLXXXXXPPPP 963 PP P P A PP P P P P PP+ PPP Sbjct: 307 PPPPAASEPAAFAPAPPPSQAPPPPKTIPSTLPPPPVPSATSAPPP 352 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Frame = +2 Query: 818 PPPXPXXPP-PPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PPP P PPP P P P PP P PP P P Sbjct: 340 PPPVPSATSAPPPWATSNSGPKPLMSTPVQRPPGMRPPGAGNGPGGPPPPWSKP 393 Score = 30.7 bits (66), Expect = 1.9 Identities = 17/55 (30%), Positives = 17/55 (30%), Gaps = 2/55 (3%) Frame = +2 Query: 818 PPPX--PXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PPP P PPPP PPP P P P PP P Sbjct: 329 PPPKTIPSTLPPPPVPSATSAPPPWATSNSGPKPLMSTPVQRPPGMRPPGAGNGP 383 Score = 29.1 bits (62), Expect = 5.8 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = +1 Query: 844 PPPPXPXPXAXPPXGXXPXP-XPPXXPPXP-PLXXXXXPPPPPPXPP 978 P P P PP P P PP P P PPPP PP Sbjct: 360 PKPLMSTPVQRPPGMRPPGAGNGPGGPPPPWSKPGGILPGPPPPGPP 406 Score = 28.7 bits (61), Expect = 7.6 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P P P P P G P P P P PPPP P Sbjct: 360 PKPLMSTPVQRPPGMRPPGAGNGPGGPPPPWSKPGGILPGPPPPGP 405 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 PPPPP P P P PP P PPPPPP F Sbjct: 26 PPPPPTRPFERNIHPRTEPRDRERPPPPPPPRFYDNDIPPPPPPRRGF 73 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXP-PXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P P P P P P PP P PP PPPPPP P Sbjct: 200 PSAAAPKQQKATPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPP 249 Score = 37.9 bits (84), Expect = 0.012 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P P PP P P P PP PP PPPP P Sbjct: 212 PVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPP-------PPPPVKKP 253 Score = 35.5 bits (78), Expect = 0.066 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPL 936 PP P P P P A P P PP PP PP+ Sbjct: 215 PPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPPV 250 Score = 33.1 bits (72), Expect = 0.35 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXP 935 P P P P PP PP P PPP PP P Sbjct: 205 PKQQKATPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 32.3 bits (70), Expect = 0.62 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPP 956 P P PP P PP P P PP P P P P Sbjct: 205 PKQQKATPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +2 Query: 812 NXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPS 937 N P P P PPP PPP P PP P P+ Sbjct: 214 NPPEPDYLEPTPPPPAAPAP-PPPPAAAPPPPPPPPPVKKPA 254 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXA 873 P PP PPPPPP P A Sbjct: 237 PAAAPPPPPPPPPVKKPAA 255 >SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) Length = 86 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 3/52 (5%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP---XPPLXXXXXPPPPPPXPP 978 P PP P P P P PP P P P PP PP+ PP PP Sbjct: 20 PKPPQPTP-PKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQPP 70 Score = 37.1 bits (82), Expect = 0.022 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 6/60 (10%) Frame = +1 Query: 817 PXXXPPXPPPPPPX------PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P PPP P P PP P PP P PPPP P Sbjct: 23 PQPTPPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQPPVTQPPPPVTQSP 82 Score = 34.3 bits (75), Expect = 0.15 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 4/54 (7%) Frame = +1 Query: 829 PPXPPPPPPX-PXPXAXPPXGXXPXPXPPXXPP---XPPLXXXXXPPPPPPXPP 978 PP P PP P P P P P PP P PP+ PP PP Sbjct: 22 PPQPTPPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQPPVTQPP 75 Score = 31.5 bits (68), Expect = 1.1 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 7/58 (12%) Frame = +1 Query: 817 PXXXPPXPP----PPPPXPXPXAXPPXGXXPXPXPPXXPP---XPPLXXXXXPPPPPP 969 P P PP PPP P P P PP P PP+ PPPP Sbjct: 20 PKPPQPTPPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQPPVTQPPPP 77 Score = 30.3 bits (65), Expect = 2.5 Identities = 16/54 (29%), Positives = 16/54 (29%), Gaps = 1/54 (1%) Frame = +2 Query: 818 PPPXPXXPPPP-PXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PPP P PP P PP P PP P P P P Sbjct: 33 PPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQPPVTQPPPPVTQSPEQEP 86 Score = 28.7 bits (61), Expect = 7.6 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP 958 P P PP P PPP P P P P P PP Sbjct: 20 PKPPQPTPPKP-----DTPPPGTNIPTPPSPNTPPPVTQPPVTQPP 60 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/52 (38%), Positives = 22/52 (42%), Gaps = 1/52 (1%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXP-PXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P P PP P P P + P P P P PP P + PPPPPP Sbjct: 765 PQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAPHLPPAPNISAE--PPPPPP 814 Score = 37.5 bits (83), Expect = 0.016 Identities = 21/50 (42%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = +1 Query: 829 PPXPP-PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PP PP PP P P A P P PP P PP+ P PP P P Sbjct: 748 PPAPPLPPKVTPKPPAPPQFA----PVPPPCAPIPPM-PCSAPLPPAPAP 792 Score = 37.1 bits (82), Expect = 0.022 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 6/53 (11%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP------XPPLXXXXXPPPPPP 969 PP PP P P P A P P PP P PP PPPPP Sbjct: 761 PPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAPHLPPAPNISAEPPPPP 813 Score = 35.5 bits (78), Expect = 0.066 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 4/53 (7%) Frame = +1 Query: 829 PPXPP---PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP-PPXP 975 PP PP P PP P A P P P P P PP P PP P Sbjct: 751 PPLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAPHLPPAP 803 Score = 33.5 bits (73), Expect = 0.27 Identities = 19/58 (32%), Positives = 21/58 (36%), Gaps = 1/58 (1%) Frame = +3 Query: 807 LPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP-XPPXPP 977 +P+ PP PP PP P PP P P P P P P P PP Sbjct: 737 IPSPSEVTTKSPPAPP------LPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPP 788 Score = 31.9 bits (69), Expect = 0.82 Identities = 17/56 (30%), Positives = 19/56 (33%) Frame = +1 Query: 802 SLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 S + P PPPPPP + P PP PPPPPP Sbjct: 837 SREEGPSLITAEPPPPPPVARKPSRS-NSTSSQQSIESAPGSPPTGADDFPPPPPP 891 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Frame = +1 Query: 859 PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP--PXPP 978 P P P PP P PP P PPP P PP Sbjct: 738 PSPSEVTTKSPPAPPLPPKVTPKPPAPPQFAPVPPPCAPIPP 779 Score = 31.1 bits (67), Expect = 1.4 Identities = 21/65 (32%), Positives = 21/65 (32%), Gaps = 9/65 (13%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXP--PPXPPXPXP--XXPXXPP-----PX 962 P P P PP PP P P P PP P P P PP Sbjct: 749 PAPPLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAPHLPPAPNISAE 808 Query: 963 PPXPP 977 PP PP Sbjct: 809 PPPPP 813 Score = 29.1 bits (62), Expect = 5.8 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP-PPPXPP 978 PP PP P P P PP P PP P P P PP Sbjct: 748 PPAPPLPPKVTPKP------PAPPQFAPVPPPCAPIPPMPCSAPLPP 788 Score = 28.7 bits (61), Expect = 7.6 Identities = 20/67 (29%), Positives = 20/67 (29%), Gaps = 4/67 (5%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXP---PPPPXXXXXRXPPXXXXXXPXPPPXPPXP-XPXXPXXPP 956 P A P PP P P PP P P P P P P P Sbjct: 748 PPAPPLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAPHLPPAPNISA 807 Query: 957 PXPPXPP 977 PP PP Sbjct: 808 EPPPPPP 814 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 38.7 bits (86), Expect = 0.007 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 2/56 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXX--GGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G G GG G GG GG G G GG G GGGGGG G G Sbjct: 198 GAYGPGGEGGKAFLNGGVGGRSVWNGVPGGFGGGGGVWGNGGGGGGGGGYSGGGSG 253 Score = 33.5 bits (73), Expect = 0.27 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGX-GXGGXGGGXGXXXXXXGGXRXXXXXGGGGG 839 G G GG G G G GG GGG G G GGGGG Sbjct: 217 GRSVWNGVPGGFGGGGGVWGNGGGGGGGGGYSGGGSGNPHYYACGGGGG 265 Score = 32.3 bits (70), Expect = 0.62 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXG 823 G GG GG G G G GG G G G GGGGG G Sbjct: 223 GVPGGFGG---GGGVWGNGGGGGGGGGYSGGGSGNPHYYACGGGGGSYNSG 270 Score = 30.3 bits (65), Expect = 2.5 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = -1 Query: 982 GXGGXGGXGGGXXG--XXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG GG G GG GGG G GG GGGGG GG Sbjct: 204 GEGGKAFLNGGVGGRSVWNGVPGGFGGGGGVWGNGGGG-------GGGGGYSGG 250 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 38.7 bits (86), Expect = 0.007 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -1 Query: 973 GXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGG 875 G GG GGG G G G GG GGG G GG Sbjct: 80 GGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGG 112 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGG 905 G GG GG GGG G G G GG GGG Sbjct: 80 GGGGCGGGGGGGGGVGGGGGGGGGGG 105 Score = 37.5 bits (83), Expect = 0.016 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 GG GGG G G G GG GGG G GG GG G GG Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGG---GGGGGGDDCEDGGGDDGEDGG 120 Score = 37.1 bits (82), Expect = 0.022 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = -3 Query: 929 GXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 G G GG G G GG G G GGGGGG GG Sbjct: 74 GGGDTDGGGGCGGG--GGGGGGVGGGGGGGGGGG 105 Score = 36.7 bits (81), Expect = 0.029 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GGGG GG GG GG G G GG GGG G G Sbjct: 75 GGDTDGGGGC-----GGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDG 119 Score = 35.9 bits (79), Expect = 0.050 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 GG GGGGGG GG GG GG G G G GG G Sbjct: 82 GGCGGGGGGG-----GGVGGGGGGGGGGGDDCEDGGGDDGEDGGSDNDG 125 Score = 33.1 bits (72), Expect = 0.35 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 959 GGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 GGG G GG GG G G GG G GGG G Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDG 116 Score = 33.1 bits (72), Expect = 0.35 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 G GGGGGG GG GG GG G GG G G G Sbjct: 85 GGGGGGGGGV----GGGGGGGGGGGDDCEDGGGDDGEDGGSDNDGDEG 128 Score = 32.3 bits (70), Expect = 0.62 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -2 Query: 957 GGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGG 820 GG G G G G GG G GGG GGG GG Sbjct: 75 GGDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGG 120 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -2 Query: 936 EGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 +G G GG G GGG GGGGG GG Sbjct: 73 DGGGDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGG 112 >SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1172 Score = 38.7 bits (86), Expect = 0.007 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G G +G GG G G G G G G GGGG GG G Sbjct: 418 GSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGGSTGG 468 Score = 36.7 bits (81), Expect = 0.029 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGG 837 GG G G GG GG G G G G GGG GG Sbjct: 417 GGSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGG 463 Score = 35.9 bits (79), Expect = 0.050 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G GGG G G G G G G G G GGG GG Sbjct: 417 GGSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGGSTGG 468 Score = 34.3 bits (75), Expect = 0.15 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GG GG G GG G G G GG G GG G Sbjct: 412 GASSAGGSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGG 464 Score = 32.7 bits (71), Expect = 0.47 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXWXSEX 798 G GGG G G G G G G GG G G GGG G G S Sbjct: 422 GASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGA--GGGGAGGGSTGGASSSGSKSSSS 479 Query: 797 S 795 S Sbjct: 480 S 480 Score = 29.9 bits (64), Expect = 3.3 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG G GG G G GG A G G G G G G G Sbjct: 405 GGSSSGTGASSAGGSSAGASGGGH-KGAGGGSAAGGGTGSGSTGNGNAGNG 454 Score = 29.1 bits (62), Expect = 5.8 Identities = 18/59 (30%), Positives = 18/59 (30%), Gaps = 1/59 (1%) Frame = -1 Query: 973 GXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGG-GXXGGXXXXVGRVS 800 G GG G G G G GGG G G GG G G G S Sbjct: 412 GASSAGGSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGGSTGGAS 470 >SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) Length = 131 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXG 899 GG GG GGG G G G GG GGG G Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 37.5 bits (83), Expect = 0.016 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 973 GXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGG 848 G GG GGG G G G GG GGG G G GG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDGDDDDGDDDDDDDDGG 94 Score = 37.1 bits (82), Expect = 0.022 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGG 849 G GGGGGG GG GG GG G G G GG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDGDDDDGDDDDDDDDGG 94 Score = 36.3 bits (80), Expect = 0.038 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -3 Query: 911 GGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG G G GG G G GGGGGG G G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDGDDDDG 84 Score = 35.5 bits (78), Expect = 0.066 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXG 900 GG GGGGGG GG GG GG G Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 35.1 bits (77), Expect = 0.088 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 967 GGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGG 845 GG GGG G G G GG GGG G G GG Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGGDGDDDDGDDDDDDDDGG 94 Score = 30.7 bits (66), Expect = 1.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXA 870 GG GGGGGG GG G G GG A Sbjct: 61 GGGGGGGGGGGGGGGGGDGDDDDGDDDDDDDDGGDA 96 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 38.7 bits (86), Expect = 0.007 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 5/55 (9%) Frame = +1 Query: 829 PPXPPP---PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP--PPPPXPP 978 P P P PP P P PP G P PP PP PP PP PP Sbjct: 2161 PSGPSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPP 2215 Score = 37.9 bits (84), Expect = 0.012 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 3/52 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP---XPPLXXXXXPPPP 963 P PP PPP P P PP G P PP P PP+ PPP Sbjct: 2166 PLGAPPSVPPPMGAP-PSGPPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPPP 2216 Score = 35.5 bits (78), Expect = 0.066 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 4/54 (7%) Frame = +1 Query: 829 PPXPPPP----PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP P P P P P PP P PP PP P+ PPP PP Sbjct: 2150 PPPPMGPARHSPSGPSPLGAPPSVPPPMGAPPSGPP--PMGAPPSGPPPMGTPP 2201 Score = 32.7 bits (71), Expect = 0.47 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP--XPPXXP 976 PPP PP R P P PP P P + P PP PP P Sbjct: 2140 PPPMGSSRYGPPPPMGPARHSPSGPSPLGAPPSVPPPMGAPPSGPPPMGAPPSGP 2194 Score = 32.3 bits (70), Expect = 0.62 Identities = 20/64 (31%), Positives = 22/64 (34%), Gaps = 6/64 (9%) Frame = +2 Query: 803 HSXNXPPPX---PXXPPP---PPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 HS + P P P PPP PP PP P PP P + P PP Sbjct: 2159 HSPSGPSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPPPSG 2218 Query: 965 PXXP 976 P Sbjct: 2219 SHSP 2222 Score = 31.9 bits (69), Expect = 0.82 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 2/51 (3%) Frame = +3 Query: 828 PPXXPP--PPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P PP PPP PP PPP P P PP P P Sbjct: 2166 PLGAPPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPPP 2216 Score = 29.9 bits (64), Expect = 3.3 Identities = 18/62 (29%), Positives = 19/62 (30%), Gaps = 2/62 (3%) Frame = +1 Query: 799 YSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP--XPPLXXXXXPPPPPPX 972 Y P PP P P P P P PP PP+ PPP Sbjct: 2130 YGAPARPAMGPPPMGSSRYGPPPPMGPARHSPSGPSPLGAPPSVPPPMGAPPSGPPPMGA 2189 Query: 973 PP 978 PP Sbjct: 2190 PP 2191 Score = 29.1 bits (62), Expect = 5.8 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +1 Query: 847 PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PP PP G P P P PP+ PPPP P Sbjct: 2115 PPSMGRYNTPPPMGQYGAPARPAMGP-PPMGSSRYGPPPPMGP 2156 Score = 29.1 bits (62), Expect = 5.8 Identities = 15/47 (31%), Positives = 16/47 (34%), Gaps = 1/47 (2%) Frame = +2 Query: 821 PPXPXXPPP-PPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP 958 PP P P P PP P PP P P + P PP Sbjct: 2150 PPPPMGPARHSPSGPSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPPP 2196 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 38.7 bits (86), Expect = 0.007 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = -1 Query: 973 GXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G GG G G G GG GGG G GG G GGG GG Sbjct: 437 GVGDGRGGDGGGDGGG-GGDGGGDGIDGGDGGGDGGGDGGGDGGGDGGG 484 Score = 38.3 bits (85), Expect = 0.009 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 3/56 (5%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGX---XGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G G RGG GG GG G G GG G G G GGG GG G Sbjct: 429 GDSDGCSSGVGDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDGGG 484 Score = 38.3 bits (85), Expect = 0.009 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGG 846 GG GGG GG GG G GG G G G G G GGG Sbjct: 443 GGDGGGDGGGGGD--GGGDGIDGGDGGGDGGGDGGGDGGGDGGG 484 Score = 35.5 bits (78), Expect = 0.066 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGG-GGXXGG 827 G G G G G GG GGG G GG GGG GG GG Sbjct: 423 GRDDGDGDSDGCSSGVGDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGG 475 Score = 31.9 bits (69), Expect = 0.82 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG G G G G GG G GG G G GGG G GG G Sbjct: 421 GGGRDDGDGDSDGCSSGVGDGRGGDG------GGDGGGGGDGGGDGIDGGDGGG 468 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = -2 Query: 957 GGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 GG +G G G G GGG GGG G G GG Sbjct: 421 GGGRDDGDGDSDGCSSGVGDGRGGDGGGDGGGGGDGGGDGIDGGDGG 467 >SB_49744| Best HMM Match : Tubulin_C (HMM E-Value=6.7) Length = 370 Score = 38.7 bits (86), Expect = 0.007 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GGGGGG G G G G G G G G G G G G G Sbjct: 258 GDGGGGGGGGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDG 311 Score = 33.1 bits (72), Expect = 0.35 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 932 GGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 G G G G G G G G GGGGGG G Sbjct: 234 GDGDGDGDGDGDGDGDGDGDGDGDGDGGGGGGGG 267 Score = 33.1 bits (72), Expect = 0.35 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 932 GGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 G G G G G G G G GGGGGG G Sbjct: 236 GDGDGDGDGDGDGDGDGDGDGDGDGGGGGGGGDG 269 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 38.7 bits (86), Expect = 0.007 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +2 Query: 812 NXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 N PP P PPP PPP P PP P P P P P Sbjct: 62 NPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDP 113 Score = 38.3 bits (85), Expect = 0.009 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = +1 Query: 817 PXXXPPXP-PPPPPXPXPXAXPPXGXXPXPXPPXXP-PXPPLXXXXXPPPPPPXPP 978 P P P PPP P P PP P PP P P P P PPP P Sbjct: 63 PPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTP 118 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 8/61 (13%) Frame = +1 Query: 817 PXXXPPXPP----PPPPXPXPXAXPPXGXXPXPXPPXXP----PXPPLXXXXXPPPPPPX 972 P PP P PPP P P PP P PP P P P PPP P Sbjct: 40 PGDRPPNTPIPGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPI 99 Query: 973 P 975 P Sbjct: 100 P 100 Score = 37.5 bits (83), Expect = 0.016 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP--XPPXXP 976 PP P PPP PPP P PP P P P P PP P Sbjct: 44 PPNTPIPGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTP 98 Score = 37.1 bits (82), Expect = 0.022 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 3/66 (4%) Frame = +2 Query: 788 TXXXTHSXNXPPPXPXXP-PPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP-- 958 T T PPP P PPP PPP P PP P P P P Sbjct: 3 TPPNTAIPGDPPPNTAIPGDPPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIPIPGN 62 Query: 959 XPPXXP 976 PP P Sbjct: 63 PPPNTP 68 Score = 37.1 bits (82), Expect = 0.022 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 8/61 (13%) Frame = +1 Query: 817 PXXXPPXPP----PPPPXPXPXAXPPXGXXPXPXPPXXP----PXPPLXXXXXPPPPPPX 972 P PP P PPP P P PP P PP P P P PPP P Sbjct: 50 PGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPI 109 Query: 973 P 975 P Sbjct: 110 P 110 Score = 36.3 bits (80), Expect = 0.038 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 3/56 (5%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXP---XPXPSXPXXXPPXPPXXP 976 PP P PPP PPP P PP P P P+ P P PP P Sbjct: 54 PPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDP-PPNTP 108 Score = 36.3 bits (80), Expect = 0.038 Identities = 19/59 (32%), Positives = 20/59 (33%), Gaps = 3/59 (5%) Frame = +3 Query: 807 LPTXXXXPPXXP---PPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 +P PP P PPP PP PPP P P P P P P P Sbjct: 57 IPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPPP 115 Score = 35.1 bits (77), Expect = 0.088 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXP 943 PP P PPP PPP P PP P P P Sbjct: 74 PPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPPP 115 Score = 32.7 bits (71), Expect = 0.47 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 4/57 (7%) Frame = +2 Query: 818 PPPXPXXP-PPPPXXXXXXRPPPXXXXPXXXPPXXP---XPXPSXPXXXPPXPPXXP 976 PPP P PPP PP P PP P P P+ P P PP P Sbjct: 23 PPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPPNTPIPGDP-PPNTP 78 Score = 32.7 bits (71), Expect = 0.47 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = +2 Query: 818 PPPXPXXPPP-PPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PPP P PP PPP P PP P P P P P Sbjct: 33 PPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGDP 83 Score = 32.3 bits (70), Expect = 0.62 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 4/48 (8%) Frame = +1 Query: 844 PPPPXPXPXAXPPXGXXPXPXPPXXP----PXPPLXXXXXPPPPPPXP 975 PPP P PP P PP P P P PPP P P Sbjct: 33 PPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPPNTPIPGDPPPNTPIP 80 Score = 29.9 bits (64), Expect = 3.3 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 3/56 (5%) Frame = +3 Query: 810 PTXXXXPPXXP---PPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P PP P PPP PP PPP P P P P P Sbjct: 68 PIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIQGDP 123 Score = 29.5 bits (63), Expect = 4.4 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 6/50 (12%) Frame = +1 Query: 844 PPPPXPXPXAXPPXGXXPXPXPPXX------PPXPPLXXXXXPPPPPPXP 975 PPP P A PP P PP PP P+ PPP P P Sbjct: 23 PPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIPI--PGNPPPNTPIP 70 >SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 650 Score = 38.3 bits (85), Expect = 0.009 Identities = 22/64 (34%), Positives = 22/64 (34%), Gaps = 2/64 (3%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP--PP 969 L L Q P P P PP P P P PP P PP P P PP Sbjct: 500 LLILRQHPSYPPTQPSYPPTPSSYLPTQPYYPPPQPYPPTQPSYPPTPSSYPPTQPSYPP 559 Query: 970 XPPF 981 PF Sbjct: 560 TAPF 563 Score = 34.3 bits (75), Expect = 0.15 Identities = 21/66 (31%), Positives = 24/66 (36%), Gaps = 4/66 (6%) Frame = +1 Query: 796 LYSLXQXPXXXPPXP--PPPPPX--PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 L+ L Q P P P PP P P P + PP P P PP P P Sbjct: 163 LFILRQHPSYPPTQPFYPPTQPFYPPTPSSYPPTQPSYPPTAPSYPPTPSSYPPIAASYP 222 Query: 964 PPXPPF 981 P P + Sbjct: 223 PTAPSY 228 Score = 33.1 bits (72), Expect = 0.35 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAX-PPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P PP P P A PP P P PP P P PP P Sbjct: 201 PPTAPSYPPTPSSYPPIAASYPPTAPSYNPTAPSYPPTPSSYPPTQPSHPPTAP 254 Score = 28.7 bits (61), Expect = 7.6 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 4/53 (7%) Frame = +1 Query: 829 PPXPP--PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP--PPXP 975 PP P PP P P P PP PP P P PP P Sbjct: 187 PPTPSSYPPTQPSYPPTAPSYPPTPSSYPPIAASYPPTAPSYNPTAPSYPPTP 239 >SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 38.3 bits (85), Expect = 0.009 Identities = 21/47 (44%), Positives = 21/47 (44%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 G G GG GG GG GG GG G G GGGGGG G Sbjct: 51 GCGDGGDDCGDDGGAGGGAGGDDDD----GGGISGCGDGGGGGGGAG 93 Score = 35.5 bits (78), Expect = 0.066 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -1 Query: 958 GGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G G GG GGG G GG GGGGG GG Sbjct: 51 GCGDGGDDCGDDGGAGGGAGGDDDDGGGISGCGDGGGGGGGAGG 94 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGG 840 GG GGG GG G G GG G GG A G GGGG Sbjct: 63 GGAGGGAGGDDDDGGGISGCGDGGGG------GGGAGGDDDDGGGG 102 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGG 875 G GG GGG G G G GG GG G GG Sbjct: 68 GAGGDDDDGGGISG-CGDGGGGGGGAGGDDDDGGGG 102 Score = 30.7 bits (66), Expect = 1.9 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = -2 Query: 963 GXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG G +G G GG G GG GG GGG Sbjct: 53 GDGGDDCGDDGGAGGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGGG 101 Score = 29.9 bits (64), Expect = 3.3 Identities = 17/48 (35%), Positives = 19/48 (39%) Frame = -2 Query: 981 EXGXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGG 838 + G GG GG G + G G G G GGG GGGG Sbjct: 58 DCGDDGGAGGGAGGDDDDGGGISG---CGDGGGGGGGAGGDDDDGGGG 102 >SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) Length = 591 Score = 38.3 bits (85), Expect = 0.009 Identities = 25/63 (39%), Positives = 26/63 (41%), Gaps = 2/63 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXX-GGXGXGXXPXGGXAXGXGXG-GGGGGXGGXXXGXWXS 804 G G GG G GG GG G GG A G G G GGGGG G G + S Sbjct: 459 GAYGPGGEGGKAFLNGGVGGRSIWNVVPGGFGGGGGASGGGGGGGGGGGFSGGACGDFTS 518 Query: 803 EXS 795 S Sbjct: 519 GLS 521 Score = 29.5 bits (63), Expect = 4.4 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 967 GGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGG 839 GG GGG G G GG GGG G G GGG Sbjct: 487 GGFGGG--GGASGGGGGGGGGGGFSGGACGDFTSGLSPTCGGG 527 >SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2332 Score = 38.3 bits (85), Expect = 0.009 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P PPP P PP P P P P P PP P P Sbjct: 940 PTPTPPPSPPPKEPTPPPSSKPSPVKEIKPKKPIEKFISRPKPPTPPP 987 >SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) Length = 304 Score = 38.3 bits (85), Expect = 0.009 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -3 Query: 965 GGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGG 840 G GGG GG GG GG G P GG G G GGG G Sbjct: 43 GRGGGRGGPRGGGRGGGRGGGGGFKSPRGG-GRGGGRGGGRG 83 Score = 36.3 bits (80), Expect = 0.038 Identities = 21/53 (39%), Positives = 22/53 (41%) Frame = -1 Query: 964 GXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGR 806 G GGG G G G GG GG G GG R GGG GG + R Sbjct: 43 GRGGGRGGPRGGGRGGGRGGGGGFKSPRGGGR-------GGGRGGGRGVFIAR 88 >SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) Length = 184 Score = 38.3 bits (85), Expect = 0.009 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PP P P P A P P PP P P P PPP P Sbjct: 115 PTPPFSTPRPRPKAKRIRRLLPTPPPPTPPQSTPKPRRVLPTPPPKPP 162 Score = 33.1 bits (72), Expect = 0.35 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPP 933 P PPPP P P P P P P PP Sbjct: 136 PTPPPPTPPQSTPKPRRVLPTPPPKPPTPRPP 167 Score = 30.7 bits (66), Expect = 1.9 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = +3 Query: 804 TLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 TLPT P P P R P P PP P P P PPP PP P Sbjct: 113 TLPTPPFSTPR--PRPKAKRIRRLLPTPPP--PTPPQSTPKPRRVLPT-PPPKPPTP 164 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP 912 P PP PP P P P P P PP Sbjct: 136 PTPPPPTPPQSTPKPRRVLPTPPPKPPTPRPP 167 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 37.9 bits (84), Expect = 0.012 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 900 PXPPPXPPXPXPXXPXXPPPXPPXPP 977 P P P P P P P PPP PP PP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 37.1 bits (82), Expect = 0.022 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPP 882 P PP PPPPPP P P PP Sbjct: 864 PRRPPPPPPPPPPPPPPPPPPP 885 Score = 36.3 bits (80), Expect = 0.038 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 895 PXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P PP PP PPPPPP PP Sbjct: 860 PRPRPRRPPPPPP--PPPPPPPPPPPPP 885 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXP 897 P PP PPPPPP P P G P Sbjct: 867 PPPPPPPPPPPPPPPPPPPASSTGSTP 893 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPP 933 PP PPPPPP P P P P P P Sbjct: 869 PPPPPPPPPPPPPPPPPASSTGSTPGGDKVPSVGP 903 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 802 SLXQXPXXXPPXPPPPPPXPXPXAXPP 882 S + P P PPPPPP P P PP Sbjct: 855 SRYRRPRPRPRRPPPPPPPPPPPPPPP 881 Score = 33.5 bits (73), Expect = 0.27 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPP 882 P P PPPPPP P P PP Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPP 883 Score = 32.3 bits (70), Expect = 0.62 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 870 RXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 R P P PPP PP P P PPP PP Sbjct: 858 RRPRPRPRRPPPPPPPPPPPPP-----PPPPPP 885 Score = 31.9 bits (69), Expect = 0.82 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 853 PXPXPXAXPPXGXXPXPXPPXXPPXP 930 P P P PP P P PP PP P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXP 903 P PP PPPPPP P G P Sbjct: 871 PPPPPPPPPPPPPPPASSTGSTPGGDKVP 899 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXP 909 P PP PPPPPP + P P P Sbjct: 873 PPPPPPPPPPPPPASSTGSTPGGDKVPSVGP 903 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/53 (28%), Positives = 15/53 (28%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P P P P P P P P P P P P P P Sbjct: 473 PSPRPHPSPHPSSNPSPNPSPNPSSDPSPNPSSNPSSDPSPNPSSNPSSEPSP 525 Score = 28.7 bits (61), Expect = 7.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 911 PXXPXPXPSXPXXXPPXPPXXPXS 982 P P P P P PP PP P S Sbjct: 864 PRRPPPPPPPPPPPPPPPPPPPAS 887 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 37.9 bits (84), Expect = 0.012 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP P P P P PP P P P PP PP Sbjct: 450 PLPSDEPPPLPPDEEKPPPPPAPALPPLPLPPELPGSPGDSPPATSPKQPPLPP 503 Score = 32.7 bits (71), Expect = 0.47 Identities = 21/68 (30%), Positives = 22/68 (32%), Gaps = 4/68 (5%) Frame = +3 Query: 786 LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPP----XXXXXXPXPPPXPPXPXPXXPXXP 953 LP + T P PPP P PP P PP P P P Sbjct: 438 LPSLRASAATLPPLPSDEPPPLPP--DEEKPPPPPAPALPPLPLPPELPGSPGDSPPATS 495 Query: 954 PPXPPXPP 977 P PP PP Sbjct: 496 PKQPPLPP 503 Score = 30.7 bits (66), Expect = 1.9 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +1 Query: 844 PPPPXPXPXAXPPXGXXPXPXP-PXXPPXP-PLXXXXXPPPPPP 969 PP P P PP P P P P PP P P P PP Sbjct: 449 PPLPSDEPPPLPPDEEKPPPPPAPALPPLPLPPELPGSPGDSPP 492 Score = 30.3 bits (65), Expect = 2.5 Identities = 17/55 (30%), Positives = 17/55 (30%), Gaps = 5/55 (9%) Frame = +2 Query: 818 PPPXPX-----XPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PPP P PPP P PP P PP P P PP Sbjct: 456 PPPLPPDEEKPPPPPAPALPPLPLPPELPGSPGDSPPATSPKQPPLPPKHSNGPP 510 Score = 29.1 bits (62), Expect = 5.8 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 4/54 (7%) Frame = +1 Query: 829 PPXPPPPPPX----PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP P P P P P PP PP PPP P PP Sbjct: 423 PPAPLPKAHNEKIAPLPSLRASAATLPPLPSDEPPPLPPDEEKPPPPPAPALPP 476 >SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) Length = 291 Score = 37.9 bits (84), Expect = 0.012 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GGGGGG G GG G G G G GGGG GG Sbjct: 224 GGFGGGGGGSEDNGASGGGGGYSGGG------SGTHSGQAGGGGGSYCGG 267 Score = 36.7 bits (81), Expect = 0.029 Identities = 22/55 (40%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXG-GXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GG GG GG G GG G G GG + G GGGGG G G Sbjct: 201 GWVGGRAGGMNSGYNGGPAPGAVGGFGGG----GGGSEDNGASGGGGGYSGGGSG 251 Score = 35.1 bits (77), Expect = 0.088 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG GGG G G G GGG G GGGG GG Sbjct: 221 GAVGGFGGGGGGSEDNGASGGGGGYSGGG---SGTHSGQAGGGGGSYCGG 267 Score = 30.7 bits (66), Expect = 1.9 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGX-GGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG G G G GG GGG GG GGGGG GG Sbjct: 205 GRAGGMNSGYNGGPAPGAVGGFGGG-------GGGSEDNGASGGGGGYSGG 248 Score = 29.5 bits (63), Expect = 4.4 Identities = 17/35 (48%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -3 Query: 935 RGGXGGXXGGXGXGXXPXGGXAXGX--GXGGGGGG 837 +G GG GG G GG A G G GGGGGG Sbjct: 200 KGWVGGRAGGMNSGYN--GGPAPGAVGGFGGGGGG 232 Score = 29.5 bits (63), Expect = 4.4 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -2 Query: 966 GGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG G G G GG GGG G G G GGG Sbjct: 213 GYNGGPAPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSGTHSGQAGGGGG 262 Score = 29.1 bits (62), Expect = 5.8 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = -3 Query: 968 GGGGGGXXXXXRGGX-GGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GG GG GG G G P G G G GGGG G G Sbjct: 192 GERGGSIEKGWVGGRAGGMNSGYNGGPAP--GAVGGFGGGGGGSEDNGASGG 241 >SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) Length = 1197 Score = 37.9 bits (84), Expect = 0.012 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = +1 Query: 865 PXAXPPXGXXPXPXPPXXPPXP---PLXXXXXPPPPPPXP 975 P A PP P PP PP P PL PPPPP P Sbjct: 853 PSAPPPLPPRPVGAPPSLPPRPRTRPLPPKSDTPPPPPRP 892 Score = 33.9 bits (74), Expect = 0.20 Identities = 22/66 (33%), Positives = 23/66 (34%), Gaps = 12/66 (18%) Frame = +1 Query: 817 PXXXPPXPPPP-------PPXPXPXAXPPXGXXPXPXP-PXXPPXPPLXXXXXP----PP 960 P PP PP P PP P PP P P P P + P P Sbjct: 853 PSAPPPLPPRPVGAPPSLPPRPRTRPLPPKSDTPPPPPRPAADESQEMSRTRGPKDGRKP 912 Query: 961 PPPXPP 978 PPP PP Sbjct: 913 PPPPPP 918 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 37.9 bits (84), Expect = 0.012 Identities = 23/61 (37%), Positives = 23/61 (37%), Gaps = 7/61 (11%) Frame = +1 Query: 817 PXXXPPXPPPPPPXP-XPXAXPP-XGXXPXPXPPXXPP-----XPPLXXXXXPPPPPPXP 975 P P PPP P P PP G P PP PP PP PPP P P Sbjct: 363 PPPIIPIPPPAMPAMFNPHVPPPMIGPVTVPPPPLIPPPQASIPPPTMIQTLPPPSVPPP 422 Query: 976 P 978 P Sbjct: 423 P 423 Score = 34.3 bits (75), Expect = 0.15 Identities = 40/175 (22%), Positives = 58/175 (33%), Gaps = 3/175 (1%) Frame = +1 Query: 463 DVNSEGSW--VYEKDVXKITFPLKQKQXEDSQRPVAEPXETTSTNVSRE-EMEFTTESNV 633 D + +G W V ++D T Q ED + P + T V++ E + + S++ Sbjct: 235 DCDEKGGWHMVGQEDEVSKTKSTDLPQVEDISPCNSPPGTLSLTIVAKPCEEQSSLYSDI 294 Query: 634 RDVDVGLETAHXTNEIAKAVEATTYAVHLQRRCRVLADSYHXINLXVXXTDYLXLYSLXQ 813 DV ET + T K + + + +N V D + Sbjct: 295 ASTDV--ETTNDTKSCGKVDDDDDDDDAMSLSSISSNEDTLEVNAPVKNIDSALHKPVIV 352 Query: 814 XPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PPPP P P P P PP P PPP PP Sbjct: 353 PPPNLLFSFPPPPIIPIPPPAMPAMFNPHVPPPMIGPVTVPPPPLIPPPQASIPP 407 Score = 33.1 bits (72), Expect = 0.35 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXP 954 P P PPPP P P A P PP P PP+ P Sbjct: 385 PMIGPVTVPPPPLIPPPQASIPPPTMIQTLPPPSVPPPPIGVPNRP 430 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 37.5 bits (83), Expect = 0.016 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGX-GXXPXGGXAXGXGXGGGGGGXG 831 GG G GGGG GG G GG GG G GGGGG G Sbjct: 203 GGRGRGGGGRGGYGGGGGYGGYGGYDQYSGGGYGGYGDSYGSYGGGGGYG 252 Score = 31.5 bits (68), Expect = 1.1 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXG 830 G GG GG GG G G GG GG GG GGGG G Sbjct: 208 GGGGRGGYGG------GGGYGGYGGYDQYSGGGYGGYGDSYGSYGGGGGYG 252 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 37.5 bits (83), Expect = 0.016 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 PP PPPP P P P PP P P P PP P Sbjct: 424 PPPPPPPAPLPPPPPPPPQPTTALPDPLQGPEVALHVEVSSPPDQP 469 Score = 31.9 bits (69), Expect = 0.82 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 3/51 (5%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXP---PLXXXXXPPPPPPXPPF 981 PPPPPP P P PP P P P P P P PP PF Sbjct: 424 PPPPPP-PAPLPPPP---PPPPQPTTALPDPLQGPEVALHVEVSSPPDQPF 470 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 918 PPXPXPXXPXXPPPXPPXPP 977 PP P P P PPP PP P Sbjct: 424 PPPPPPPAPLPPPPPPPPQP 443 Score = 29.1 bits (62), Expect = 5.8 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP 960 P P P PP P P PP PP PP P P Sbjct: 409 PFPTPNRRRRRSLVQPPPPPPPAPLPP-PPPPPPQPTTALPDP 450 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 37.5 bits (83), Expect = 0.016 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXG 899 G G GG GGG G G G GG GGG G Sbjct: 338 GSGRGGGGGGGGGGGGGGGGGGRGGGGG 365 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -3 Query: 887 PXGGXAXGXGXGGGGGGXGGXXXG 816 P GG G G GGGGGG GG G Sbjct: 335 PRGGSGRGGGGGGGGGGGGGGGGG 358 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 935 RGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 RGG G GG G G GG G G GGG G Sbjct: 336 RGGSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRG 370 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -3 Query: 911 GGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG G G GG G G GGGGGG GG Sbjct: 337 GGSGRGGG--GGGGGGGGGGGGGGGRGG 362 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 973 GXGGXGGGXXGXXGXGXGGXGGGXG 899 G G GGG G G G GG GGG G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRG 361 Score = 33.5 bits (73), Expect = 0.27 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXP 885 GG GGGGGG GG GG G G P Sbjct: 343 GGGGGGGGGGGGGGGGGRGGGGGFSSRGRGP 373 Score = 32.7 bits (71), Expect = 0.47 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 896 GXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GG G G GGGGGG GG G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGG 363 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXP 885 GG GGGGGG G GG G G P Sbjct: 345 GGGGGGGGGGGGGGGRGGGGGFSSRGRGPPP 375 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 958 GGGXXGXXGXGXGGXGGGXGXXXXXXGG 875 GG G G G GG GGG G GG Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGG 364 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 958 GGGXXGXXGXGXGGXGGGXGXXXXXXGG 875 G G G G G GG GGG G GG Sbjct: 338 GSGRGGGGGGGGGGGGGGGGGGRGGGGG 365 >SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 37.5 bits (83), Expect = 0.016 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GGG GG GG G G G G G GGGGG G G Sbjct: 270 GNAGGGAGEGSTGGPGGINAGGGGGDSTTDSD-DGAGGGGGGGHFSGGAGG 319 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGG 906 GG GGGGGG GG GG GG Sbjct: 397 GGGGGGGGGSAFGIEGGRGGHGGG 420 Score = 33.5 bits (73), Expect = 0.27 Identities = 28/97 (28%), Positives = 32/97 (32%), Gaps = 1/97 (1%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXG-GXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGR 806 G GG GGG G G GGG G GG GG G +G Sbjct: 283 GPGGINAGGGGGDSTTDSDDGAGGGGGGGHFSGGAGGAAATGCTNQYGGSGGIASSTIGA 342 Query: 805 VSXAXGSQXFXQXD*SNDXNRQELGIVSGGGQRTWSL 695 + GS N N + G SGG T S+ Sbjct: 343 CAGGGGSS---NCQAGNGGNSCQRGGQSGGAAGTASM 376 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGG 905 GG GG GGG G GG GGG Sbjct: 397 GGGGGGGGGSAFGIEGGRGGHGGG 420 Score = 29.5 bits (63), Expect = 4.4 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 7/55 (12%) Frame = -3 Query: 959 GGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGX-------GXGGGGGGXGGXXXG 816 G G RGG G G GG G GGGGGG GG G Sbjct: 355 GNGGNSCQRGGQSGGAAGTASMGGGGGGLQFGNQDYTSRLSYGGGGGGGGGSAFG 409 >SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) Length = 496 Score = 37.5 bits (83), Expect = 0.016 Identities = 19/59 (32%), Positives = 21/59 (35%) Frame = +1 Query: 802 SLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 SL + P P PP PP P P P P P P+ P PP PP Sbjct: 281 SLIRYPTLPPRYPPSPPRYPPSPPRYPPSLHRYPQSPLRYPPSPIRYPPLPSRYPPSPP 339 Score = 36.7 bits (81), Expect = 0.029 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 7/61 (11%) Frame = +1 Query: 817 PXXXPPXPPPPPPX-----PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXP--PPPPPXP 975 P PP PP PP P PP P P PP PP P PP PP Sbjct: 296 PPRYPPSPPRYPPSLHRYPQSPLRYPPSPIRYPPLPSRYPPSPPRYPSSHPRYPPSPPRY 355 Query: 976 P 978 P Sbjct: 356 P 356 Score = 35.5 bits (78), Expect = 0.066 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXPXS 982 PP P PP PP P P PP P P P PP PP P S Sbjct: 293 PPSPPRYPPSPPRYPPSLHRYPQS--PLRYPPS-PIRYPPLPSRYPPSPPRYPSS 344 Score = 35.1 bits (77), Expect = 0.088 Identities = 21/61 (34%), Positives = 22/61 (36%), Gaps = 5/61 (8%) Frame = +3 Query: 810 PTXXXXPPXXPPPPP-----XXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P+ PP P PP R PP P P PP P P P P PP P Sbjct: 294 PSPPRYPPSPPRYPPSLHRYPQSPLRYPPSPIRYPPLPSRYPPSP-PRYPSSHPRYPPSP 352 Query: 975 P 977 P Sbjct: 353 P 353 Score = 33.9 bits (74), Expect = 0.20 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P PP PP R P P PP PP P P P P PP P Sbjct: 331 PSRYPPSPP-----RYPSSHPRYPPSPPRYPPSP-PRYPSSHPRYPPSP 373 Score = 33.1 bits (72), Expect = 0.35 Identities = 21/60 (35%), Positives = 22/60 (36%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 L+ Q P PP P PP P PP P PP PP PP PP P Sbjct: 310 LHRYPQSPLRYPPSPIRYPPLPS--RYPPSPPRYPSSHPRYPPSPP----RYPPSPPRYP 363 Score = 33.1 bits (72), Expect = 0.35 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = +1 Query: 817 PXXXPPXPP--PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 P PP P PP P P + P P PP PP PP P PP Sbjct: 324 PIRYPPLPSRYPPSPPRYPSSHPRY----PPSPPRYPPSPPRYPSSHPRYPP 371 Score = 31.9 bits (69), Expect = 0.82 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P P PP P PP P PP PP P P P P PP Sbjct: 317 PLRYPPSPIRYPPLPSRYPPS-PPRYPSSHPRYPPSPPRYPPSPPRYPSSHPRYPP 371 Score = 30.7 bits (66), Expect = 1.9 Identities = 21/67 (31%), Positives = 22/67 (32%), Gaps = 4/67 (5%) Frame = +3 Query: 786 LPXAXLTLPTXXXXPPXXPP-PPPXXXXXRXPPXXXXXXPXPPPXPPXPXP---XXPXXP 953 LP P+ PP P PP PP P PP PP P P P Sbjct: 258 LPSPPRYPPSPLRYPPIPPRYPPSLIRYPTLPPRYPPSPPRYPPSPPRYPPSLHRYPQSP 317 Query: 954 PPXPPXP 974 PP P Sbjct: 318 LRYPPSP 324 Score = 30.7 bits (66), Expect = 1.9 Identities = 21/67 (31%), Positives = 21/67 (31%), Gaps = 11/67 (16%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXX---------RXPPXXXXXXPXPPPXPPXPXPXXPXXP--P 956 P PP PP PP R PP P P PP P P P Sbjct: 290 PRYPPSPPRYPPSPPRYPPSLHRYPQSPLRYPPSPIRYPPLPSRYPPSPPRYPSSHPRYP 349 Query: 957 PXPPXPP 977 P PP P Sbjct: 350 PSPPRYP 356 Score = 30.3 bits (65), Expect = 2.5 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +2 Query: 830 PXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXPXS 982 P P PP PP P P P P PP PP P S Sbjct: 259 PSPPRYPPSPLRYPPIPPRYPPSLIRYPTLPPRYPPSPPRYPPSPPRYPPS 309 Score = 29.9 bits (64), Expect = 3.3 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 1/55 (1%) Frame = +1 Query: 817 PXXXPPXPPP-PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP PP PP P P PP P P P PP Sbjct: 268 PLRYPPIPPRYPPSLIRYPTLPPRYPPSPPRYPPSPPRYPPSLHRYPQSPLRYPP 322 Score = 29.1 bits (62), Expect = 5.8 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PP P PP P R PP PP P P P P PP Sbjct: 265 PPSPLRYPPIPP-----RYPPSLIRYPTLPPRYPPSPPRYPPSPPRYPP 308 Score = 29.1 bits (62), Expect = 5.8 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXPXS 982 PP P PP P R PP P P P PS P PP PP P S Sbjct: 321 PPSPIRYPPLPS-----RYPPS---PPRYPSSHPRYPPSPPRY-PPSPPRYPSS 365 Score = 28.7 bits (61), Expect = 7.6 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXPXS 982 P P PP PP PP P P P P PP P P S Sbjct: 286 PTLPPRYPPSPPRYPPS---PPRYPPSLHRYPQSPLRYPPSPIRYPPLPSRYPPS 337 >SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 37.1 bits (82), Expect = 0.022 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 3/50 (6%) Frame = +1 Query: 829 PPXPPP---PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PP PP PPP P PP G P PP P PP P PPPP Sbjct: 208 PPNAPPGLMPPPGMLP---PPGGMPPGRMPPQGLPFPP----PGPIPPPP 250 Score = 34.7 bits (76), Expect = 0.12 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 850 PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP P PP G P P PP PP P P PP Sbjct: 208 PPNAPPGLMPPPGMLPPPGGMPPGRMPPQGLPFPPPGPIPPPP 250 Score = 28.7 bits (61), Expect = 7.6 Identities = 16/55 (29%), Positives = 17/55 (30%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 +S P P PPP PP P P P P P P PP Sbjct: 204 NSQMPPNAPPGLMPPPGMLPPPGGMPPGRMPPQGLPFPPPGPIPPPPGAGGMRPP 258 >SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 37.1 bits (82), Expect = 0.022 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G G GG G GG GG GG G GGGGGG GG G Sbjct: 440 GSRGTGGEGGKSFLAGGAGGR-SNQNDVEGGFGGGGGPNGAGGGGGGGGGYSGG 492 Score = 34.7 bits (76), Expect = 0.12 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 GG GG GG G GG GGG G G R GGGG G Sbjct: 468 GGFGGGGGPN------GAGGGGGGGGGYSGGASGSRSNSCGGGGGSYNAG 511 Score = 31.5 bits (68), Expect = 1.1 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 5/55 (9%) Frame = -3 Query: 977 GGXGG-----GGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GG GG G GG GG G P G G G GG GG G Sbjct: 445 GGEGGKSFLAGGAGGRSNQNDVEGGFGGGGG----PNGAGGGGGGGGGYSGGASG 495 Score = 31.5 bits (68), Expect = 1.1 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 5/56 (8%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGG-----GGGXGGXXXG 816 G GG GG GG G G G GG G G GGG G G Sbjct: 456 GAGGRSNQNDVEGGFGGGGGPNGAGGGGGGGGGYSGGASGSRSNSCGGGGGSYNAG 511 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGG 840 GG GGGGGG G GG G + G G G Sbjct: 480 GGGGGGGGGYSGGASGSRSNSCGGGGGSYNAGSDKSQQAGANNGAG 525 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGG 908 G GG GG GG G GG GG Sbjct: 482 GGGGGGGYSGGASGSRSNSCGGGGG 506 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 37.1 bits (82), Expect = 0.022 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPP 933 P PPPPPP P P P P P P PP Sbjct: 1660 PAPPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPP 1694 Score = 35.5 bits (78), Expect = 0.066 Identities = 22/63 (34%), Positives = 23/63 (36%), Gaps = 3/63 (4%) Frame = +1 Query: 799 YSLXQXPXXXPPXPPPP-PPXP-XPXAXP-PXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 Y + P PP PP P PP P P P P G PP P P P P Sbjct: 1654 YPVFHYPAPPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPGYPGAPA 1713 Query: 970 XPP 978 PP Sbjct: 1714 GPP 1716 Score = 32.3 bits (70), Expect = 0.62 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Frame = +3 Query: 831 PXXPPPPPXXXXXRXPPXXXXXXP--XPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PP + P P PP PP P P PP PP Sbjct: 1799 PPGPPGPPGAIGWKGNPGNPAGPPGLDGPPGPPGPQGPKGWPGVPGPPGPP 1849 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/59 (30%), Positives = 18/59 (30%), Gaps = 1/59 (1%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXP-XPXPSXPXXXPPXPPXXP 976 H PPP P P PP P P PP P P P P P P Sbjct: 1658 HYPAPPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPGYPGAPAGPP 1716 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 37.1 bits (82), Expect = 0.022 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPP 882 P PP PPPPPP P P PP Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPP 1328 Score = 35.9 bits (79), Expect = 0.050 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXPXPXAXP 879 Q P PP PPPPPP P P P Sbjct: 1306 QPPESPPPPPPPPPPPPPPPLPP 1328 Score = 35.1 bits (77), Expect = 0.088 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 906 PPPXPPXPXPXXPXXPPPXPPXPP 977 PP PP P P P PPP PP PP Sbjct: 1307 PPESPPPPPP--PPPPPPPPPLPP 1328 Score = 35.1 bits (77), Expect = 0.088 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +1 Query: 907 PPXXPPXPPLXXXXXPPPPPPXPP 978 PP PP PP PPPPPP PP Sbjct: 1307 PPESPPPPP--PPPPPPPPPPLPP 1328 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 900 PXPPPXPPXPXPXXPXXPPPXPPXP 974 P PP PP P P P PPP PP P Sbjct: 1308 PESPPPPPPPPPPPP--PPPLPPTP 1330 Score = 33.1 bits (72), Expect = 0.35 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXP 897 P PPPPPP P P PP P Sbjct: 1308 PESPPPPPPPPPPPPPPPLPPTP 1330 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 877 PPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 PP P P PP PP PPL PP P Sbjct: 1307 PPESPPPPPPPPPPPPPPPL-----PPTP 1330 Score = 29.9 bits (64), Expect = 3.3 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXP 930 PP PP P P PP P P PP PP P Sbjct: 1307 PPESPPPPPP---PP----PPPPPPPLPPTP 1330 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXP 903 P PPPP P P PP P P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 901 PXPPXXPPXPPLXXXXXPPPPPPXP 975 P PP PP PP PPP PP P Sbjct: 1311 PPPPPPPPPPP-----PPPPLPPTP 1330 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXP 867 P PP PPPPP P P Sbjct: 1314 PPPPPPPPPPPPLPPTP 1330 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 37.1 bits (82), Expect = 0.022 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 865 PXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 P PP P P PP P PP PPPP P F Sbjct: 179 PPPAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAPPTF 217 Score = 30.3 bits (65), Expect = 2.5 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P PPP PP P PPP PP PPP PP Sbjct: 174 PGILAPPPAPPGVLAPPPAPPGVLP-PPPAPPGAL----IPPPPAPP 215 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP 912 P P P PP P P A P P P PP Sbjct: 184 PGVLAPPPAPPGVLPPPPAPPGALIPPPPAPP 215 >SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) Length = 800 Score = 37.1 bits (82), Expect = 0.022 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG G G G G G GG G P GG G GGG G G G Sbjct: 325 GGDGDHGDGDHGGGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDG 378 Score = 37.1 bits (82), Expect = 0.022 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G G GGG G G GG G P GG G GGG G G G Sbjct: 331 GDGDHGGGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGG 383 Score = 35.9 bits (79), Expect = 0.050 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 3/55 (5%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGG---GGGXXGG 827 G G G GGG G G G GGG GG GG GGG GG Sbjct: 338 GDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHGGGDHGG 392 Score = 35.9 bits (79), Expect = 0.050 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 2/56 (3%) Frame = -3 Query: 977 GGXGGG--GGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GGG GGG G GG GG G GG G G GGG GG G Sbjct: 338 GDPGGGDPGGGDPGGGDPG-GGDPGGGDHGGGDHGGGDHGDGDHGGGDHGGGDHGG 392 Score = 34.7 bits (76), Expect = 0.12 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = -3 Query: 977 GGXGGG--GGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 G GGG GGG G GG GG G GG G G GGG GG Sbjct: 348 GDPGGGDPGGGDPGGGDHG-GGDHGGGDHGDGDHGGGDHGGGDHGGGDHGGG 398 Score = 33.5 bits (73), Expect = 0.27 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXG 830 G G G GGG G G G GGG GG GGG G Sbjct: 328 GDHGDGDHGGGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDG 378 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 3/55 (5%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGG---GGGXXGG 827 G G G GGG G G G GGG GG G GGG GG Sbjct: 333 GDHGGGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHGG 387 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 3/55 (5%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGG---GGGXXGG 827 G G G GGG G G G GGG G GG GGG GG Sbjct: 343 GDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHGGGDHGGGDHGG 397 Score = 33.1 bits (72), Expect = 0.35 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 2/56 (3%) Frame = -3 Query: 977 GGXGGG--GGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GGG GGG G GG GG G G G G GGG GG G Sbjct: 343 GDPGGGDPGGGDPGGGDPG-GGDHGGGDHGGGDHGDGDHGGGDHGGGDHGGGDHGG 397 Score = 31.5 bits (68), Expect = 1.1 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 3/51 (5%) Frame = -2 Query: 966 GGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGG---GGGXXGXG 823 G GG G G G GG G GGG GG GGG G G Sbjct: 353 GDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHGGGDHGGGDHGGGDYGDG 403 Score = 30.7 bits (66), Expect = 1.9 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXG 830 G G G GGG G G G GGG GG G G G Sbjct: 358 GDPGGGDHGGGDHGGGDHGDGDHGGGDHGGGDHGGGDHGGGDYGDGDHGDG 408 Score = 30.3 bits (65), Expect = 2.5 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGG GG G G G GG G GGG G G G Sbjct: 356 GGGDPGGGDHGGGDHGGGDHGDGDHGGGDH-GGGDHGGGDHGGGDYGDGDHGDG 408 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 36.7 bits (81), Expect = 0.029 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P + P P P P P PPPPPP PP Sbjct: 321 PDSTPATNAPPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPP 367 Score = 36.3 bits (80), Expect = 0.038 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +1 Query: 850 PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP P P P P P P L PPPPPP PP Sbjct: 330 PPSDSPSTTTPTTPQP-PTPTTPKTHPQLGPPPPPPPPPPTPP 371 Score = 35.5 bits (78), Expect = 0.066 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPP 933 P P P PP P P G P P PP PP PP Sbjct: 335 PSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPP--PPTPP 371 Score = 34.7 bits (76), Expect = 0.12 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP P P PP P P PP PP PPPPP PP Sbjct: 330 PPSDSPSTTTPTTPQ-PPTPTTPKTHPQLGPPPPP------PPPPPTPPP 372 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPP 882 P P PPPPP P P PP Sbjct: 351 PKTHPQLGPPPPPPPPPPTPPP 372 Score = 28.7 bits (61), Expect = 7.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 788 TXXXTHSXNXPPPXPXXPPPPP 853 T TH PPP P PPP P Sbjct: 349 TTPKTHPQLGPPPPPPPPPPTP 370 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 36.7 bits (81), Expect = 0.029 Identities = 29/91 (31%), Positives = 33/91 (36%) Frame = +3 Query: 687 SCRSDHVRCPPPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXXPPPPPXXXX 866 SCR + RCP + SSC ++ C T T PP PPPP Sbjct: 60 SCRDNDKRCP---SWASSCNSNQYVKNNCKK--------TCGTCGDPPPPATPPPP---- 104 Query: 867 XRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP 959 PP P PP P P P P P P Sbjct: 105 -TMPP-----TPPPPQTPAPPGPDTPAPPAP 129 Score = 33.1 bits (72), Expect = 0.35 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 906 PPPXPPXPXPXXPXXPPPXPPXPP 977 PPP P P P PPP P PP Sbjct: 96 PPPATPPPPTMPPTPPPPQTPAPP 119 Score = 32.3 bits (70), Expect = 0.62 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 859 PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 P P A PP P PP P PP PP P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 31.9 bits (69), Expect = 0.82 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 886 GXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 G P PP PP PP PPP P PP Sbjct: 90 GTCGDPPPPATPP-PPTMPPTPPPPQTPAPP 119 Score = 31.9 bits (69), Expect = 0.82 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPP 933 PP P PPP P PP P P P P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 1/27 (3%) Frame = +3 Query: 900 PXPPPXPPXPXPXX-PXXPPPXPPXPP 977 P PP PP P P P P P P PP Sbjct: 101 PPPPTMPPTPPPPQTPAPPGPDTPAPP 127 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 877 PPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP P P P PP P P P P P Sbjct: 96 PPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 28.7 bits (61), Expect = 7.6 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +1 Query: 877 PPXGXXPXPXPPXXPPXPPLXXXXXPP-PPPPXPP 978 PP P PP PP PP PP P P PP Sbjct: 95 PPPPAT--PPPPTMPPTPPPPQTPAPPGPDTPAPP 127 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 36.3 bits (80), Expect = 0.038 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 2/59 (3%) Frame = +3 Query: 807 LPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPP-XPPXPXPXXPXXPPP-XPPXPP 977 LPT P P P P PPP PP P P P PPP PP P Sbjct: 1001 LPTSGPTNPGTTTNVPDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDPPTQP 1059 Score = 36.3 bits (80), Expect = 0.038 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +1 Query: 805 LXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPP 933 L P PP PP PP P PP P PP PP P Sbjct: 1019 LPTDPPTEPPTDPPTPPPTEPPTPPP--TEPPTPPPTDPPTQP 1059 Score = 35.9 bits (79), Expect = 0.050 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P P P P P P P PP PP PPP P Sbjct: 1002 PTSGPTNPGTTTNVPDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDP 1055 Score = 34.3 bits (75), Expect = 0.15 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +1 Query: 847 PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P P P P P P PP PP PP P Sbjct: 1016 PDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDPPTQP 1059 Score = 32.3 bits (70), Expect = 0.62 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = +2 Query: 812 NXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXP 955 N P P P PP P PP P P P P P+ P P Sbjct: 1014 NVPDPLPTDPPTEPPTDPP--TPPPTEPPTPPPTEPPTPPPTDPPTQP 1059 Score = 28.7 bits (61), Expect = 7.6 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXG 830 GG G GGG G G GG GG GGGG G Sbjct: 802 GGMGMSGGGSMG--AHGGGGMAGGGSSMGGAGSTVHGGLDMDGGGGVIG 848 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 36.3 bits (80), Expect = 0.038 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXP 903 PP PPPPPP P P PP P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 35.1 bits (77), Expect = 0.088 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 799 YSLXQXPXXXPPXPPPPPPXPXPXAXPP 882 Y P PP PPPPPP P P + P Sbjct: 48 YDDDHDPPPPPPPPPPPPPPPPPPSSSP 75 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPL 936 PPPPPP P P PP P P PP P PL Sbjct: 54 PPPPPPPPPP---PP----PPPPPPSSSPSRPL 79 Score = 33.5 bits (73), Expect = 0.27 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +1 Query: 907 PPXXPPXPPLXXXXXPPPPPPXPP 978 PP PP PP PPPPPP PP Sbjct: 54 PPPPPPPPP------PPPPPPPPP 71 Score = 32.7 bits (71), Expect = 0.47 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 900 PXPPPXPPXPXPXXPXXPPPXPPXP 974 P PPP PP P P P P P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 32.7 bits (71), Expect = 0.47 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 906 PPPXPPXPXPXXPXXPPPXPPXPP 977 PPP PP P P P PP P P Sbjct: 55 PPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 31.9 bits (69), Expect = 0.82 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 895 PXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PP PP PP PPPPP P Sbjct: 54 PPPPPPPPPPPPP------PPPPPSSSP 75 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRP 877 PPP P PPPPP RP Sbjct: 59 PPPPPPPPPPPPPSSSPSRP 78 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXP 879 P PP PPPPPP + P Sbjct: 58 PPPPPPPPPPPPPPSSSPSRP 78 >SB_29930| Best HMM Match : Collagen (HMM E-Value=0.067) Length = 129 Score = 36.3 bits (80), Expect = 0.038 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GGGG GG G GG G GG G GGG G G Sbjct: 78 GGCEGGGGSGGCEGGGGCVGCEGGGGCVGCEGGGGCVGCEGGGGCVGCEG 127 Score = 31.5 bits (68), Expect = 1.1 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGG-GGXXGG 827 G GG G GG G G G GG G GG GGG G GG Sbjct: 76 GCGGCEGGGGSGGCEGGGGCVGCEGGGGCVGCEGGGGCVGCEGGGGCVGCEGG 128 >SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) Length = 1439 Score = 36.3 bits (80), Expect = 0.038 Identities = 18/57 (31%), Positives = 19/57 (33%) Frame = +3 Query: 807 LPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 +PT PP PPP P P PPP P P PP PP Sbjct: 508 VPTTVTAPPAAPPPSVFAPSSGVPTPVTEPPPAPPPSVFAPSSGVPTPVTAPPPAPP 564 Score = 32.3 bits (70), Expect = 0.62 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PPP P P P PP P PPP PP Sbjct: 515 PPAAPPPSVFAPSSGVPTPVTEPPPAPPPSVFAPSSGVPTPVTAPPPAPP 564 Score = 32.3 bits (70), Expect = 0.62 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PPP P P A P PP PP P P PP Sbjct: 533 PVTEPPPAPPPSVFAPSSGVPTPVTAPPPAPPPSVFAPSSAVPTPATAPP 582 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 3/54 (5%) Frame = +3 Query: 807 LPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPP---XPPXPXPXXPXXPPP 959 +PT PP PPP P P PPP P P PPP Sbjct: 530 VPTPVTEPPPAPPPSVFAPSSGVPTPVTAPPPAPPPSVFAPSSAVPTPATAPPP 583 Score = 30.7 bits (66), Expect = 1.9 Identities = 15/51 (29%), Positives = 15/51 (29%) Frame = +2 Query: 824 PXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 P P PPP P P PP P P P P P P Sbjct: 531 PTPVTEPPPAPPPSVFAPSSGVPTPVTAPPPAPPPSVFAPSSAVPTPATAP 581 Score = 28.7 bits (61), Expect = 7.6 Identities = 24/92 (26%), Positives = 27/92 (29%), Gaps = 1/92 (1%) Frame = +3 Query: 705 VRCPPPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPX 884 V PPP PS S + P + P+ P PPP P Sbjct: 454 VTAPPPAPPPSVFAPSSGVPTPVAA---PPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPT 510 Query: 885 XXXXXPX-PPPXPPXPXPXXPXXPPPXPPXPP 977 P PPP P P PP PP Sbjct: 511 TVTAPPAAPPPSVFAPSSGVPTPVTEPPPAPP 542 Score = 28.7 bits (61), Expect = 7.6 Identities = 15/51 (29%), Positives = 15/51 (29%) Frame = +2 Query: 830 PXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXPXS 982 P PPP P P P PP P P PP P S Sbjct: 516 PAAPPPSVFAPSSGVPTPVTEPPPAPPPSVFAPSSGVPTPVTAPPPAPPPS 566 >SB_22536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 593 Score = 36.3 bits (80), Expect = 0.038 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -2 Query: 966 GGXGGXXXGXE-GXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGGXLXE 805 G GG G G G G G GGG GGGGG G G G L E Sbjct: 250 GWVGGKAGGMNSGYNGGPPPGAVGGFGGWGGGSEDNGASGGGGGYSGGGSGTLKE 304 Score = 33.1 bits (72), Expect = 0.35 Identities = 21/55 (38%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXG-GXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GG GG GG G GG G GG + G GGGGG G G Sbjct: 250 GWVGGKAGGMNSGYNGGPPPGAVGGFGG----WGGGSEDNGASGGGGGYSGGGSG 300 >SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 36.3 bits (80), Expect = 0.038 Identities = 25/59 (42%), Positives = 25/59 (42%), Gaps = 3/59 (5%) Frame = -3 Query: 977 GGXGGGGGGXXXXX-RGGXGGXXGGXGXGXXPXGGXAXGXGXGGG--GGGXGGXXXGXW 810 GG GG GGG RGG G GG G GG G G GG GG GG W Sbjct: 190 GGRGGRGGGRGAPRGRGGPRGGGGGSG---GYGGGSYGGYGNYGGYSQGGYGGYADNSW 245 Score = 35.5 bits (78), Expect = 0.066 Identities = 18/41 (43%), Positives = 19/41 (46%) Frame = -3 Query: 932 GGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXW 810 GG GG GG G G G G GGG GG GG G + Sbjct: 187 GGRGGR-GGRGGGRGAPRGRGGPRGGGGGSGGYGGGSYGGY 226 Score = 35.1 bits (77), Expect = 0.088 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = -3 Query: 935 RGGXGGXXGGXGXGXXPXGGXAXGXGXGG-GGGGXGG 828 RGG GG GG G G G G GG GGG GG Sbjct: 189 RGGRGGRGGGRGAPRGRGGPRGGGGGSGGYGGGSYGG 225 Score = 34.7 bits (76), Expect = 0.12 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GG GG RGG GG G P GG G GGG G G G Sbjct: 185 GAGGRGG------RGGRGGGRGAPRGRGGPRGGGGGSGGYGGGSYGGYGNYGG 231 Score = 33.9 bits (74), Expect = 0.20 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXG--XGGXGGGXGXXXXXXGGXRXXXXXGGGG 842 G GG GG GGG G G GG GG G GG GG Sbjct: 188 GRGGRGGRGGGRGAPRGRGGPRGGGGGSGGYGGGSYGGYGNYGGYSQGG 236 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/59 (33%), Positives = 22/59 (37%), Gaps = 2/59 (3%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXG--GXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXWXS 804 G GGG GG GG G G G G + G G GG G GG + S Sbjct: 210 GGGGGSGGYGGGSYGGYGNYGGYSQGGYGGYADNSWSGGYGSYDGGYGNGGDYSNGYSS 268 Score = 32.7 bits (71), Expect = 0.47 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXG-XGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG G GGG G G G GG G G GG GG G GG Sbjct: 204 GRGGPRGGGGGS-GGYGGGSYGGYGNYGGYSQGGYGGYADNSWSGGYGSYDGG 255 >SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) Length = 472 Score = 36.3 bits (80), Expect = 0.038 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GG G GG G G G GG G GG G GG Sbjct: 124 GGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGGSTSGSSSGGATSGGGG 173 Score = 35.1 bits (77), Expect = 0.088 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGG--GGGGXGGXXXG 816 GG GG G G GG G G GG G G GG GG G G Sbjct: 110 GGEAGGEAGGQAGGGGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGGSTSGSSSG 165 Score = 34.3 bits (75), Expect = 0.15 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGG G GG GG G G A G G GGGG GG G Sbjct: 104 GGTAEGGGEAG----GEAGGQAGGGGQAGGQAGSQAGG-GAAGGGGQEGGGQGG 152 Score = 33.1 bits (72), Expect = 0.35 Identities = 21/54 (38%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGG---GGXGGXXXG 816 GGG G + G GG GG G GG A G G GGG GG G Sbjct: 109 GGGEAGGEAGGQAGGGGQAGGQA-GSQAGGGAAGGGGQEGGGQGGAQAGGSTSG 161 Score = 32.3 bits (70), Expect = 0.62 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G G G GG GG G GG A GG GG G G Sbjct: 99 GASTSGGTAEGGGEAGGEAGGQAGGGGQAGGQAGSQAGGGAAGGGGQEGGG 149 Score = 32.3 bits (70), Expect = 0.62 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 5/59 (8%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGG--XGGXXGGXGXGXXPXGGXAXGXGXG---GGGGGXGGXXXG 816 GG GGGG +GG GG G G GG G GGG G G Sbjct: 136 GGGAAGGGGQEGGGQGGAQAGGSTSGSSSGGATSGGGGVSGSSGTSIAGGGSSAGAGAG 194 Score = 31.9 bits (69), Expect = 0.82 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 4/54 (7%) Frame = -3 Query: 977 GGXGGGGG--GXXXXXRGGXGGXXGGXGXGXXPXGGXAXGX--GXGGGGGGXGG 828 GG GGGG G + G G GG G G A G G GG GG Sbjct: 118 GGQAGGGGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGGSTSGSSSGGATSGG 171 >SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) Length = 397 Score = 36.3 bits (80), Expect = 0.038 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PP P P P P PP P PP PP PP PP Sbjct: 246 PPSVKPSVPIPPPTKPPPRVASRRPPPPLPPPDSSEAQAQQPPLSPP 292 Score = 32.7 bits (71), Expect = 0.47 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 PP P P + PP P PP PP PP PP Sbjct: 246 PPSVKPSVPIPPPTKPPPRVASRRPPPPLPPPDSSEAQAQQPPLSPP 292 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/60 (30%), Positives = 19/60 (31%), Gaps = 1/60 (1%) Frame = +2 Query: 788 TXXXTHSXNXPPPXPXXPP-PPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 T H + P P PP PP RPPP P P S P P P Sbjct: 240 TGDKPHPPSVKPSVPIPPPTKPPPRVASRRPPPPLPPPDSSEAQAQQPPLSPPVGKPVVP 299 Score = 29.9 bits (64), Expect = 3.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 877 PPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PP P PP P PP PPPP P P Sbjct: 246 PPSVKPSVPIPPPTKP-PPRVASRRPPPPLPPP 277 >SB_1966| Best HMM Match : GRP (HMM E-Value=0.53) Length = 178 Score = 36.3 bits (80), Expect = 0.038 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRG-GXGGXXGGXGXGXXPXGGXAXGXGXGGGGGG 837 GG GGG GG RG G GG GG GG G G G GGG Sbjct: 40 GGHGGGHGGGRGRGRGHGHGGDVGGDDGD----GGNCDGDGYGDVGGG 83 Score = 32.3 bits (70), Expect = 0.62 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXG 830 G G GG GGG G G GG GG G GGG G Sbjct: 39 GGGHGGGHGGGRGRGRGHGHGGDVGGDDGDGGNCDGDGYGDVGGGGDDDDG 89 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 35.9 bits (79), Expect = 0.050 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 907 PPXXPPXPPLXXXXXPPPPPPXPP 978 PP PP PP PPPPPP P Sbjct: 82 PPPPPPPPPASNVPAPPPPPPVMP 105 Score = 35.9 bits (79), Expect = 0.050 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 906 PPPXPPXPXPXXPXXPPPXPPXPP 977 PPP PP P P PPP P PP Sbjct: 83 PPPPPPPPASNVPAPPPPPPVMPP 106 Score = 32.3 bits (70), Expect = 0.62 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 906 PPPXPPXPXPXXPXXPPPXPPXPP 977 PPP PP P PPP PP P Sbjct: 82 PPPPPPPPPASNVPAPPPPPPVMP 105 Score = 32.3 bits (70), Expect = 0.62 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 907 PPXXPPXPPLXXXXXPPPPPPXPP 978 PP PP P PPPPP PP Sbjct: 83 PPPPPPPPASNVPAPPPPPPVMPP 106 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP 924 PP PPPPPP A P P PP PP Sbjct: 82 PPPPPPPPPASNVPA-------PPPPPPVMPP 106 Score = 30.3 bits (65), Expect = 2.5 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPP 933 PPPPP P PP P P PP P PP Sbjct: 82 PPPPPPP-----PPASNVPAPPPPP-PVMPP 106 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPP 933 P PPPPP A PP P P PP Sbjct: 582 PIPPPPPQMNNTSAPPPPNKEKQTAKPPAPLPPP 615 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 879 PXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P P PPP P P P PP PP Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPPPVMPP 106 >SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) Length = 631 Score = 35.9 bits (79), Expect = 0.050 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP P PP P PP P P P PP P PP P Sbjct: 154 PETVPPQPETVPPQPE--TVPPQPGSEEPEPVSQAPEPPKPKTSAPEPPKP 202 Score = 35.1 bits (77), Expect = 0.088 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 4/50 (8%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXP----PLXXXXXPPPPPP 969 P PP P P P PP P P PP P P P PP P Sbjct: 143 PSPPNPTEAPEPETVPPQPETVPPQPETVPPQPGSEEPEPVSQAPEPPKP 192 Score = 28.7 bits (61), Expect = 7.6 Identities = 15/55 (27%), Positives = 15/55 (27%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 PT P PP P P P P P P P PP P Sbjct: 148 PTEAPEPETVPPQPETVPPQPETVPPQPGSEEPEPVSQAPEPPKPKTSAPEPPKP 202 >SB_6248| Best HMM Match : KH_1 (HMM E-Value=1.6e-41) Length = 487 Score = 35.9 bits (79), Expect = 0.050 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGG-XGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GG G RGG GG GG G GG GG GG G G Sbjct: 213 GGRGGPRGRGMQRGRGGPRGGGRGGFGGDFGGDGGRFDASNMGGATGGTGNMFGG 267 >SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) Length = 287 Score = 35.9 bits (79), Expect = 0.050 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXX-GGXGXGXXPXGGXAXGXGXGGGGGGXG 831 G GG G GG GG G GG A G GG GGG G Sbjct: 234 GSGGEGGKAFLHGGVGGRQFSSNSYGGFGGGGGACGCNGGGAGGGGG 280 Score = 31.9 bits (69), Expect = 0.82 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG GG G G G GGG G GGG GGG Sbjct: 233 GGSGGEGGKAFLHGGVGGRQFSSNSYGGFGGGGGACGCNGGGAGGGGGYSGGG 285 Score = 31.1 bits (67), Expect = 1.4 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = -3 Query: 968 GGGGGGXXXXXRG----GXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GGGGGG +G G G GG GG GG GG GG Sbjct: 216 GGGGGGFYTDGQGSRNKGGSGGEGGKAFLHGGVGGRQFSSNSYGGFGGGGG 266 Score = 28.7 bits (61), Expect = 7.6 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = -3 Query: 977 GGXGGGGG--GXXXXXRGGXGGXXGG 906 GG GGGGG G GG GG GG Sbjct: 259 GGFGGGGGACGCNGGGAGGGGGYSGG 284 >SB_37025| Best HMM Match : Homeobox (HMM E-Value=1.3e-16) Length = 154 Score = 35.9 bits (79), Expect = 0.050 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PT P PPP R P P PP P P P P PPP P P Sbjct: 69 PTQGFRPYPGPPPALSPQVYRGYPFQYPGTPPPPMYPAFP-PSFPSSPPPEYPGLP 123 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 830 PXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXPXS 982 P PPP R P PP P PS P PP P P S Sbjct: 75 PYPGPPPALSPQVYRGYPFQYPGTPPPPMYPAFPPSFPSSPPPEYPGLPVS 125 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 35.9 bits (79), Expect = 0.050 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 871 AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 A PP P P P P P PPPPPP P Sbjct: 355 ANPPSTPAPTPAPLSSTPCAPFAPPPPPPPPPPPAP 390 Score = 33.5 bits (73), Expect = 0.27 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXP 879 PP PPPPPP P P + P Sbjct: 378 PPPPPPPPPPPAPGSTP 394 Score = 32.7 bits (71), Expect = 0.47 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PP P P P P P P PP PP PPPPPP P Sbjct: 357 PPSTPAPTPAPLSST---------PCAPFAPPPPP------PPPPPPAP 390 Score = 30.7 bits (66), Expect = 1.9 Identities = 15/45 (33%), Positives = 17/45 (37%) Frame = +3 Query: 801 LTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXP 935 L + + PP P P P P P PPP PP P P Sbjct: 348 LQIASLVANPPSTPAPTPAPLSST--PCAPFAPPPPPPPPPPPAP 390 Score = 30.3 bits (65), Expect = 2.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +1 Query: 847 PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP P P P P P PP PP PPP P P Sbjct: 357 PPSTPAPTPAPLSSTPCAPFAPPPPPPPP------PPPAPGSTP 394 >SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 246 Score = 35.5 bits (78), Expect = 0.066 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GGGG RGG G G G G G G GGGG G G Sbjct: 102 GMGGGGMAGEGMSRGGIAGEGMGRGGMAGEGMGRGGMAGEGMGGGGMAGEGMG 154 Score = 34.7 bits (76), Expect = 0.12 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GGGG RGG G G G G G G GGGG G G Sbjct: 41 GRMGGGGMAGEGMGRGGMAGEGMGGGGMAGEGMGRGGMAGEGMGGGGMAGEGMG 94 Score = 33.9 bits (74), Expect = 0.20 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 G GGGG RGG G G G G G G GGGG G Sbjct: 62 GMGGGGMAGEGMGRGGMAGEGMGGGGMAGEGMGRGGIAGEGMGGGGMAG 110 Score = 33.1 bits (72), Expect = 0.35 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Frame = -2 Query: 966 GGXGGXXXGXEGX-GXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGGXL 811 GG G G G G G GG G GGG GGG G GG + Sbjct: 126 GGMAGEGMGRGGMAGEGMGGGGMAGEGMGGGGMAGEGMGGGGIAGEGISGGAI 178 Score = 31.9 bits (69), Expect = 0.82 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXX-GGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 G G GG RGG G GG G GG G G GGGG G Sbjct: 122 GMGRGGMAGEGMGRGGMAGEGMGGGGMAGEGMGGGGMA-GEGMGGGGIAG 170 Score = 31.9 bits (69), Expect = 0.82 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGG 845 G GG G G G G G G G GGG GG GGG Sbjct: 124 GRGGMAGEGMGRGGMAGEGMG--GGGMAGEGMGGGGMAGEGMGGGG 167 Score = 30.3 bits (65), Expect = 2.5 Identities = 18/55 (32%), Positives = 19/55 (34%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGGXL 811 G G GG G G G G G GGG GG G GGG + Sbjct: 34 GRGGIAGGRMGGGGMAGEGMGRGGMAGEGMGGGGMAGEGMGRGGMAGEGMGGGGM 88 Score = 29.5 bits (63), Expect = 4.4 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = -1 Query: 982 GXGGXG--GXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXG 830 G GG G G G G G G G G GGG GG GGG G Sbjct: 62 GMGGGGMAGEGMGRGGMAGEGMG--GGGMAGEGMGRGGIAGEGMGGGGMAGEG 112 Score = 29.5 bits (63), Expect = 4.4 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = -2 Query: 963 GXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGGXL 811 G GG EG G G G G GGG GG G GGG + Sbjct: 62 GMGGGGMAGEGMGRGGMAGEGMG----GGGMAGEGMGRGGIAGEGMGGGGM 108 Score = 29.5 bits (63), Expect = 4.4 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGG 848 G GG G G G G G G G GGG GG GG Sbjct: 134 GRGGMAGEGMGGGGMAGEGMG--GGGMAGEGMGGGGIAGEGISGG 176 Score = 29.1 bits (62), Expect = 5.8 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG G G G G GG GG GG A G G GGGG G G Sbjct: 26 GGMAGEGMGRGGIAGGRMGG--GGMAGEGMGRGGMA---GEGMGGGGMAGEGMG 74 >SB_3426| Best HMM Match : Homeobox (HMM E-Value=3.4e-22) Length = 245 Score = 35.5 bits (78), Expect = 0.066 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PT P PPP R P P PP P P P P PPP P P Sbjct: 159 PTQGFRPYPGPPPVLSPQVYRCYPFQYPGTPPPPMYPAFP-PSFPFSPPPEYPGLP 213 Score = 30.3 bits (65), Expect = 2.5 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 830 PXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXPXS 982 P PPP R P PP P PS P PP P P S Sbjct: 165 PYPGPPPVLSPQVYRCYPFQYPGTPPPPMYPAFPPSFPFSPPPEYPGLPVS 215 >SB_52656| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1321 Score = 35.1 bits (77), Expect = 0.088 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP 960 PP P P P PP P P PP PP+ PPP Sbjct: 874 PPMSSQPQPPPGNQVNPPMSSQPQP-PPGNQVNPPMSSQPQPPP 916 Score = 35.1 bits (77), Expect = 0.088 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP 960 PP P P P PP P P PP PP+ PPP Sbjct: 922 PPMSSQPQPLPGNQVNPPMSSQPQP-PPGNQVNPPMSSQPQPPP 964 Score = 35.1 bits (77), Expect = 0.088 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP 960 PP P P P PP P P PP PP+ PPP Sbjct: 938 PPMSSQPQPPPGNQVNPPMSSQPQP-PPGNQVNPPMSSQPQPPP 980 Score = 35.1 bits (77), Expect = 0.088 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP 960 PP P P P PP P P PP PP+ PPP Sbjct: 954 PPMSSQPQPPPGNQVNPPMSSQPQP-PPGNQVNPPMSSQPQPPP 996 Score = 31.9 bits (69), Expect = 0.82 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP 960 PP P P P PP P P P PP+ PPP Sbjct: 906 PPMSSQPQPPPGNQVNPPMSSQPQPL-PGNQVNPPMSSQPQPPP 948 >SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 795 Score = 35.1 bits (77), Expect = 0.088 Identities = 22/69 (31%), Positives = 23/69 (33%), Gaps = 6/69 (8%) Frame = +1 Query: 790 LXLYSLXQXPXXXPPXPPPPP-----PXPXPXAXPPXGXX-PXPXPPXXPPXPPLXXXXX 951 + L P PP P P P P P P PP G P P PP Sbjct: 672 IELVEFSSKPPLTPPPPLPTPIASSEPLPLPPPPPPTGIDIPHSPSKDDLPLPPPPEEVS 731 Query: 952 PPPPPPXPP 978 PPP PP Sbjct: 732 LPPPDESPP 740 Score = 31.5 bits (68), Expect = 1.1 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +2 Query: 824 PXPXXPPPPPXXXXXXRPPPXXXXPXXXPP---XXPXPXPSXPXXXPPXPPXXPXS 982 P P PPPPP P P PP P P S P P P P S Sbjct: 698 PLPLPPPPPPTGIDIPHSPSKDDLPLPPPPEEVSLPPPDESPPSSKHP-PTVSPSS 752 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 900 PXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PP P P P P PP PP Sbjct: 682 PLTPP-PPLPTPIASSEPLPLPPPPP 706 Score = 30.7 bits (66), Expect = 1.9 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PPPPP P P P PP PP PP PP Sbjct: 700 PLPPPPPPTGIDIPHSPSKDDLPLPPPPEEVSLPP---PDESPPSSKHPP 746 Score = 29.5 bits (63), Expect = 4.4 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 3/52 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPP--XPXPXXPXXPP-PXPPXP 974 PP PPPP P P PPP PP P P P PP P Sbjct: 681 PPLTPPPPLPTPIASSEP-----LPLPPPPPPTGIDIPHSPSKDDLPLPPPP 727 Score = 29.5 bits (63), Expect = 4.4 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 2/51 (3%) Frame = +1 Query: 832 PXPPPPPPX--PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PPPP P P PP P P PP PP PP Sbjct: 722 PLPPPPEEVSLPPPDESPPSSKHPPTVSPSSSSAPP--RPSTPPSVSSAPP 770 >SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) Length = 295 Score = 35.1 bits (77), Expect = 0.088 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 807 LPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 LP P P PP P P PP PP P P P PP PP P Sbjct: 208 LPGNGVVPTQAPRPPTTQTPPTKAPTDP---PVPPTNPPVP-PTNPPAPPTNPPKP 259 Score = 35.1 bits (77), Expect = 0.088 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P P P PP PP PP PP PP PP Sbjct: 215 PTQAPRPPTTQTPPTKAPTDPPVPPTNPPVPPTN----PPAPPTNPP 257 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 35.1 bits (77), Expect = 0.088 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 849 PPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 PP PP PPP PP P P P P PP Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 Score = 35.1 bits (77), Expect = 0.088 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 843 PPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP 959 PP P PP P PPP PP P PPP Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPP 682 Score = 33.5 bits (73), Expect = 0.27 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP 959 PP P PP P PPP P P P PPP Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 Score = 33.5 bits (73), Expect = 0.27 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 844 PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 PP P PP G P PP PP + PPPP Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXP 921 PP PP P P PP G P P P P Sbjct: 653 PPPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 3/39 (7%) Frame = +3 Query: 870 RXPPXXXXXXPXPPPXP---PXPXPXXPXXPPPXPPXPP 977 R P P PPP P P P P P PP PP Sbjct: 643 RPPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPP 681 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 895 PXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P PP PP PPPPPP P Sbjct: 645 PNPFFGGIPPPPP-GGGMFPPPPPPPP 670 >SB_51094| Best HMM Match : VWA (HMM E-Value=0) Length = 3544 Score = 35.1 bits (77), Expect = 0.088 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 3/52 (5%) Frame = -3 Query: 977 GGXGGGGGGXXXXXR---GGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 GG GG GG GG G G G G G GGGGG G Sbjct: 3266 GGAGGAGGASAYMMSASGGGAAGSSGSIGAGAAGGAGAVAAVAVSGGGGGGG 3317 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -3 Query: 929 GXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 G GG GG G A G GGGGGG GG Sbjct: 3199 GEGGGGGGESLAMTVTGLEAGGYSAGGGGGGAGG 3232 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 934 GXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G GG GGG G GGGGG GG Sbjct: 3197 GAGEGGGGGGESLAMTVTGLEAGGYSAGGGGGGAGG 3232 >SB_7859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 35.1 bits (77), Expect = 0.088 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXG--GXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GG G GG G G G G GG G G GGG GG G Sbjct: 141 GGDNGGVVDVVVEDDGHGGGDGGDDGDGGGDDDDGGDGDGGGDDGGGADGGGADGG 196 Score = 28.7 bits (61), Expect = 7.6 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -1 Query: 967 GGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 GG GG G GGG G GG G GGG GG Sbjct: 141 GGDNGGVVDVV-VEDDGHGGGDGGDDGDGGGDDDDGGDGDGGGDDGG 186 >SB_3427| Best HMM Match : Homeobox (HMM E-Value=4e-24) Length = 245 Score = 35.1 bits (77), Expect = 0.088 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PT P PPP R P P PP P P P P PPP P P Sbjct: 159 PTQGFRPFPGPPPVLSPQVYRGYPFQYPGTPPPPMYPAFP-PSFPSSPPPEYPGLP 213 Score = 30.7 bits (66), Expect = 1.9 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 830 PXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXPXS 982 P PPP R P PP P PS P PP P P S Sbjct: 165 PFPGPPPVLSPQVYRGYPFQYPGTPPPPMYPAFPPSFPSSPPPEYPGLPVS 215 >SB_52294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 394 Score = 34.7 bits (76), Expect = 0.12 Identities = 18/37 (48%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -3 Query: 935 RGGXGGXXGG-XGXGXXPXGGXAXGXGXGGGGGGXGG 828 RGG G GG G G G + G G GGG GG GG Sbjct: 337 RGGGRGGRGGRPGRGGRGGRGASGGRGRGGGRGGFGG 373 Score = 33.5 bits (73), Expect = 0.27 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 GG GG RGG GG G G GG G G G G G G Sbjct: 339 GGRGGRGGRPGRGGRGGRGASGGRGR---GGGRGGFGGGAGPQGEG 381 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GGG GG RGG G G G G G G G GGG G G Sbjct: 338 GGGRGG-----RGGRPGRGGRGGRGASGGRGRGGGRGGFGGGAGPQG 379 Score = 29.1 bits (62), Expect = 5.8 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXG 894 GG G GG RGG GG G G G Sbjct: 354 GGRGASGGRGRGGGRGGFGGGAGPQGEG 381 >SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) Length = 595 Score = 32.3 bits (70), Expect(2) = 0.13 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXG 894 GG GGGGGG GG GG GG G G Sbjct: 514 GGGGGGGGGG-----GGGGGGRGGRGRG 536 Score = 32.3 bits (70), Expect = 0.62 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 881 GGXAXGXGXGGGGGGXGGXXXG 816 GG G G GGGGGG GG G Sbjct: 515 GGGGGGGGGGGGGGGRGGRGRG 536 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -3 Query: 920 GXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G G P G G GGGGGG GG G Sbjct: 498 GSSSGSSIVRRPRRRRGGGGGGGGGGGGGGGGRGG 532 Score = 21.0 bits (42), Expect(2) = 0.13 Identities = 7/15 (46%), Positives = 7/15 (46%) Frame = -3 Query: 854 GGGGGGXGGXXXGXW 810 G GGGG G W Sbjct: 576 GAGGGGGSGAGFSGW 590 >SB_53480| Best HMM Match : Sigma70_r1_1 (HMM E-Value=5.7) Length = 402 Score = 34.3 bits (75), Expect = 0.15 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G G G G G G G G G G G G GGGGGG G G Sbjct: 52 GDDGDGDGDDGDDGDGDGD---GDGDGDGDGDGDGDGDGDGGGGGGGDGDGDG 101 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 34.3 bits (75), Expect = 0.15 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPP 882 PP PPPPPP P P A P Sbjct: 81 PPPPPPPPPPPPPGAKKP 98 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXP 897 P PP PPPPPP P P PP P Sbjct: 75 PLCAPPPPPPPPPPPPP---PPGAKKP 98 Score = 32.3 bits (70), Expect = 0.62 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 901 PXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PP PP PPPPPP PP Sbjct: 73 PPPLCAPPPPP-----PPPPPPPPPP 93 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXP 909 P P PPPPPP P P PP G P Sbjct: 74 PPLCAPPPPPPPPPPPP---PPPGAKKPDDP 101 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 918 PPXPXPXXPXXPPPXPPXPP 977 PP P P PPP PP PP Sbjct: 74 PPLCAPPPPPPPPPPPPPPP 93 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 871 AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 A PP P P PP PP PP P P Sbjct: 71 ATPPPLCAPPPPPPPPPPPPPPPGAKKPDDP 101 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 906 PPPXPPXPXPXXPXXPPPXPP 968 PPP P P P PPP PP Sbjct: 73 PPPLCAPPPPPPPPPPPPPPP 93 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPP 912 PP PPPP P P PP P P Sbjct: 74 PPLCAPPPPPPPPPPPPPPPGAKKPDDP 101 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 900 PXPPPXPPXPXPXXPXXPPPXPP 968 P PPP PP P P P P P Sbjct: 79 PPPPPPPPPPPPPPPGAKKPDDP 101 >SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 34.3 bits (75), Expect = 0.15 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 907 PPXXPPXPPLXXXXXPPPPPPXPP 978 PP PP PP+ PP PP PP Sbjct: 5 PPPPPPPPPIAAEFTAPPAPPPPP 28 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXP 930 PP PPPPPP PP P P P P P Sbjct: 5 PPPPPPPPPIAAEFTAPP---APPPPPNPAPDVP 35 Score = 33.1 bits (72), Expect = 0.35 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXP 944 PP PPPPP PP PP PP P P P Sbjct: 5 PPPPPPPPPIAAEFTAPP--------APPPPPNPAPDVP 35 Score = 32.3 bits (70), Expect = 0.62 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 906 PPPXPPXPXPXXPXXPPPXPPXPP 977 PPP PP P PP PP PP Sbjct: 5 PPPPPPPPPIAAEFTAPPAPPPPP 28 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PPPPP P P A P PP P P P P Sbjct: 5 PPPPPPPPPIAAEFTAPPAPPPPPNPAPDVPAESVNTQPNSQAAP 49 >SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) Length = 547 Score = 34.3 bits (75), Expect = 0.15 Identities = 21/55 (38%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXG-GXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GG G GG G GG G G GG + G GGGGG G G Sbjct: 331 GWVGGRAGNMNSGYNGGPSPGAVGGFGGG----GGGSEDNGASGGGGGYSGGGSG 381 Score = 33.9 bits (74), Expect = 0.20 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GGGGGG G GG G G G GGGG G Sbjct: 354 GGFGGGGGGSEDNGASGGGGGYSGGG------SGITWNQAGGGGGSYCAG 397 Score = 32.3 bits (70), Expect = 0.62 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG GGG G G G GGG G GGGG G Sbjct: 351 GAVGGFGGGGGGSEDNGASGGGGGYSGGG---SGITWNQAGGGGGSYCAG 397 Score = 29.5 bits (63), Expect = 4.4 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GG GG G G P G G G GGGG G G Sbjct: 322 GEAGGARAQGWVGGRAGNMNS-GYNGGPSPGAVGGFGGGGGGSEDNGASGG 371 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXG 888 P PP PPPPPP P P PP G Sbjct: 65 PTLPPPPPPPPPPLPPP---PPSG 85 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 900 PXPPPXPPXPXPXXPXXPPPXP 965 P PP PP P P P PPP P Sbjct: 62 PIPPTLPPPPPPPPPPLPPPPP 83 Score = 33.1 bits (72), Expect = 0.35 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 901 PXPPXXPPXPPLXXXXXPPPPP 966 P PP PP PP PPPPP Sbjct: 62 PIPPTLPPPPPPPPPPLPPPPP 83 Score = 31.9 bits (69), Expect = 0.82 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXG 888 P PP PPPPPP P P P G Sbjct: 64 PPTLPP-PPPPPPPPLPPPPPSGG 86 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 850 PPXPXPXAXPPXGXXPXPXPPXXPPXPP 933 P P P PP P P PP PP PP Sbjct: 59 PTVPIPPTLPP---PPPPPPPPLPPPPP 83 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 912 PXPPXPXPXXPXXPPPXPPXPP 977 P P P P PPP PP PP Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPP 80 Score = 29.5 bits (63), Expect = 4.4 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 Query: 922 PXPPLXXXXXPPPPPPXPP 978 P P+ PPPPPP PP Sbjct: 59 PTVPIPPTLPPPPPPPPPP 77 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 34.3 bits (75), Expect = 0.15 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPP 882 PP PPPPPP P P A P Sbjct: 282 PPPPPPPPPPPPPGAKKP 299 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXP 897 P PP PPPPPP P P PP P Sbjct: 276 PLCAPPPPPPPPPPPPP---PPGAKKP 299 Score = 32.3 bits (70), Expect = 0.62 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 901 PXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PP PP PPPPPP PP Sbjct: 274 PPPLCAPPPPP-----PPPPPPPPPP 294 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXP 909 P P PPPPPP P P PP G P Sbjct: 275 PPLCAPPPPPPPPPPPP---PPPGAKKPDDP 302 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 918 PPXPXPXXPXXPPPXPPXPP 977 PP P P PPP PP PP Sbjct: 275 PPLCAPPPPPPPPPPPPPPP 294 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 871 AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 A PP P P PP PP PP P P Sbjct: 272 ATPPPLCAPPPPPPPPPPPPPPPGAKKPDDP 302 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 906 PPPXPPXPXPXXPXXPPPXPP 968 PPP P P P PPP PP Sbjct: 274 PPPLCAPPPPPPPPPPPPPPP 294 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPP 912 PP PPPP P P PP P P Sbjct: 275 PPLCAPPPPPPPPPPPPPPPGAKKPDDP 302 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 900 PXPPPXPPXPXPXXPXXPPPXPP 968 P PPP PP P P P P P Sbjct: 280 PPPPPPPPPPPPPPPGAKKPDDP 302 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXG 888 P PP PPPPPP P P PP G Sbjct: 289 PTLPPPPPPPPPPLPPP---PPSG 309 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 900 PXPPPXPPXPXPXXPXXPPPXP 965 P PP PP P P P PPP P Sbjct: 286 PIPPTLPPPPPPPPPPLPPPPP 307 Score = 33.1 bits (72), Expect = 0.35 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 901 PXPPXXPPXPPLXXXXXPPPPP 966 P PP PP PP PPPPP Sbjct: 286 PIPPTLPPPPPPPPPPLPPPPP 307 Score = 31.9 bits (69), Expect = 0.82 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXG 888 P PP PPPPPP P P P G Sbjct: 288 PPTLPP-PPPPPPPPLPPPPPSGG 310 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 850 PPXPXPXAXPPXGXXPXPXPPXXPPXPP 933 P P P PP P P PP PP PP Sbjct: 283 PTVPIPPTLPP---PPPPPPPPLPPPPP 307 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 912 PXPPXPXPXXPXXPPPXPPXPP 977 P P P P PPP PP PP Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPP 304 Score = 29.5 bits (63), Expect = 4.4 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 Query: 922 PXPPLXXXXXPPPPPPXPP 978 P P+ PPPPPP PP Sbjct: 283 PTVPIPPTLPPPPPPPPPP 301 >SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) Length = 491 Score = 34.3 bits (75), Expect = 0.15 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGG 840 G GGGGGG GG GG G G G G G G Sbjct: 320 GGGGGGGGGGGGGGGGGGGGDXXXXNGDDDDDGNGNGDDDGDGNG 364 Score = 33.1 bits (72), Expect = 0.35 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 GG GGGGGG GG G G G G G G G Sbjct: 321 GGGGGGGGGGGGGGGGGGGDXXXXNGDDDDDGNGNGDDDGDGNGDDDDG 369 Score = 32.7 bits (71), Expect = 0.47 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGGGGG GG G G G G G G G G Sbjct: 323 GGGGGGGGGGGGGGGGGDXXXXNGDDDDDGNGNGDDDGDGNGDDDDGDGDGDDG 376 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 881 GGXAXGXGXGGGGGGXGG 828 GG G G GGGGGG GG Sbjct: 320 GGGGGGGGGGGGGGGGGG 337 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 881 GGXAXGXGXGGGGGGXGG 828 GG G G GGGGGG GG Sbjct: 321 GGGGGGGGGGGGGGGGGG 338 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 881 GGXAXGXGXGGGGGGXGG 828 GG G G GGGGGG GG Sbjct: 322 GGGGGGGGGGGGGGGGGG 339 Score = 30.3 bits (65), Expect = 2.5 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 GG GGGGGG G G G G G G G G Sbjct: 330 GGGGGGGGGGDXXXXNGDDDDDGNGNGDDDGDGNGDDDDGDGDGDDGDG 378 Score = 29.5 bits (63), Expect = 4.4 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXA---XGXGXGGGGGGXGG 828 GG GGGGGG G G G G G G G G G G Sbjct: 329 GGGGGGGGGGGDXXXXNGDDDDDGNGNGDDDGDGNGDDDDGDGDGDDGDGDDG 381 Score = 29.1 bits (62), Expect = 5.8 Identities = 18/55 (32%), Positives = 19/55 (34%) Frame = -2 Query: 981 EXGXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 + G GG GG G G G G G G G G G G G Sbjct: 319 DGGGGGGGGGGGGGGGGGGGGDXXXXNGDDDDDGNGNGDDDGDGNGDDDDGDGDG 373 >SB_56161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 34.3 bits (75), Expect = 0.15 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Frame = +3 Query: 813 TXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPP--XPPXPXPXXPXXPPPXPP 968 T PP PPP PP P P PP P P PP PP Sbjct: 134 TINYPPPGPQAPPPGSTVHYPPPQTTMGYPSAQPGFAPPGNYPPPPAPPPAYPP 187 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = +1 Query: 853 PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP---PPPPXPP 978 P P P A PP P P P PP PPPP PP Sbjct: 138 PPPGPQAPPPGSTVHYPPPQTTMGYPSAQPGFAPPGNYPPPPAPP 182 Score = 33.1 bits (72), Expect = 0.35 Identities = 21/64 (32%), Positives = 23/64 (35%), Gaps = 6/64 (9%) Frame = +2 Query: 785 TTXXXTHSXNXPPPXPXXPPPPPXXXXXXRPPP------XXXXPXXXPPXXPXPXPSXPX 946 T T + N PPP P PPP PPP P PP P P+ P Sbjct: 127 TPSFATTTINYPPPGPQAPPP---GSTVHYPPPQTTMGYPSAQPGFAPPGNYPPPPAPPP 183 Query: 947 XXPP 958 PP Sbjct: 184 AYPP 187 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP P PPP PP P P P PP PPP P Sbjct: 139 PPGPQAPPPGSTVHYPPPQ--TTMGYPSAQPGFAPPGNYPPPPAPPPAYP 186 Score = 30.3 bits (65), Expect = 2.5 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXP-XPPXXPPXPPLXXXXXPPPPPPXPP 978 PP P P PP P P PP PP PPP PP Sbjct: 155 PPQTTMGYPSAQPGFAPPGNYPPPPAPPPAYPPVTQGYNMSQYPPPDVAPP 205 >SB_37033| Best HMM Match : Annexin (HMM E-Value=0) Length = 287 Score = 33.9 bits (74), Expect = 0.20 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 6/57 (10%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPP-XGXXPXPXPPXXPP--XPPLXXXXXPP---PPPP 969 P PP P PPP PP G P P P P P PP PPPP Sbjct: 21 PGAPPPMPQQPPPLGFDAMGPPQPGGMPMPMPGPYPSSGYPTSVPGAAPPYGGPPPP 77 Score = 29.9 bits (64), Expect = 3.3 Identities = 18/59 (30%), Positives = 19/59 (32%), Gaps = 2/59 (3%) Frame = +3 Query: 807 LPTXXXXPPXXPPPPPXXXXXRXPP-XXXXXXPXPPPXPPXPXP-XXPXXPPPXPPXPP 977 +P PP PPP PP P P P P P P PP PP Sbjct: 18 MPRPGAPPPMPQQPPPLGFDAMGPPQPGGMPMPMPGPYPSSGYPTSVPGAAPPYGGPPP 76 >SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 516 Score = 33.9 bits (74), Expect = 0.20 Identities = 26/89 (29%), Positives = 34/89 (38%), Gaps = 1/89 (1%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGX-GGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGR 806 G G GG G G G G GGG G GG R GGG GG G Sbjct: 388 GVSGMRRGRGGYRGRGGRGGYRGRGGGRGYYRGGRGGGR-------GGGGRGGRGGLRGE 440 Query: 805 VSXAXGSQXFXQXD*SNDXNRQELGIVSG 719 S A ++ + ND ++ + + +G Sbjct: 441 ASEASPNRDWVDYPLDNDTSKLQKNLPNG 469 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPP--XXPPXPP 933 PPP P P PP G P P PP P PP Sbjct: 209 PPPMGGPPPMGGPPGGYPPPPPPPGAGDPAYPP 241 Score = 31.1 bits (67), Expect = 1.4 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 P P PPP P PP G P PP PP PP PPP Sbjct: 199 PYPGQPGMWGPPPMGGP---PPMGGPPGGYPP--PPPPPGAGDPAYPPP 242 Score = 30.3 bits (65), Expect = 2.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP 958 P P PPP PPP P PP P P P PP Sbjct: 201 PGQPGMWGPPPMGG----PPPMGGPPGGYPPPPPPPGAGDPAYPPP 242 Score = 29.5 bits (63), Expect = 4.4 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +1 Query: 844 PPPPXPXPXAXPPXGXXPXPX-PPXX-PPXPPLXXXXXPPPPPP 969 P P P PP G P PP PP PP P PPP Sbjct: 199 PYPGQPGMWGPPPMGGPPPMGGPPGGYPPPPPPPGAGDPAYPPP 242 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPL 936 PPPPP P P P P P PP P+ Sbjct: 512 PPPPPASPPPPLPAEEDNSPPPLPAGPPPDEPM 544 Score = 33.1 bits (72), Expect = 0.35 Identities = 16/49 (32%), Positives = 19/49 (38%) Frame = +2 Query: 776 EXLTTXXXTHSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXP 922 E + + + PPP P PPPP PPP P PP P Sbjct: 498 ETVESLDFVEDRSPPPPPPASPPPPLPAEEDNSPPP---LPAGPPPDEP 543 Score = 32.7 bits (71), Expect = 0.47 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +1 Query: 895 PXPXPPXXPPXP-PLXXXXXPPPPPPXPP 978 P P PP PP P P PPP P PP Sbjct: 511 PPPPPPASPPPPLPAEEDNSPPPLPAGPP 539 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXG 909 GG GGGGGG RGG GG G Sbjct: 1005 GGGGGGGGGGGGGRRGGRGGARG 1027 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 973 GXGGXGGGXXGXXGXGXGGXGGGXG 899 G GG GGG G G GG GG G Sbjct: 1003 GGGGGGGGGGGGGGGRRGGRGGARG 1027 Score = 30.3 bits (65), Expect = 2.5 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXG 900 GG GGGGGG GG GG GG G Sbjct: 1003 GGGGGGGGGG-----GGGGGRRGGRG 1023 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = -3 Query: 866 GXGXGGGGGGXGGXXXGXWXSEXSXR*SVXXTXRLI 759 G G GGGGGG GG G R + T R + Sbjct: 1004 GGGGGGGGGGGGGGRRGGRGGARGRRATTTTTRRCV 1039 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 881 GGXAXGXGXGGGGGGXGGXXXG 816 GG G G GGGGGG G G Sbjct: 1003 GGGGGGGGGGGGGGGRRGGRGG 1024 >SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPP 933 P P PPP P P P PP P P PP PP Sbjct: 424 PGGGVPSHPPPLPQPPPSIIPPP-TTPLPQTVPTPPRPP 461 Score = 28.7 bits (61), Expect = 7.6 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PP P PPP P P P P P L PP P Sbjct: 429 PSHPPPLPQPPPSIIPPPTTPLPQTVPTPPRPPTTMTTILTTIATSGPPGGAP 481 >SB_18739| Best HMM Match : YhhN (HMM E-Value=7.3) Length = 306 Score = 26.2 bits (55), Expect(2) = 0.23 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 829 PPXPPPPPP 855 PP PPPPPP Sbjct: 252 PPPPPPPPP 260 Score = 26.2 bits (55), Expect(2) = 0.23 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 952 PPPPPPXPP 978 PPPPPP PP Sbjct: 253 PPPPPPPPP 261 >SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) Length = 288 Score = 33.5 bits (73), Expect = 0.27 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PP P P PP P P P P PP PPP P Sbjct: 210 PLPPTAAPPP---PPTTGAPPPTPVTNKPPPPRPATTQAPPPTAAP 252 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPP 933 P PPPPP P P P P P PP Sbjct: 210 PLPPTAAPPPPPTTGAPPPTPVTNKPPPPRPATTQAPPP 248 Score = 28.7 bits (61), Expect = 7.6 Identities = 17/55 (30%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Frame = +3 Query: 795 AXLTL-PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPP 956 A +T+ P PP PPPP PP PPP P P P Sbjct: 200 ADITIKPRSGPLPPTAAPPPPPTTG--APPPTPVTNKPPPPRPATTQAPPPTAAP 252 Score = 28.7 bits (61), Expect = 7.6 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP P P P P P P PP P PP P Sbjct: 210 PLPPTAAPPPPPTTGAPP---PTPVTNKPPPPRPATTQAPPPTAAP 252 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 33.5 bits (73), Expect = 0.27 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = +1 Query: 829 PPXPPP-PPPXPXPXAXPPXGXXPXPXP 909 PP PPP PPP P P PP P P P Sbjct: 431 PPTPPPTPPPTPPPTTLPPT-TQPPPQP 457 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXP 921 PP PPP P P P PP P PP P Sbjct: 430 PPPTPPPTPPPTP---PPTTLPPTTQPPPQP 457 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 871 AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 A PP P P PP PP L PPP P Sbjct: 428 ATPPP--TPPPTPPPTPPPTTLPPTTQPPPQP 457 Score = 29.1 bits (62), Expect = 5.8 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPPXP 930 PPP P P P PP P P PP P Sbjct: 430 PPPTPPPTPPPTPPPTTLPPTTQP--PPQP 457 Score = 29.1 bits (62), Expect = 5.8 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +3 Query: 900 PXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PPP PP P P PP P Sbjct: 432 PTPPPTPPPTPPPTTLPPTTQPPPQP 457 >SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 33.1 bits (72), Expect = 0.35 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPP 882 P PPPPPP P P PP Sbjct: 142 PPPPPPPPSPPPPCHPP 158 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 906 PPPXPPXPXPXXPXXPPPXP 965 PPP PP P P P PP P Sbjct: 142 PPPPPPPPSPPPPCHPPALP 161 Score = 29.1 bits (62), Expect = 5.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXP 879 PP PPPPP P P P Sbjct: 142 PPPPPPPPSPPPPCHPP 158 >SB_48388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 33.1 bits (72), Expect = 0.35 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 GG GG G G G GGG G G GGGG G Sbjct: 212 GGKGGWENGGFGGGGSAMAHPGGGGGYSGGGIEGSETTGSAGGGGSFNSG 261 >SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGG 906 GG GGG GG RGG GG GG Sbjct: 369 GGRGGGRGGGRGGFRGGRGGRGGG 392 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGG 905 G G GG GGG G G G GG GGG Sbjct: 368 GGGRGGGRGGGRGGFRG-GRGGRGGG 392 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXA 870 GGG GG RGG G GG G G G A Sbjct: 368 GGGRGGGRGGGRGGFRGGRGGRGGGGRGAGSDA 400 Score = 28.7 bits (61), Expect = 7.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXG 900 GG GGG G RGG GG G G Sbjct: 372 GGGRGGGRGGFRGGRGGRGGGGRGAG 397 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 33.1 bits (72), Expect = 0.35 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 844 PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 P P PP P P P PP PP PPPPP Sbjct: 185 PTEDTPWTSVPPP----PPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP 912 P P PPPP P P PP P PP Sbjct: 190 PWTSVPPPPPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 30.3 bits (65), Expect = 2.5 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPP---XXPPXPPL 936 PPPPPP P G P P PP PP PP+ Sbjct: 195 PPPPPPGP--------GGIPPPPPPIRGGVPPPPPM 222 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%) Frame = +3 Query: 906 PPPXPPXPXPXXPXXPP---PXPPXPP 977 PPP PP P P PP PP PP Sbjct: 195 PPPPPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 919 PPXPPLXXXXXPPPPPP 969 PP PP PPPPPP Sbjct: 195 PPPPPPGPGGIPPPPPP 211 >SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26) Length = 687 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 2/58 (3%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXP--PXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP P PP R P P P PP P P P PP P PP Sbjct: 340 PHEPGRPPHEPGRPPHEPG-RPPHEPGRPPHEPGRPPHEPGRPPYEPGRPPHEPGRPP 396 Score = 30.7 bits (66), Expect = 1.9 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP P PP P P PP P P P PP P PP Sbjct: 319 PHDQGRPPYEPGRPPHE------PGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPP 368 Score = 29.9 bits (64), Expect = 3.3 Identities = 16/55 (29%), Positives = 17/55 (30%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 P P P PP P P P P P P PP P PP+ Sbjct: 329 PGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPY 383 Score = 29.1 bits (62), Expect = 5.8 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 846 PPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP P P PP P P P PP P PP Sbjct: 318 PPHDQGRPPYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPP 361 Score = 28.7 bits (61), Expect = 7.6 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P PP P P P P P P PP P PP Sbjct: 343 PGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEPGRPPHEPGRPP 396 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 895 PXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP PP P PPPP PP Sbjct: 781 PTTPPPEYPPPPP--GLARPNPPPPNPP 806 Score = 32.7 bits (71), Expect = 0.47 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 850 PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P P P PP P PP PP PPL P P P Sbjct: 781 PTTPPPEYPPPPPGLARPNPP--PPNPPLQVTSIPGEPAP 818 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 824 PXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXP 928 P P PPPPP PPP P P P Sbjct: 784 PPPEYPPPPPGLARPNPPPPNPPLQVTSIPGEPAP 818 Score = 30.7 bits (66), Expect = 1.9 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 8/57 (14%) Frame = +1 Query: 829 PPXPPPPPPX--------PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PP PP PP P P P P PP P PPPP P Sbjct: 859 PPCPPDPPQRLPLVEACPGSPSVKPAIDWPPPPPPPATSNGDPSLLLTTNVPPPPDP 915 >SB_32409| Best HMM Match : Oxidored_q2 (HMM E-Value=0.081) Length = 185 Score = 33.1 bits (72), Expect = 0.35 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -3 Query: 977 GGXGGGGG-GXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGG 846 GG GGGG G GG G G G GG G GGG Sbjct: 125 GGDGGGGSDGGGGSDGGGGDGEDDDGGDGDDDDGGDVEDDGDGGG 169 >SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) Length = 1282 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 2/58 (3%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXP--PXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP P PP R P P P PP P P P PP P PP Sbjct: 106 PHEPGRPPHEPGRPPHEPG-RPPHEPGRPPHEPGRPPHEPGRPPYEPGRPPHEPGRPP 162 Score = 30.7 bits (66), Expect = 1.9 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP P PP P P PP P P P PP P PP Sbjct: 85 PHDQGRPPYEPGRPPHE------PGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPP 134 Score = 29.9 bits (64), Expect = 3.3 Identities = 16/55 (29%), Positives = 17/55 (30%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 P P P PP P P P P P P PP P PP+ Sbjct: 95 PGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPY 149 Score = 29.1 bits (62), Expect = 5.8 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 846 PPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP P P PP P P P PP P PP Sbjct: 84 PPHDQGRPPYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPP 127 Score = 28.7 bits (61), Expect = 7.6 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P PP P P P P P P PP P PP Sbjct: 109 PGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEPGRPPHEPGRPP 162 >SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) Length = 135 Score = 32.7 bits (71), Expect = 0.47 Identities = 23/68 (33%), Positives = 24/68 (35%) Frame = +1 Query: 772 VXXTDYLXLYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXX 951 V T Y+ Y P PP P PP P PP G P PP P Sbjct: 13 VRNTPYMGGYP-PAAPGGYPPAPGGYPPAPG--GYPPSGGYGYPPAGGYPPPQP-GYAGG 68 Query: 952 PPPPPPXP 975 PPPP P Sbjct: 69 PPPPGIAP 76 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXP--PXXPPXPPLXXXXXPPPP 963 P PP P PP PP G P P P PP P + PPP Sbjct: 34 PGGYPPAPGGYPP-SGGYGYPPAGGYPPPQPGYAGGPPPPGIAPGIGGPPP 83 Score = 28.7 bits (61), Expect = 7.6 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 3/46 (6%) Frame = +1 Query: 838 PPPPPPXPXPXAXPP---XGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 PPPP P PP G P P PP PPPP Sbjct: 69 PPPPGIAPGIGGPPPSGQYGAPPTSQPYGAPPTSGYPGYQQHPPPP 114 >SB_37850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 509 Score = 32.7 bits (71), Expect = 0.47 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G G GG GG GG G G G GG G G G G GG G Sbjct: 222 GAGAVGGLGGLGGLGGVGGLGGVGGLGGI--GGLGGGGVIAGAGAGIGGGVIG 272 Score = 31.1 bits (67), Expect = 1.4 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGG 820 G GG GG G G GG GGG G GGG G GG Sbjct: 224 GAVGGLGGLGGLGGVGGLGGVGGLGGIGGLGGGGVIAGAGAGIGGGVIGTGG 275 >SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74) Length = 483 Score = 32.7 bits (71), Expect = 0.47 Identities = 16/46 (34%), Positives = 18/46 (39%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P P + P P PP PP PP+ P P PP Sbjct: 161 PTTKPTPAPHSSPSP---TPPPPPIIPPCPPVINLLIPTARPCMPP 203 Score = 28.7 bits (61), Expect = 7.6 Identities = 24/96 (25%), Positives = 26/96 (27%) Frame = +3 Query: 690 CRSDHVRCPPPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXXPPPPPXXXXX 869 CR V PP C F ++ P T PT P PPP Sbjct: 128 CRPVMVPRPPVCPCKQECNFCCIEEEKPTTTKKPT---TKPTPAPHSSPSPTPPPPPIIP 184 Query: 870 RXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP P P P P P P P Sbjct: 185 PCPPVINLLIPTARPCMPPPIIIHHHHHHPFPVRVP 220 >SB_12635| Best HMM Match : Chlam_PMP (HMM E-Value=0.018) Length = 3561 Score = 32.7 bits (71), Expect = 0.47 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 G G G G GG GG P G G GGGG GG Sbjct: 959 GAGSGSAGASGAGYGGRGGQGAATPITGSPYGDYRSPQVFGSGGGGTGG 1007 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 32.7 bits (71), Expect = 0.47 Identities = 22/69 (31%), Positives = 23/69 (33%), Gaps = 19/69 (27%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXP----------PXGXXPXPXPPXXPPXPP---------LXXXXX 951 PP PPP PP P P P P PP PP + Sbjct: 1456 PPPPPPAPPCPPPCHVQSTQHTVDHSWAPSPVSAPLPMAAPPSPPQRIHHVHTIVHHHVH 1515 Query: 952 PPPPPPXPP 978 PPPP P PP Sbjct: 1516 PPPPAPPPP 1524 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PPPPP P P PP P P PP PP Sbjct: 1455 PPPPPPPAPPCPPPCHVQSTQHTVDHSWAPSPVSAPLPMAAPPSPP 1500 >SB_40954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 274 Score = 32.7 bits (71), Expect = 0.47 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PPPP P P P P P P PPPPPP Sbjct: 51 PQMGMPPPPGPGQPEMP---GQPQVTPQTPSPASPGLPFMPPPPPPP 94 Score = 29.5 bits (63), Expect = 4.4 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 P P PP P P P P P P PP PPPPP Sbjct: 51 PQMGMPPPPGPGQPEMPGQPQVTPQTPSPASPGLPFMPP------PPPPP 94 Score = 29.5 bits (63), Expect = 4.4 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 1/48 (2%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXP-XPXXPXXPPPXPP 968 P PPPP P P P P P P P PPP PP Sbjct: 51 PQMGMPPPPGPGQPEMP-----GQPQVTPQTPSPASPGLPFMPPPPPP 93 >SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 421 Score = 32.3 bits (70), Expect = 0.62 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 895 PXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P PPL PPPPP PP Sbjct: 190 PDESPEPTRPPPPLDDLDDLPPPPPPPP 217 Score = 29.5 bits (63), Expect = 4.4 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P P P P P P PP PP PPPP P Sbjct: 190 PDESPEPTRPPP---PLDDLDDLPPPPPPPPEDDSIHNHEDLPPPPPP 234 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 870 RXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 R PP PPP PP P PP PP Sbjct: 198 RPPPPLDDLDDLPPPPPPPPEDDSIHNHEDLPPPPP 233 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 32.3 bits (70), Expect = 0.62 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXP 897 P PP PP PPP P P P P Sbjct: 522 PAPQPPSPPAPPPKPAPPPRSPPAAAP 548 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +1 Query: 844 PPPPXPXPXAXPPX-GXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P P G P P PP P PP P PPP PP Sbjct: 504 PCAPSCAPTYSPSCCGSYPAPQPPSPPAPPP-----KPAPPPRSPP 544 Score = 29.9 bits (64), Expect = 3.3 Identities = 23/97 (23%), Positives = 30/97 (30%), Gaps = 4/97 (4%) Frame = +3 Query: 690 CRSDHVRCPPPETMPSSCRFXSXDQSXCXXX*LPXAXLTLP----TXXXXPPXXPPPPPX 857 C ++ + PPP P + +P A + +P T P P Sbjct: 449 CNANMPQGPPPPPPPPPQMYQQPLMMPQAPMMMPQAPMMMPQAPMTMQQQAQMQQPCAPS 508 Query: 858 XXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P PP PP P P P PP PP Sbjct: 509 CAPTYSPSCCGSYPAPQPPSPPAPPPK-PAPPPRSPP 544 Score = 29.9 bits (64), Expect = 3.3 Identities = 15/54 (27%), Positives = 16/54 (29%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PPPPP P P P P P+ P P Sbjct: 454 PQGPPPPPPPPPQMYQQPLMMPQAPMMMPQAPMMMPQAPMTMQQQAQMQQPCAP 507 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 921 PXPXPXXPXXPPPXPPXPP 977 P P P P PPP P PP Sbjct: 522 PAPQPPSPPAPPPKPAPPP 540 >SB_14693| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 32.3 bits (70), Expect = 0.62 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PT P P P R P P PP P P P P PPP P P Sbjct: 159 PTQGFRPYPGPSPVLSPQVYRGYPFQYPGTPPPPMYPAFP-PIFPSSPPPEYPGLP 213 >SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) Length = 340 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +1 Query: 907 PPXXPPXPPLXXXXXPPPPPP 969 PP PP PPL PPPPPP Sbjct: 162 PPPQPPPPPL-----PPPPPP 177 Score = 27.9 bits (59), Expect(2) = 0.65 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +1 Query: 829 PPXPPPPPPXPXP 867 PP PPPPP P P Sbjct: 162 PPPQPPPPPLPPP 174 Score = 23.0 bits (47), Expect(2) = 0.65 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +1 Query: 901 PXPPXXPPXPPL 936 P PP PP PP+ Sbjct: 167 PPPPLPPPPPPI 178 >SB_58920| Best HMM Match : GRP (HMM E-Value=0.35) Length = 243 Score = 31.9 bits (69), Expect = 0.82 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 962 GGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGG 837 GGGG GG G G G G G G G GG Sbjct: 101 GGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGG 142 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGG 845 G G GG G G G G GGG GG GGG Sbjct: 98 GSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGG 143 Score = 29.1 bits (62), Expect = 5.8 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -2 Query: 942 GXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G G G GG GGG GGGG G GG Sbjct: 101 GGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGG 142 >SB_42356| Best HMM Match : PDZ (HMM E-Value=5.7e-19) Length = 619 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 PPPPP P P P P P P PPPPP Sbjct: 50 PPPPPTRPSHSCGP----HPVPPTPLVQHPEPEAPPQLPPPPP 88 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 PPPPP P P P PP P PP PP PPF Sbjct: 50 PPPPP-----TRPSHSCGPHPVPPT--PLVQHPEPEAPPQLPPPPPF 89 Score = 30.7 bits (66), Expect = 1.9 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 4/58 (6%) Frame = +1 Query: 817 PXXXPPXPPPPPPX----PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PPP P P P P P P P P PP P PP Sbjct: 45 PHYHQPPPPPTRPSHSCGPHPVPPTPLVQHPEPEAPPQLPPPPPFIVDDTESPQEQPP 102 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 31.9 bits (69), Expect = 0.82 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP 924 P P PP PP P P PP P P PP P Sbjct: 1355 PSTPRPRPPTPPRPPTPRPRPP---TPRPGPPTPRP 1387 Score = 31.9 bits (69), Expect = 0.82 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 879 PXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P P PP PP P P P P P PP P Sbjct: 1355 PSTPRPRPPTPPRPPTPRP-RPPTPRPGPPTP 1385 Score = 30.3 bits (65), Expect = 2.5 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 880 PXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P PP PP PP PP P P PP Sbjct: 1353 PIPSTPRPRPP-TPPRPP-TPRPRPPTPRPGPP 1383 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXP 903 P PP P PP P P PP P P Sbjct: 1575 PITPPPPTPSPPQTPPPVNTPPRPETPEP 1603 Score = 29.9 bits (64), Expect = 3.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPP 933 P P P P P PP P P PP P PP Sbjct: 1353 PIPSTPRPRPPTPPRPP---TPRPRPPTPRPGPP 1383 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPP 912 P PPPP P PP P P P Sbjct: 1575 PITPPPPTPSPPQTPPPVNTPPRPETP 1601 Score = 28.7 bits (61), Expect = 7.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 906 PPPXPPXPXPXXPXXPPPXPPXPP 977 P P P P P P PP P PP Sbjct: 1353 PIPSTPRPRPPTPPRPPTPRPRPP 1376 >SB_36422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 31.9 bits (69), Expect = 0.82 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 907 PPXXPPXPPLXXXXXPPPPPPXPP 978 PP PP PP PPP PP PP Sbjct: 29 PPEAPPLPPF--APLPPPVPPPPP 50 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 906 PPPXPPXPXPXXPXXPPPXPPXPP 977 PP PP P P P PPP PP PP Sbjct: 29 PPEAPPLP-PFAP-LPPPVPPPPP 50 >SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) Length = 256 Score = 31.9 bits (69), Expect = 0.82 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 900 PXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PP P PPP P PP Sbjct: 230 PKPPTAPPNTPPPPVTPPPPNTPGPP 255 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 901 PXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP P PPP P PP Sbjct: 230 PKPPTAPPNTPPPPVTPPPPNTPGPP 255 >SB_32850| Best HMM Match : GRP (HMM E-Value=0.089) Length = 676 Score = 31.9 bits (69), Expect = 0.82 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GGGGGG GG G G G G G G GGGG G G Sbjct: 556 GGGGGG---DYNGGDGDDDDG-GGGGDDDDGDGDGDDDDDGGGGDGDYNGG 602 Score = 31.1 bits (67), Expect = 1.4 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 4/54 (7%) Frame = -3 Query: 977 GGXGGG---GGGXXXXXRGGXGGXXGGXGXG-XXPXGGXAXGXGXGGGGGGXGG 828 GG GGG GG GG G G G G GG G GG G GG Sbjct: 556 GGGGGGDYNGGDGDDDDGGGGGDDDDGDGDGDDDDDGGGGDGDYNGGDGDYNGG 609 Score = 29.9 bits (64), Expect = 3.3 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 964 GXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GGG G G GGG G G GGG G G Sbjct: 556 GGGGGGDYNGGDGDDDDGGGGGDDDDGDGDGDDDDDGGGGDGDYNG 601 Score = 28.7 bits (61), Expect = 7.6 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGG-GGXGGXXXG 816 G GGG GG G GG G G G GG GG G G Sbjct: 586 GDDDDDGGGGDGDYNGGDGDYNGGDGDYNGGDDDYNGGDGDSNGGDGGDNGTGDG 640 >SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 955 Score = 31.9 bits (69), Expect = 0.82 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PPPPP P P P PP P PPP PP P Sbjct: 529 PTGPPPPPVPKPQFDDT--PTRAPPPPDMQTNP--DTERRPPPLPPAP 572 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P PP R P PP PP P P P PP P Sbjct: 505 PSDVAESPPPIPPIRCSSVSRPVRPTGPPPPPVPKPQFDDTPTRAPPPP 553 Score = 28.7 bits (61), Expect = 7.6 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PPP PP P P PP P P PPPP Sbjct: 505 PSDVAESPPPIPPIRCSSVSRP--VRPTGPPPPPVPKPQFDDTPTRAPPPP 553 >SB_29063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 31.9 bits (69), Expect = 0.82 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -3 Query: 962 GGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXWXSE 801 GGGG RG G G G G GG G G G G G G G E Sbjct: 18 GGGGDRGRGRGHCLGHGSGRG-GRGGRGGSGRGRGRGRGSGRGRGRGSGQGYGE 70 >SB_29025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 31.9 bits (69), Expect = 0.82 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 876 PPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 PP P PPP P P PPP PP P Sbjct: 139 PPAKEAPLP-PPPAQQEAVPDIPTSPPPVPPLP 170 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 875 PPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PPP P PP P P PP PP Sbjct: 138 PPPAKEAPLPPPPAQQEAVPDIPTSPPPVPP 168 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXP-XPPXXPPXPPL 936 PPPP P PP P P PP PPL Sbjct: 137 PPPPAKEAPLPPPPAQQEAVPDIPTSPPPVPPL 169 Score = 29.5 bits (63), Expect = 4.4 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +3 Query: 807 LPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXP 953 LP PPPP PP P P PP P P P P Sbjct: 126 LPKKEAAASSTPPPPAKEAPLPPPPAQQEAVPDIPTSPP-PVPPLPTEP 173 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 31.9 bits (69), Expect = 0.82 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGG 837 GG GGG G G GG GG G GG G GGGGG Sbjct: 423 GGSSGGGFG------GSSGGSFGGSSGG--SFGGSGFGSKSSGGGGG 461 Score = 30.7 bits (66), Expect = 1.9 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 959 GGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GG GG GG G G G GGG GG Sbjct: 419 GGAFGGSSGGGFGGSSGGSFGGSSGGSFGGSGFGSKSSGGGGGG 462 Score = 29.9 bits (64), Expect = 3.3 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -1 Query: 967 GGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGG 839 G GG G G GG GG G GGGGG Sbjct: 420 GAFGGSSGGGFGGSSGGSFGGSSGGSFGGSGFGSKSSGGGGGG 462 >SB_19709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 613 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Frame = +3 Query: 831 PXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXX--PXXPPPXPP 968 P P P P + PPP PP P P PPP PP Sbjct: 558 PKRPAPTPSQTQVKYMGSTSPVATSPPPHPPPPAHHVNKPGVPPPPPP 605 Score = 29.5 bits (63), Expect = 4.4 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 1/48 (2%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXX-PXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P P G P P P PP P PPP PP Sbjct: 558 PKRPAPTPSQTQVKYMGSTSPVATSPPPHPPPPAHHVNKPGVPPPPPP 605 >SB_14242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGG 840 G GGGG R G GG G G + G GGGG Sbjct: 339 GFGGGGATVASRPGGGGGYSGGGLASSGGSTLSSEGGVAGGGG 381 >SB_51494| Best HMM Match : Drf_FH1 (HMM E-Value=2.4) Length = 157 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/49 (34%), Positives = 19/49 (38%) Frame = +1 Query: 784 DYLXLYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXP 930 +Y + L Q P PPPP P P P P P PP P P Sbjct: 72 EYRAMGRLAQLPGASRAAPPPPVPEPEP---EPDLDLDLPVPPLETPRP 117 >SB_50230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/49 (34%), Positives = 19/49 (38%) Frame = +1 Query: 784 DYLXLYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXP 930 +Y + L Q P PPPP P P P P P PP P P Sbjct: 32 EYRAMGRLAQLPGASRAAPPPPVPEPEP---EPDLDLDLPVPPHETPRP 77 >SB_18836| Best HMM Match : C1_1 (HMM E-Value=7.3e-17) Length = 1440 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXG-XXPXPXPPXXPPXPPLXXXXXPPP 960 P PPPPPP P P P P P PP PP Sbjct: 1122 PLPPPPPPPIPDDDGDDTDSTQLPNPPPDMQLPDPPPPITINVPP 1166 >SB_14695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 31.5 bits (68), Expect = 1.1 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PT P P P R P P PP P P P P PPP P P Sbjct: 122 PTQGFRPYPGPLPVLSPQVYRGYPFQYPGTPPPPMYPAFP-PSFPSSPPPEYPGLP 176 >SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) Length = 1706 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = +3 Query: 909 PPXPPXPXPXX-PXXPPPXPPXPP 977 PP PP P P P PP PP PP Sbjct: 1259 PPLPPLPPPDAQPPSLPPQPPQPP 1282 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXP 909 PP PP PPP P + PP P P P Sbjct: 1259 PPLPPLPPPDAQPPSLPPQPPQP-PQP 1284 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPP 912 PP PP P P A PP P PP Sbjct: 1259 PPLPPLPPPDAQPPSLPPQPPQPP 1282 >SB_1375| Best HMM Match : Extensin_2 (HMM E-Value=0.18) Length = 796 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PPPPP P P P P P P P PP Sbjct: 364 PPMGPPPPPGFNLHTGPRLHMGPPPSGFHAQRGPQPEMGPTPQPHPYVPP 413 Score = 28.7 bits (61), Expect = 7.6 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PPPPP P P P P P P P PP Sbjct: 364 PPMGPPPPPGFNLHTGPRLHMGPPPSGFHAQRGPQPEMGPTPQPHPYVPP 413 >SB_52268| Best HMM Match : SecA_PP_bind (HMM E-Value=0.33) Length = 774 Score = 25.8 bits (54), Expect(2) = 1.3 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 955 PPPPPXPPF 981 PPPPP PPF Sbjct: 415 PPPPPTPPF 423 Score = 23.8 bits (49), Expect(2) = 1.3 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 817 PXXXPPXPPPPPPXP 861 P P PPPPP P Sbjct: 408 PQPWSPAPPPPPTPP 422 >SB_59007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGG 846 GGGG G GG G G G G GG G G G G Sbjct: 25 GGGGSGEGDDDDGGCGDDEDG-GGGENDDGGVDVGDGGGDG 64 >SB_51557| Best HMM Match : Collagen (HMM E-Value=0.56) Length = 697 Score = 31.1 bits (67), Expect = 1.4 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 10/59 (16%) Frame = -3 Query: 974 GXGGGG----------GGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 G GGG GG GG GG G G G GG G G G G GG Sbjct: 473 GMGGGANGMAGGMNGMGGGMDDMAGGMGGGMNGMGAGMNAMGGGLNGIGGMNGMRGIGG 531 >SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 965 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXP 897 P PPPPP P P PP P Sbjct: 461 PIPPPPPMSPPPPTPPPPATSP 482 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/20 (60%), Positives = 12/20 (60%), Gaps = 2/20 (10%) Frame = +1 Query: 829 PPXPP--PPPPXPXPXAXPP 882 PP PP PPPP P P A P Sbjct: 463 PPPPPMSPPPPTPPPPATSP 482 >SB_42661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1717 Score = 31.1 bits (67), Expect = 1.4 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXG-GGGGXXGG 827 G G G G G G G G G G G G G GGGG GG Sbjct: 226 GHGRTAGVGAGSDSGVGSGGGYGGVGGGSGGIAYGSVFKPVDLGSGGGGSWGG 278 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = -2 Query: 963 GXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGGXL 811 G G G G G GG G + GGGG G GGG L Sbjct: 234 GAGSDSGVGSGGGYGGVGGGSGGIAYGSVFKPVDLGSGGGGSWGGAGGGCL 284 Score = 29.1 bits (62), Expect = 5.8 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G G G GG G GG G G G G GGGG G G Sbjct: 232 GVGAGSDSGVGSGGGYGGVGG-GSGGIAYGSVFKPVDLGSGGGGSWGGAGG 281 >SB_27771| Best HMM Match : SH2 (HMM E-Value=8.6e-16) Length = 896 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/49 (30%), Positives = 16/49 (32%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P P P + P P P P P P PP PP Sbjct: 150 PHPSPTPAQAPPHSRPVAAKRPMPSTPDQNPCPSEAPPRLPPANKLLPP 198 Score = 29.9 bits (64), Expect = 3.3 Identities = 22/74 (29%), Positives = 22/74 (29%), Gaps = 7/74 (9%) Frame = +2 Query: 776 EXLTTXXXTHSXNXPPPXPXXPPP----PPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXP 943 E LT HS P P PP P P P P P P PS P Sbjct: 117 EGLTLETTPHSTTPQHPTPQHSPPIRKQTPPSKPHPSPTPAQAPPHSRPVAAKRPMPSTP 176 Query: 944 XXXP---PXPPXXP 976 P PP P Sbjct: 177 DQNPCPSEAPPRLP 190 >SB_26560| Best HMM Match : 7tm_1 (HMM E-Value=6.3e-09) Length = 556 Score = 31.1 bits (67), Expect = 1.4 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 3/57 (5%) Frame = -3 Query: 977 GGXGGG---GGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG G G GGG GG G G G G A G GGGG GG G Sbjct: 435 GGIGDGAIGGGGDGAIGGGGDGAIGSAIGDGVNSDDG-AIGC-DGGGGANVGGDIGG 489 Score = 30.7 bits (66), Expect = 1.9 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXG-GXGGGXG-XXXXXXGGXRXXXXXGGGGGXXGG 827 G GG G GGG G G G G G GG GG G GG Sbjct: 443 GGGGDGAIGGGGDGAIGSAIGDGVNSDDGAIGCDGGGGANVGGDIGGNNGAIGG 496 Score = 29.1 bits (62), Expect = 5.8 Identities = 20/61 (32%), Positives = 21/61 (34%), Gaps = 3/61 (4%) Frame = -1 Query: 982 GXGGXGGXGGGXXG-XXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGG--GGXXGGXXXXV 812 G G G GGG G G G G G G G GG GG GG + Sbjct: 435 GGIGDGAIGGGGDGAIGGGGDGAIGSAIGDGVNSDDGAIGCDGGGGANVGGDIGGNNGAI 494 Query: 811 G 809 G Sbjct: 495 G 495 >SB_3226| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=0.021) Length = 1217 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 965 GGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GGGG RGG G G GG G G GG GG Sbjct: 1028 GGGGAWRAGDRGGDRDPRGDRGGFGRDRGGYGDRSERGFGDGGDGG 1073 >SB_43620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1680 Score = 31.1 bits (67), Expect = 1.4 Identities = 23/75 (30%), Positives = 24/75 (32%), Gaps = 7/75 (9%) Frame = +1 Query: 772 VXXTDYLXLYSLXQXPXXXPPXPPPPP---PXPXPXAXPPXGXXPXPXP---PXXPPXP- 930 V Y L + Q P P P P P P P P P P PP P Sbjct: 702 VPEVPYPTLSTAAQPTQAQNPAPTPAPTQAQNPAPTPAPTQAQNPAPTPAPTQAQPPVPS 761 Query: 931 PLXXXXXPPPPPPXP 975 P PP P P P Sbjct: 762 PAPTQAQPPAPSPAP 776 >SB_36275| Best HMM Match : Extensin_2 (HMM E-Value=0.062) Length = 406 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PP P P P P P P P P P P PP P P Sbjct: 244 PPTPTPHTSIP-PTPTPHTSIPPTPTPHTSIPPTPTPHTSIPPTPTP 289 Score = 30.7 bits (66), Expect = 1.9 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PP P P P P P P P P P P PP P P Sbjct: 254 PPTPTPHTSIP-PTPTPHTSIPPTPTPHTSIPPTPTPHTSIPPTPHP 299 >SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) Length = 421 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P P P P A PP G P P PP PPP P Sbjct: 218 PPQNHPLTNYPAPPPQGYAPPPGGYPGAPPAGGYPGAPPPGGYPGGPPPANYP 270 Score = 29.9 bits (64), Expect = 3.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 4/54 (7%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAX-PPXGXXPXPXPPXXPPXPPLXXXXXPP---PPPPXPP 978 PP PP P PP G P P P PP PP PPP P Sbjct: 158 PPGTQPPGQGGYPGYNQPPPGHYPAPGQPGGYYPPPGGYQQPPPGGYAPPPYVP 211 Score = 28.7 bits (61), Expect = 7.6 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 3/50 (6%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP---PPXPP 978 PP P A PP G P P P PP PPP P PP Sbjct: 218 PPQNHPLTNYPAPPPQGYAPPPG--GYPGAPPAGGYPGAPPPGGYPGGPP 265 >SB_23696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 559 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG G GGGG GG G G G G GGGGG G G Sbjct: 419 GGGGRGGGGGDGG--GGGEGVQGTPYTPEEEEGRALQACGRGGGGGECGEKEEG 470 >SB_17676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1271 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 843 PPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P P R P P P P P P PP PP PP Sbjct: 135 PMHPPLSNTRHNPKVAVPHPNTPYYHPKPADPAPMQPPAPPPSPP 179 >SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) Length = 628 Score = 31.1 bits (67), Expect = 1.4 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 829 PPXPPPPPPXPXP 867 PP PPPPPP P P Sbjct: 211 PPPPPPPPPPPPP 223 Score = 31.1 bits (67), Expect = 1.4 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 829 PPXPPPPPPXPXP 867 PP PPPPPP P P Sbjct: 212 PPPPPPPPPPPPP 224 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +1 Query: 790 LXLYSLXQXPXXXPPXPPPPPP 855 L Y + P PP PPPPPP Sbjct: 203 LLAYGDAKPPPPPPPPPPPPPP 224 Score = 28.7 bits (61), Expect = 7.6 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +1 Query: 919 PPXPPLXXXXXPPPPPPXPP 978 PP PP PPPPPP PP Sbjct: 211 PPPPP------PPPPPPPPP 224 >SB_10368| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 413 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PP P P P P P P P PPL P P P Sbjct: 220 PAMPPVPAMRPLPAMRPLPAMRPLPAMRPLPAMPPLPAMRPLPAMRPLP 268 Score = 30.7 bits (66), Expect = 1.9 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PP P P P P P P P PPL P P P Sbjct: 250 PAMPPLPAMRPLPAMRPLPAMRPLPAMRPLPAMPPLPAMRPLPAMRPLP 298 >SB_2691| Best HMM Match : Luteo_Vpg (HMM E-Value=2.1) Length = 332 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGG--GGXGGXXXG 816 G GGGGG GG G G GG G G GG G GG G Sbjct: 114 GHGGGGGSNGEVSDGGDDSSDDSGG-GDDSGGGDDSGDGGGGNDSVGASGGYCGG 167 >SB_51034| Best HMM Match : Extensin_2 (HMM E-Value=0.038) Length = 354 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPP 933 PPPPPP P P P P PP PP Sbjct: 73 PPPPPPGPYYQGRPAHWHQP-PGGMSYPPAPP 103 >SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) Length = 519 Score = 30.7 bits (66), Expect = 1.9 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PP P P P P P PP P P PP P P L P P P Sbjct: 35 PPIPHGPRPLP-PLREPPT-PAPTP-PPALPSTPTLPLAPRPRPTASQP 80 Score = 28.7 bits (61), Expect = 7.6 Identities = 21/93 (22%), Positives = 30/93 (32%), Gaps = 4/93 (4%) Frame = +1 Query: 712 VHLQRRCRVLADSYHXINLXVXXTDYLXLYSLXQXPXXXPPXPPPPPPXPXP----XAXP 879 + L R + +D+++ L + + P PP PP P P P + P Sbjct: 6 IPLSIRRNIFSDAFNSRARPSSTRTKLAVPPIPHGPRPLPPLREPPTPAPTPPPALPSTP 65 Query: 880 PXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P P PPP P Sbjct: 66 TLPLAPRPRPTASQPTTRTQYSGGGAIPPPLIP 98 >SB_8802| Best HMM Match : WW (HMM E-Value=3.2e-31) Length = 662 Score = 30.7 bits (66), Expect = 1.9 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 2/56 (3%) Frame = +1 Query: 817 PXXXPPXPPP--PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PP PP PP G P P P P P L P P P P Sbjct: 354 PNHRPQGLPPGMPPMALSLPGMPPPGLLPPPGMPPRLPIPGLGLPGMPLPGMPGMP 409 Score = 29.9 bits (64), Expect = 3.3 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 2/48 (4%) Frame = +2 Query: 839 PP--PPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PP PP PPP P PP P P P P P P Sbjct: 362 PPGMPPMALSLPGMPPPGLLPPPGMPPRLPIPGLGLPGMPLPGMPGMP 409 >SB_5854| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.3e-17) Length = 1850 Score = 30.7 bits (66), Expect = 1.9 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 5/44 (11%) Frame = +3 Query: 849 PPXXXXXRXPPXXXXXXPXPPPXP-----PXPXPXXPXXPPPXP 965 PP R PP PPP P P P P PPP P Sbjct: 1445 PPFPAEHRIPPPDPAERRVPPPFPAERRTPAPDPAERRVPPPFP 1488 >SB_5034| Best HMM Match : Extensin_2 (HMM E-Value=0.0055) Length = 695 Score = 30.7 bits (66), Expect = 1.9 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 5/53 (9%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPX-----PXPPXXPPXPPLXXXXXPPPPPPXP 975 P P P PP A PP P PP PL P PPP P Sbjct: 199 PSPKPRPPRASKIAAPPAPSLQAVCIDLPEPPLKAGDSPLKRSVKAPLPPPPP 251 >SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 911 Score = 30.7 bits (66), Expect = 1.9 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 11/58 (18%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPP-----------XXPPXPPLXXXXXPPPPPPXPP 978 PPP P P PP G P PP PP PPPPP P Sbjct: 593 PPPHPSGGYPQPSPPHGGHPHHPPPTGYPGGYPGTHTAPPAGGYPTGQHPPPPPAGYP 650 Score = 29.9 bits (64), Expect = 3.3 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P P P P PP P P P PP PPP P Sbjct: 580 PAPTPSYPQPGTYPP----PHPSGGYPQPSPPHGGHPHHPPPTGYP 621 >SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1929 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 906 PPPXPPXPXPXXPXXPPPXPP 968 PP PP P P PPP PP Sbjct: 1166 PPQPPPVPSVQAPPAPPPAPP 1186 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 907 PPXXPPXPPLXXXXXPPPPPPXPP 978 PP PP P + PP PPP PP Sbjct: 1166 PPQPPPVPSV---QAPPAPPPAPP 1186 >SB_15415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1390 Score = 25.8 bits (54), Expect(2) = 2.2 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +1 Query: 799 YSLXQXPXXXPPXPPPPPP 855 +++ P P PPPPPP Sbjct: 1037 HNIAHEPIMEEPFPPPPPP 1055 Score = 23.0 bits (47), Expect(2) = 2.2 Identities = 9/22 (40%), Positives = 9/22 (40%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXP 903 P PPPP P P P P Sbjct: 1048 PFPPPPPPYQTGSPIRAFPPPP 1069 >SB_56109| Best HMM Match : Collagen (HMM E-Value=0.79) Length = 327 Score = 30.3 bits (65), Expect = 2.5 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GG GGG G GG G G + G G G G G G Sbjct: 257 GSEGGFGGGGAAFLYAGGGGGYSGGGVTRATRYSKSGGGGSYNAGSGQEGEVRG 310 Score = 29.5 bits (63), Expect = 4.4 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 G G G GG GG G GG A GGGG GG Sbjct: 233 GASGVNATGGSAYVNGGEGGLGTTGSEGGFGGGGAAFLYAGGGGGYSGGG 282 >SB_52043| Best HMM Match : Collagen (HMM E-Value=0.77) Length = 97 Score = 30.3 bits (65), Expect = 2.5 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 G GGGGGG G GG G G GG GG Sbjct: 4 GDDGGGGGGGNDDDGGNDNDDGGGKDDGANGDDGGGGNDDDGGNDDDDGG 53 >SB_49284| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1041 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/42 (33%), Positives = 16/42 (38%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPL 936 + P P PP P P PP P P P P PP+ Sbjct: 411 EPPQQQPQQQRQSPPQPSPTGAPP--QRPHPPPQQPSPRPPM 450 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 845 PPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP 958 PP R P P PP P P P P PP Sbjct: 412 PPQQQPQQQRQSPPQPSPTGAPPQRPHPPPQQPSPRPP 449 >SB_48544| Best HMM Match : TSP_1 (HMM E-Value=3.1e-32) Length = 326 Score = 30.3 bits (65), Expect = 2.5 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 965 GGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 G G G G G GG G G G A G GG G G G Sbjct: 268 GSGSGFVSSGSGSGSGSRGGSGSG---EGSGASDEGSGGEGSGDG 309 >SB_47181| Best HMM Match : Pkinase (HMM E-Value=7.7e-31) Length = 801 Score = 30.3 bits (65), Expect = 2.5 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 G G G G G G G G G G GG GG GG Sbjct: 312 GLGSGDSSGSFKSTGENPENNGSAGDGSGDRGFLGGGGGGGGSSGGGGG 360 >SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) Length = 1230 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 PPP P P PPP PP P P P P Sbjct: 432 PPPRPYASQFADAPPVSPTTATPPPPPPSQPPPQQFIPSPQFP 474 >SB_37296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGG 908 G GG G GGG G G G G GG Sbjct: 380 GLGGAGVFGGGGVGGAGVGGAGVGG 404 >SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 30.3 bits (65), Expect = 2.5 Identities = 17/58 (29%), Positives = 19/58 (32%), Gaps = 3/58 (5%) Frame = +1 Query: 811 QXPXXXPPXPPPPP---PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 Q P PP P P P + P P P P P PP+ PP P Sbjct: 870 QQPAFQPPSPQPTQFYNPASYQPSAPSSMPAPVPLQPYNTPMPPISSTPYQAPPTLPP 927 Score = 29.1 bits (62), Expect = 5.8 Identities = 15/51 (29%), Positives = 15/51 (29%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P P P P P PP P PP PP P P P Sbjct: 892 PSAPSSMPAPVPLQPYNTPMPPISSTPYQAPPTLPPTTLTTPSWSQPVPVP 942 >SB_33219| Best HMM Match : RhoGAP (HMM E-Value=0.0014) Length = 399 Score = 30.3 bits (65), Expect = 2.5 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PPP P P P P P P P PPP P Sbjct: 217 PAPAPPPRPCPAPRVRKTIPSSTDSLPRPGRPPSPSTRGMKPLPPPKKP 265 >SB_33199| Best HMM Match : Collagen (HMM E-Value=0.77) Length = 134 Score = 30.3 bits (65), Expect = 2.5 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 G GGGGGG G GG G G GG GG Sbjct: 44 GDDGGGGGGGNDDDGGNDNDDGGGKDDGANGDDGGGGNDDDGGNDDDDGG 93 >SB_31707| Best HMM Match : Extensin_2 (HMM E-Value=0.19) Length = 309 Score = 30.3 bits (65), Expect = 2.5 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P P P P P P PP P L P P P PP Sbjct: 174 PGQPSPEYPHPYPPLRPEYA---HPYPPRRPEYAHLYPPRRPEYPHPYPP 220 >SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2202 Score = 30.3 bits (65), Expect = 2.5 Identities = 28/125 (22%), Positives = 51/125 (40%), Gaps = 1/125 (0%) Frame = -3 Query: 911 GGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXWXSEXSXR*SVXXTXRLIX*XESARTR 732 GG G GG A G G G GG GG G E + + L T Sbjct: 292 GGITAGGTAEGGNAGGNG--GNAGGNGGMTGGGAGGEVELGFMLDTSTSLGGEANLKITL 349 Query: 731 HRLWR-WTAYVVASTAFAISLVXWAVSKPTSTSRTLLSVVNSISSRLTFVEVVSXGSATG 555 + + ++ ++S+A+ + +V + S + + S I S L+ ++++ +A G Sbjct: 350 DFIKAVYGSFTISSSAYRVGVVIFGSSAKVAFDFSKFSSSAEIESGLSEIKLIGGATAAG 409 Query: 554 LWLSS 540 L++ Sbjct: 410 QGLTT 414 >SB_58404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 532 Score = 30.3 bits (65), Expect = 2.5 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -2 Query: 957 GGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 GG G G G GG G GGR GGGG G GG Sbjct: 430 GGGRGGFRGNRGGFRGGNERGQRR--GGRGGHGPPRGGGGFSGPRGG 474 Score = 29.9 bits (64), Expect = 3.3 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGX--GGXXGGXGXGXXPXGGXAXGXGXGGG 846 GG GG G RGG G GG G P GG GGG Sbjct: 430 GGGRGGFRGNRGGFRGGNERGQRRGGRGGHGPPRGGGGFSGPRGGG 475 >SB_42044| Best HMM Match : ubiquitin (HMM E-Value=1.2e-06) Length = 1425 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 876 PPXXXXXXPXPPPXPPXPXPXXPXXPPPXP 965 PP P PP P P P PPP P Sbjct: 137 PPKYSTSAPVQPPPAPTPVGSTPSDPPPAP 166 >SB_29605| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 30.3 bits (65), Expect = 2.5 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 1/48 (2%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXG-GXXGGXGXGXXPXGGXAXGXGXGGGGGG 837 G G G GG +GG G G G G G GG G GG G G Sbjct: 35 GQGGNGQGGDGQAGQGGNGQGGDGQAGQGGNGQGGDGPA-GQGGDGPG 81 >SB_20903| Best HMM Match : Extensin_2 (HMM E-Value=0.3) Length = 713 Score = 30.3 bits (65), Expect = 2.5 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 2/49 (4%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPP--XXPPXPPLXXXXXPPPPPP 969 PP PPP P P PP PP PP P PP Sbjct: 487 PPPPPPSDAMMQGMGAPSMSEPPAGGPPMGQGPPRPPTNPTAAPMGQPP 535 >SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) Length = 1103 Score = 30.3 bits (65), Expect = 2.5 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +2 Query: 818 PPPXPXXP---PPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPS 937 PPP P P PP PPP P PP P P+ Sbjct: 272 PPPIEHRPHHRPFPPAVHAPYHPPPAYSNPTYQPPASTYPPPT 314 >SB_7159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 30.3 bits (65), Expect = 2.5 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 GG GG GG G G G GG GGG GG G G G G Sbjct: 14 GGDGGDSGG--GSDGGGDGGDGGGGS-----DGGDGEGDDDGDGEGDDDG 56 >SB_6095| Best HMM Match : 7tm_1 (HMM E-Value=0.013) Length = 872 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 910 PXXPPXPPLXXXXXPPPPPPXP 975 P PP PP PP PPP P Sbjct: 791 PPTPPPPPRVMNGLPPSPPPSP 812 >SB_48061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 307 Score = 29.9 bits (64), Expect = 3.3 Identities = 23/68 (33%), Positives = 23/68 (33%), Gaps = 5/68 (7%) Frame = +1 Query: 790 LXLYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP---- 957 L L SL P PPPP P PP PP P P PP Sbjct: 132 LELASLPTSATTPIPQIPPPPTYLHPSQYPPS------PPPWELPRVPSANATLPPHLQY 185 Query: 958 -PPPPXPP 978 PPPP P Sbjct: 186 GPPPPTSP 193 >SB_38159| Best HMM Match : Peptidase_M28 (HMM E-Value=4.7e-09) Length = 1049 Score = 29.9 bits (64), Expect = 3.3 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 G G GGG G G G G G G G G GG G Sbjct: 237 GDGDGGGDGDGDGDGDGDGDGDGDGDGDGDGDGGVGGGGGGGSCNDKG 284 >SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +1 Query: 901 PXPPXXPPXPPLXXXXXPPPPPP 969 P P PP PP+ PPPPPP Sbjct: 197 PPPSGAPPPPPI---GAPPPPPP 216 >SB_9614| Best HMM Match : GBP (HMM E-Value=1e-31) Length = 708 Score = 29.9 bits (64), Expect = 3.3 Identities = 19/61 (31%), Positives = 20/61 (32%), Gaps = 1/61 (1%) Frame = -1 Query: 967 GGXGGGXXGXXGXGX-GGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRVSXAX 791 GG GG G G G GG GG GG R G G G G + Sbjct: 625 GGMWGGARGYPGTGRKGGHGGSQAKAGGMWGGARGYPGTGRESGHGGAQAESGGMLGGVC 684 Query: 790 G 788 G Sbjct: 685 G 685 >SB_1944| Best HMM Match : DUF1482 (HMM E-Value=7.3) Length = 491 Score = 29.9 bits (64), Expect = 3.3 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P P P PP G P P PP P P P PP Sbjct: 421 PHLPDGQRPSPRPVPDPPDGQHLSPRPVPDPP----DGQHLSPRPVPDPP 466 >SB_47680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2749 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPP 923 PP PPP P P P PP PP Sbjct: 359 PPQSPPPSPPESYNSEPEDSPLVGPSKPPTPP 390 >SB_4771| Best HMM Match : DEAD (HMM E-Value=0.015) Length = 592 Score = 29.9 bits (64), Expect = 3.3 Identities = 22/76 (28%), Positives = 24/76 (31%) Frame = +2 Query: 731 AEFLPXXXXXXXXLXEXLTTXXXTHSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXP 910 A F+P L E + P P P PPP PPP P Sbjct: 44 AGFIPADSVPDEVLAESGVGPPVASTPPAPQPVPNNMGPPPHVNQG--PPP--NSANQAP 99 Query: 911 PXXPXPXPSXPXXXPP 958 P P P PS PP Sbjct: 100 PPNPGPSPSFNSQGPP 115 >SB_54430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 25.0 bits (52), Expect(2) = 4.0 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -3 Query: 860 GXGGGGGGXGG 828 G GGGGGG GG Sbjct: 301 GGGGGGGGGGG 311 Score = 23.0 bits (47), Expect(2) = 4.0 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -3 Query: 977 GGXGGGGGG 951 GG GGGGGG Sbjct: 300 GGGGGGGGG 308 >SB_35620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 271 Score = 25.0 bits (52), Expect(2) = 4.2 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -3 Query: 860 GXGGGGGGXGG 828 G GGGGGG GG Sbjct: 68 GGGGGGGGGGG 78 Score = 24.6 bits (51), Expect(2) = 5.4 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -3 Query: 866 GXGXGGGGGGXG 831 G G GGGGGG G Sbjct: 69 GGGGGGGGGGRG 80 Score = 24.2 bits (50), Expect(2) = 5.4 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -3 Query: 854 GGGGGGXGGXXXG 816 GGGGGG GG G Sbjct: 68 GGGGGGGGGGGRG 80 Score = 23.4 bits (48), Expect(2) = 5.4 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -3 Query: 866 GXGXGGGGGGXGG 828 G GGGGGG GG Sbjct: 63 GCVHGGGGGGGGG 75 Score = 23.0 bits (47), Expect(2) = 4.2 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -3 Query: 977 GGXGGGGGG 951 GG GGGGGG Sbjct: 67 GGGGGGGGG 75 Score = 23.0 bits (47), Expect(2) = 5.4 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -3 Query: 977 GGXGGGGGG 951 GG GGGGGG Sbjct: 68 GGGGGGGGG 76 >SB_56224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 798 Score = 29.5 bits (63), Expect = 4.4 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GGGG G G GG GG G GGG G G Sbjct: 194 GGGGVGTTGGSTGAAGGGGGGTSTSTGSSGSTGTSMVTSGGGISTSGSSSG 244 Score = 29.1 bits (62), Expect = 5.8 Identities = 18/69 (26%), Positives = 20/69 (28%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRV 803 G GG G G G GG GGG G GGG G + Sbjct: 189 GASAGGGGGVGTTGGSTGAAGGGGGGTSTSTGSSGSTGTSMVTSGGGISTSGSSSGSSQS 248 Query: 802 SXAXGSQXF 776 + G F Sbjct: 249 GASGGKTIF 257 >SB_52684| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 29.5 bits (63), Expect = 4.4 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 918 PPXPXPXXPXXPPPXPP 968 PP P P P PPP PP Sbjct: 139 PPQPSPPQPPQPPPQPP 155 >SB_51714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 900 PXPPPXPPXPXPXXPXXPPPXPP 968 P PP PP P P PPP P Sbjct: 366 PPPPHSPPPPLPVIQLNPPPARP 388 Score = 28.7 bits (61), Expect = 7.6 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 895 PXPXPPXXPPXPPLXXXXXPPPP 963 P P PP P PPL PPP Sbjct: 363 PTPPPPPHSPPPPLPVIQLNPPP 385 >SB_51555| Best HMM Match : ATP-cone (HMM E-Value=3.3) Length = 491 Score = 29.5 bits (63), Expect = 4.4 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 3/44 (6%) Frame = -3 Query: 965 GGGGGXXXXXRGGXGGXX---GGXGXGXXPXGGXAXGXGXGGGG 843 GGGGG GG GG G G GG A GGGG Sbjct: 355 GGGGGADLQTLGGGGGVQTLGGQTMQGVQSYGGGAGMQSFGGGG 398 Score = 28.7 bits (61), Expect = 7.6 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -1 Query: 967 GGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGG 839 GG G G G GG G GG GGGGG Sbjct: 328 GGSMQSLGGDAGGSMQGLAGGGGIQSFGGGGGADLQTLGGGGG 370 >SB_44452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PPPP P P P P P PP P PP Sbjct: 227 PHPPPPRVVPLPVVVQEEQEQPRPRKSVLPARVADGTEATPPRPNTSPP 275 >SB_33008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1016 Score = 29.5 bits (63), Expect = 4.4 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 GG GG G + G G G G G GG A G G G G G Sbjct: 477 GGVGGATGSIGN--KEGIGDIATGNGVGVTGSGGVATESGGGAIGNGDG 523 >SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) Length = 693 Score = 29.5 bits (63), Expect = 4.4 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P P P PPP P P P PP P P P PP P Sbjct: 37 PPPSSVPVSYPGPPPAMYAVPGMPMPPAY-PGMPTYPPQPMQFLPGTLPGMPPPP 90 >SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) Length = 1467 Score = 29.5 bits (63), Expect = 4.4 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 3/48 (6%) Frame = +1 Query: 832 PXPPPPP---PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 P PPP P P P P P PP PP PPP Sbjct: 602 PTPPPLPLSIPLLLQATPPHLQSTAQPRPTTVPPLPPTPPPRQSTPPP 649 >SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) Length = 782 Score = 29.5 bits (63), Expect = 4.4 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GGGG G G GG GG G GGG G G Sbjct: 240 GGGGVGTTGGSTGAAGGGGGGTSTSTGSSGSTGTSMVTSGGGISTSGSSSG 290 Score = 29.1 bits (62), Expect = 5.8 Identities = 18/69 (26%), Positives = 20/69 (28%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRV 803 G GG G G G GG GGG G GGG G + Sbjct: 235 GASAGGGGGVGTTGGSTGAAGGGGGGTSTSTGSSGSTGTSMVTSGGGISTSGSSSGSSQS 294 Query: 802 SXAXGSQXF 776 + G F Sbjct: 295 GASGGKTIF 303 >SB_45593| Best HMM Match : ArfGap (HMM E-Value=3.3e-37) Length = 732 Score = 29.5 bits (63), Expect = 4.4 Identities = 19/56 (33%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGG--XGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGGG G +GG G G G A G G GG G G Sbjct: 640 GGIGGGGMGGGFSGQGGGFPTSQAQADGFGTSQGGFGASQGGFGASQGGFGAKMGG 695 Score = 28.7 bits (61), Expect = 7.6 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXR--GGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG G GGG G G GG G G G G GGG GG G Sbjct: 649 GGFSGQGGGFPTSQAQADGFGTSQGGFGASQGGFGASQGGFG-AKMGGGMGGQQYG 703 >SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1430 Score = 29.5 bits (63), Expect = 4.4 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXP 879 PP PPPPPP P P Sbjct: 795 PPPPPPPPPPPEDLIIP 811 Score = 28.7 bits (61), Expect = 7.6 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +1 Query: 829 PPXPPPPPPXP 861 PP PPPPPP P Sbjct: 794 PPPPPPPPPPP 804 >SB_12281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 327 Score = 29.5 bits (63), Expect = 4.4 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 799 YSLXQXPXXXPPXPPPPPP 855 Y P PP PPPPPP Sbjct: 241 YEYQSLPPYLPPAPPPPPP 259 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 29.5 bits (63), Expect = 4.4 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +1 Query: 829 PPXPPPPPPX--PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PP P P P P P P P PP PPP PP Sbjct: 382 PPRGMPPKEDWGPGPRGMGPGMGPPRPMGPPGPHGPPFGPRG--PPPHGGPP 431 Score = 29.5 bits (63), Expect = 4.4 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXP-XPXPSXPXXXP 955 PP P PP P R PP P PP P P P P P Sbjct: 405 PPRPMGPPGPHGPPFGPRGPP----PHGGPPRGPMGPGPGMPPMRP 446 Score = 29.1 bits (62), Expect = 5.8 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP P P PP G P P PP P+ PP P Sbjct: 401 PGMGPPRPMGPPGPHGPPFGPR-GPPPHGGPPRGPMGPGPGMPPMRP 446 >SB_5429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 29.5 bits (63), Expect = 4.4 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 918 PPXPXPXXPXXPPPXPP 968 PP P P P PPP PP Sbjct: 157 PPQPSPPQPPQPPPQPP 173 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,291,339 Number of Sequences: 59808 Number of extensions: 818882 Number of successful extensions: 21267 Number of sequences better than 10.0: 298 Number of HSP's better than 10.0 without gapping: 2469 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8544 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2907797044 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -