BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_G10 (982 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 67 1e-11 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 65 6e-11 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 65 6e-11 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 60 2e-09 At1g61080.1 68414.m06877 proline-rich family protein 58 1e-08 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 58 1e-08 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 56 4e-08 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 55 8e-08 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 54 1e-07 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 54 2e-07 At2g30560.1 68415.m03722 glycine-rich protein 53 3e-07 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 53 3e-07 At5g46730.1 68418.m05757 glycine-rich protein 52 4e-07 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 52 6e-07 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 52 6e-07 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 52 8e-07 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 52 8e-07 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 51 1e-06 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 51 1e-06 At1g75550.1 68414.m08780 glycine-rich protein 50 2e-06 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 50 2e-06 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 50 2e-06 At4g01985.1 68417.m00265 expressed protein 50 2e-06 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 50 2e-06 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 50 3e-06 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 50 3e-06 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 49 5e-06 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 48 7e-06 At1g26150.1 68414.m03192 protein kinase family protein similar t... 48 7e-06 At1g10620.1 68414.m01204 protein kinase family protein contains ... 48 7e-06 At5g19090.1 68418.m02269 heavy-metal-associated domain-containin... 48 1e-05 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 48 1e-05 At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protei... 47 2e-05 At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protei... 47 2e-05 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 47 2e-05 At2g05440.2 68415.m00575 glycine-rich protein 47 2e-05 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 47 2e-05 At1g27710.1 68414.m03387 glycine-rich protein 47 2e-05 At5g33390.1 68418.m03985 glycine-rich protein similar to nuclear... 47 2e-05 At2g05440.1 68415.m00574 glycine-rich protein 47 2e-05 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 47 2e-05 At1g29380.1 68414.m03592 hypothetical protein 47 2e-05 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 47 2e-05 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 46 3e-05 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 46 3e-05 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 46 3e-05 At2g05510.1 68415.m00583 glycine-rich protein 46 3e-05 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 46 3e-05 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 46 4e-05 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 46 4e-05 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 46 4e-05 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 46 4e-05 At5g08230.1 68418.m00965 PWWP domain-containing protein putative... 46 5e-05 At2g25050.1 68415.m02996 formin homology 2 domain-containing pro... 46 5e-05 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 46 5e-05 At2g28490.1 68415.m03462 cupin family protein similar to preproM... 45 7e-05 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 45 7e-05 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 45 7e-05 At1g02710.1 68414.m00222 glycine-rich protein 45 7e-05 At4g30460.1 68417.m04325 glycine-rich protein 45 9e-05 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 45 9e-05 At5g62210.1 68418.m07811 embryo-specific protein-related contain... 44 1e-04 At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; g... 44 1e-04 At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar... 44 1e-04 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 44 1e-04 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 44 1e-04 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 44 1e-04 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 44 2e-04 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 44 2e-04 At1g26240.1 68414.m03201 proline-rich extensin-like family prote... 44 2e-04 At1g11850.1 68414.m01363 expressed protein 44 2e-04 At1g04660.1 68414.m00463 glycine-rich protein 44 2e-04 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 44 2e-04 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 44 2e-04 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 44 2e-04 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 43 3e-04 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 43 3e-04 At5g38560.1 68418.m04662 protein kinase family protein contains ... 43 3e-04 At4g18570.1 68417.m02749 proline-rich family protein common fami... 43 3e-04 At2g43150.1 68415.m05358 proline-rich extensin-like family prote... 43 3e-04 At1g11850.2 68414.m01364 expressed protein 43 3e-04 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 43 4e-04 At3g22070.1 68416.m02785 proline-rich family protein contains pr... 43 4e-04 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 42 5e-04 At4g29030.1 68417.m04151 glycine-rich protein glycine-rich prote... 42 5e-04 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 42 5e-04 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 42 5e-04 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 42 5e-04 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 42 5e-04 At3g32400.1 68416.m04142 formin homology 2 domain-containing pro... 42 6e-04 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 42 8e-04 At3g51290.1 68416.m05614 proline-rich family protein 42 8e-04 At3g24550.1 68416.m03083 protein kinase family protein contains ... 42 8e-04 At1g62240.1 68414.m07021 expressed protein 42 8e-04 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 42 8e-04 At1g15840.1 68414.m01901 expressed protein 42 8e-04 At1g15830.1 68414.m01900 expressed protein 42 8e-04 At1g23540.1 68414.m02960 protein kinase family protein contains ... 41 0.001 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 41 0.001 At5g26070.1 68418.m03102 hydroxyproline-rich glycoprotein family... 41 0.001 At4g29020.1 68417.m04149 glycine-rich protein supporting cDNA gi... 41 0.001 At3g50180.1 68416.m05486 hypothetical protein 41 0.001 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 41 0.001 At1g70990.1 68414.m08190 proline-rich family protein 41 0.001 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 41 0.001 At5g19090.2 68418.m02270 heavy-metal-associated domain-containin... 40 0.002 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 40 0.002 At2g11005.1 68415.m01177 glycine-rich protein 40 0.002 At1g65440.1 68414.m07424 glycine-rich protein 40 0.002 At1g27750.1 68414.m03391 ubiquitin system component Cue domain-c... 40 0.002 At5g11990.1 68418.m01402 proline-rich family protein contains pr... 40 0.003 At5g04970.1 68418.m00526 pectinesterase, putative contains simil... 40 0.003 At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin fa... 40 0.003 At5g43770.1 68418.m05353 proline-rich family protein contains pr... 40 0.003 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 40 0.003 At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin fa... 39 0.004 At5g14540.1 68418.m01704 proline-rich family protein contains pr... 39 0.004 At3g50140.1 68416.m05481 expressed protein contains Pfam profile... 39 0.004 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 39 0.006 At4g13390.1 68417.m02092 proline-rich extensin-like family prote... 39 0.006 At3g44340.1 68416.m04764 sec23/sec24 transport family protein co... 39 0.006 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 39 0.006 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 39 0.006 At1g04800.1 68414.m00476 glycine-rich protein 39 0.006 At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family... 37 0.008 At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibri... 38 0.008 At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containi... 38 0.008 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 38 0.008 At4g08380.1 68417.m01384 proline-rich extensin-like family prote... 38 0.008 At4g08370.1 68417.m01382 proline-rich extensin-like family prote... 38 0.008 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 38 0.008 At1g31290.1 68414.m03829 PAZ domain-containing protein / piwi do... 38 0.008 At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family... 38 0.010 At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identica... 38 0.010 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 38 0.010 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 38 0.010 At2g40820.1 68415.m05038 proline-rich family protein contains pr... 38 0.010 At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 38 0.010 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 38 0.010 At1g49270.1 68414.m05524 protein kinase family protein contains ... 38 0.010 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 38 0.010 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 38 0.013 At5g58540.1 68418.m07330 protein kinase family protein contains ... 38 0.013 At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ b... 38 0.013 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 38 0.013 At1g53625.1 68414.m06096 expressed protein 38 0.013 At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family... 38 0.013 At1g07135.1 68414.m00759 glycine-rich protein 38 0.013 At5g66400.1 68418.m08374 dehydrin (RAB18) nearly identical to SP... 37 0.018 At4g33660.1 68417.m04781 expressed protein 37 0.018 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 37 0.018 At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar... 37 0.018 At3g50130.1 68416.m05480 expressed protein ; expression supporte... 37 0.018 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 37 0.018 At2g28670.1 68415.m03485 disease resistance-responsive family pr... 37 0.018 At2g05530.1 68415.m00585 glycine-rich protein 37 0.018 At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / he... 37 0.024 At3g02670.1 68416.m00258 proline-rich family protein contains pr... 37 0.024 At2g04170.1 68415.m00402 meprin and TRAF homology domain-contain... 37 0.024 At1g70140.1 68414.m08071 formin homology 2 domain-containing pro... 37 0.024 At5g61660.1 68418.m07736 glycine-rich protein 36 0.031 At5g59170.1 68418.m07416 proline-rich family protein contains pr... 36 0.031 At4g38770.1 68417.m05490 proline-rich family protein (PRP4) simi... 36 0.031 At4g34440.1 68417.m04894 protein kinase family protein contains ... 36 0.031 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 36 0.031 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 36 0.031 At3g26120.1 68416.m03257 RNA-binding protein, putative similar t... 36 0.031 At3g11402.1 68416.m01388 DC1 domain-containing protein contains ... 36 0.031 At3g06130.1 68416.m00704 heavy-metal-associated domain-containin... 36 0.031 At3g04640.1 68416.m00497 glycine-rich protein predicted proteins... 36 0.031 At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containi... 36 0.031 At4g23140.2 68417.m03338 receptor-like protein kinase 5 (RLK5) i... 30 0.037 At4g23140.1 68417.m03337 receptor-like protein kinase 5 (RLK5) i... 30 0.037 At2g39250.1 68415.m04820 AP2 domain-containing transcription fac... 29 0.040 At4g34150.1 68417.m04846 C2 domain-containing protein similar to... 36 0.041 At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) ... 36 0.041 At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) ... 36 0.041 At3g24540.1 68416.m03082 protein kinase family protein contains ... 36 0.041 At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) s... 36 0.041 At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to... 36 0.041 At5g28480.1 68418.m03462 hypothetical protein 36 0.054 At4g21720.1 68417.m03145 expressed protein 36 0.054 At3g52460.1 68416.m05769 hydroxyproline-rich glycoprotein family... 36 0.054 At3g28550.1 68416.m03565 proline-rich extensin-like family prote... 36 0.054 At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PL... 36 0.054 At2g12100.1 68415.m01300 Ulp1 protease family protein contains P... 36 0.054 At1g60200.1 68414.m06781 splicing factor PWI domain-containing p... 36 0.054 At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putativ... 36 0.054 At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putativ... 36 0.054 At1g45090.1 68414.m05169 Ulp1 protease family protein similar to... 36 0.054 At1g31750.1 68414.m03895 proline-rich family protein contains pr... 36 0.054 At3g05470.1 68416.m00599 formin homology 2 domain-containing pro... 29 0.061 At1g72600.1 68414.m08395 hydroxyproline-rich glycoprotein family... 28 0.070 At5g65390.1 68418.m08224 arabinogalactan-protein (AGP7) 35 0.072 At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family... 35 0.072 At3g01560.1 68416.m00086 proline-rich family protein contains pr... 35 0.072 At2g26410.1 68415.m03169 calmodulin-binding family protein simil... 35 0.072 At2g16630.1 68415.m01909 proline-rich family protein contains pr... 35 0.072 At1g55540.1 68414.m06356 proline-rich family protein contains pr... 35 0.072 At1g52030.2 68414.m05870 myrosinase-binding protein, putative (F... 35 0.072 At1g52030.1 68414.m05869 myrosinase-binding protein, putative (F... 35 0.072 At5g35190.1 68418.m04170 proline-rich extensin-like family prote... 35 0.095 At5g25590.1 68418.m03045 expressed protein contains Pfam profile... 35 0.095 At4g08230.1 68417.m01358 glycine-rich protein 35 0.095 At3g54590.1 68416.m06040 proline-rich extensin-like family prote... 35 0.095 At3g54580.1 68416.m06039 proline-rich extensin-like family prote... 35 0.095 At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) fa... 35 0.095 At2g43800.1 68415.m05445 formin homology 2 domain-containing pro... 35 0.095 At2g28440.1 68415.m03455 proline-rich family protein contains pr... 35 0.095 At1g79480.1 68414.m09263 hypothetical protein low similarity to ... 35 0.095 At1g30780.1 68414.m03763 F-box family protein 35 0.095 At5g07540.2 68418.m00864 glycine-rich protein (GRP16) oleosin; g... 34 0.13 At4g37900.1 68417.m05360 glycine-rich protein 34 0.13 At4g08400.1 68417.m01388 proline-rich extensin-like family prote... 34 0.13 At3g53330.1 68416.m05884 plastocyanin-like domain-containing pro... 34 0.13 At3g29390.1 68416.m03693 hydroxyproline-rich glycoprotein family... 34 0.13 At3g21215.1 68416.m02681 RNA-binding protein, putative contains ... 34 0.13 At3g15400.1 68416.m01954 anther development protein, putative si... 34 0.13 At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing ... 34 0.13 At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing ... 34 0.13 At3g06780.1 68416.m00805 glycine-rich protein 34 0.13 At2g10940.2 68415.m01168 protease inhibitor/seed storage/lipid t... 34 0.13 At2g10940.1 68415.m01167 protease inhibitor/seed storage/lipid t... 34 0.13 At2g05380.1 68415.m00566 glycine-rich protein (GRP3S) identical ... 34 0.13 At1g76930.2 68414.m08956 proline-rich extensin-like family prote... 34 0.13 At1g76930.1 68414.m08955 proline-rich extensin-like family prote... 34 0.13 At1g70250.1 68414.m08082 receptor serine/threonine kinase, putat... 34 0.13 At1g11130.1 68414.m01274 leucine-rich repeat family protein / pr... 34 0.13 At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family... 34 0.13 At5g25550.1 68418.m03040 leucine-rich repeat family protein / ex... 34 0.17 At5g06640.1 68418.m00750 proline-rich extensin-like family prote... 34 0.17 At4g03120.1 68417.m00425 proline-rich family protein similar to ... 34 0.17 At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacy... 34 0.17 At3g25500.1 68416.m03171 formin homology 2 domain-containing pro... 34 0.17 At3g18810.1 68416.m02389 protein kinase family protein contains ... 34 0.17 At3g05220.1 68416.m00569 heavy-metal-associated domain-containin... 34 0.17 At2g34670.1 68415.m04259 proline-rich family protein contains pr... 34 0.17 At2g04190.1 68415.m00404 meprin and TRAF homology domain-contain... 34 0.17 At1g63550.1 68414.m07184 hypothetical protein low similarity to ... 34 0.17 At1g24490.1 68414.m03084 60 kDa inner membrane family protein si... 34 0.17 At1g13020.1 68414.m01510 eukaryotic translation initiation facto... 34 0.17 At5g41440.1 68418.m05033 zinc finger (C3HC4-type RING finger) fa... 26 0.21 At5g51300.2 68418.m06360 splicing factor-related contains simila... 33 0.22 At5g51300.1 68418.m06359 splicing factor-related contains simila... 33 0.22 At4g19920.1 68417.m02918 disease resistance protein (TIR class),... 33 0.22 At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family... 33 0.22 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 33 0.22 At1g77030.1 68414.m08970 glycine-rich protein 33 0.22 At1g27090.1 68414.m03302 glycine-rich protein 33 0.22 At4g39680.1 68417.m05614 SAP domain-containing protein contains ... 33 0.29 At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identic... 33 0.29 At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp... 33 0.29 At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp... 33 0.29 At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp... 33 0.29 At3g24650.1 68416.m03095 abscisic acid-insensitive protein 3 (AB... 33 0.29 At3g18360.1 68416.m02335 VQ motif-containing protein contains PF... 33 0.29 At1g76010.1 68414.m08825 expressed protein 33 0.29 At1g72790.1 68414.m08415 hydroxyproline-rich glycoprotein family... 33 0.29 At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family... 33 0.29 At5g62760.2 68418.m07879 nuclear protein ZAP-related similar to ... 33 0.38 At5g62760.1 68418.m07878 nuclear protein ZAP-related similar to ... 33 0.38 At5g49080.1 68418.m06074 proline-rich extensin-like family prote... 33 0.38 At5g45350.1 68418.m05567 proline-rich family protein contains pr... 33 0.38 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 33 0.38 At4g15460.1 68417.m02363 glycine-rich protein 33 0.38 At4g03390.1 68417.m00461 leucine-rich repeat transmembrane prote... 33 0.38 At3g62680.1 68416.m07041 proline-rich family protein contains pr... 33 0.38 At3g49300.1 68416.m05388 proline-rich family protein contains pr... 33 0.38 At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein... 33 0.38 At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1... 33 0.38 At3g06480.1 68416.m00750 DEAD box RNA helicase, putative similar... 33 0.38 At2g05540.1 68415.m00586 glycine-rich protein 33 0.38 At1g31280.1 68414.m03828 PAZ domain-containing protein / piwi do... 33 0.38 At1g26110.1 68414.m03186 expressed protein 33 0.38 At1g12810.1 68414.m01488 proline-rich family protein contains pr... 33 0.38 At5g65630.1 68418.m08256 DNA-binding bromodomain-containing prot... 32 0.51 At5g59270.1 68418.m07427 lectin protein kinase family protein co... 32 0.51 At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family... 32 0.51 At5g07190.1 68418.m00819 embryo-specific protein 3, putative sim... 32 0.51 At5g06630.1 68418.m00749 proline-rich extensin-like family prote... 32 0.51 At5g04290.1 68418.m00422 KOW domain-containing transcription fac... 32 0.51 At4g32640.1 68417.m04646 sec23/sec24 transport protein-related 32 0.51 At4g16240.1 68417.m02464 hypothetical protein 32 0.51 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 32 0.51 At4g08410.1 68417.m01390 proline-rich extensin-like family prote... 32 0.51 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 32 0.51 At3g15000.1 68416.m01897 expressed protein similar to DAG protei... 32 0.51 At3g07100.1 68416.m00845 protein transport protein Sec24, putati... 32 0.51 At3g05920.1 68416.m00668 heavy-metal-associated domain-containin... 32 0.51 At3g04570.1 68416.m00485 DNA-binding protein-related contains Pf... 32 0.51 At3g03776.1 68416.m00385 hydroxyproline-rich glycoprotein family... 32 0.51 At2g24980.1 68415.m02987 proline-rich extensin-like family prote... 32 0.51 At2g18470.1 68415.m02151 protein kinase family protein contains ... 32 0.51 At1g12380.1 68414.m01431 expressed protein 32 0.51 At5g60980.2 68418.m07650 nuclear transport factor 2 (NTF2) famil... 32 0.67 At5g60980.1 68418.m07649 nuclear transport factor 2 (NTF2) famil... 32 0.67 At5g51680.1 68418.m06407 hydroxyproline-rich glycoprotein family... 32 0.67 At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ... 32 0.67 At5g19750.1 68418.m02348 peroxisomal membrane 22 kDa family prot... 32 0.67 At5g11550.1 68418.m01347 expressed protein 32 0.67 At4g32340.1 68417.m04603 expressed protein 32 0.67 At4g28300.2 68417.m04053 hydroxyproline-rich glycoprotein family... 32 0.67 At4g28300.1 68417.m04052 hydroxyproline-rich glycoprotein family... 32 0.67 At4g09030.1 68417.m01490 arabinogalactan-protein (AGP10) identic... 32 0.67 At3g08640.1 68416.m01003 alphavirus core protein family contains... 32 0.67 At3g08630.1 68416.m01002 expressed protein 32 0.67 At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ b... 32 0.67 At1g32360.1 68414.m03989 zinc finger (CCCH-type) family protein ... 32 0.67 At1g21310.1 68414.m02662 proline-rich extensin-like family prote... 32 0.67 At5g48360.1 68418.m05975 formin homology 2 domain-containing pro... 31 0.88 At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/pr... 31 0.88 At4g12470.1 68417.m01972 protease inhibitor/seed storage/lipid t... 31 0.88 At3g43583.1 68416.m04636 hypothetical protein 31 0.88 At3g26400.1 68416.m03292 eukaryotic translation initiation facto... 31 0.88 At3g07560.1 68416.m00903 glycine-rich protein 31 0.88 At2g17870.1 68415.m02070 cold-shock DNA-binding family protein c... 31 0.88 At1g48100.1 68414.m05368 glycoside hydrolase family 28 protein /... 31 0.88 At1g07310.1 68414.m00778 C2 domain-containing protein contains s... 31 0.88 At5g66960.1 68418.m08442 prolyl oligopeptidase family protein si... 31 1.2 At5g60850.1 68418.m07633 Dof-type zinc finger domain-containing ... 31 1.2 At5g46780.2 68418.m05763 VQ motif-containing protein contains PF... 31 1.2 At5g46780.1 68418.m05762 VQ motif-containing protein contains PF... 31 1.2 At5g13760.1 68418.m01604 expressed protein similar to unknown pr... 31 1.2 At5g07150.1 68418.m00815 leucine-rich repeat family protein cont... 31 1.2 At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family... 31 1.2 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 31 1.2 At3g45540.1 68416.m04918 zinc finger (C3HC4-type RING finger) fa... 31 1.2 At3g16350.1 68416.m02068 myb family transcription factor ; conta... 31 1.2 At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing ... 31 1.2 At2g44790.1 68415.m05574 uclacyanin II strong similarity to ucla... 31 1.2 At2g33790.1 68415.m04144 pollen Ole e 1 allergen and extensin fa... 31 1.2 At2g30505.1 68415.m03716 Expressed protein 31 1.2 At1g61750.1 68414.m06964 expressed protein contains Pfam profile... 31 1.2 At1g54970.1 68414.m06278 proline-rich family protein similar to ... 31 1.2 At1g35830.1 68414.m04452 VQ motif-containing protein contains PF... 31 1.2 At1g22060.1 68414.m02759 expressed protein 31 1.2 At1g19950.1 68414.m02500 abscisic acid-responsive HVA22 family p... 31 1.2 At5g11700.1 68418.m01367 glycine-rich protein predicted protein,... 26 1.4 At5g15870.1 68418.m01857 glycosyl hydrolase family 81 protein si... 31 1.5 At4g12490.1 68417.m01974 protease inhibitor/seed storage/lipid t... 31 1.5 At3g44950.1 68416.m04843 glycine-rich protein 31 1.5 At3g16510.1 68416.m02107 C2 domain-containing protein contains s... 31 1.5 At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein ... 31 1.5 At2g02080.1 68415.m00144 zinc finger (C2H2 type) family protein ... 31 1.5 At1g69440.1 68414.m07979 PAZ domain-containing protein / piwi do... 31 1.5 At1g63570.1 68414.m07186 receptor-like protein kinase-related co... 31 1.5 At1g36675.1 68414.m04563 glycine-rich protein 31 1.5 At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family... 31 1.5 At5g41460.1 68418.m05035 fringe-related protein strong similarit... 29 1.9 At4g37180.2 68417.m05264 myb family transcription factor contain... 25 2.0 At4g37180.1 68417.m05263 myb family transcription factor contain... 25 2.0 At5g10550.1 68418.m01221 DNA-binding bromodomain-containing prot... 30 2.0 At4g12500.1 68417.m01975 protease inhibitor/seed storage/lipid t... 30 2.0 At3g57670.1 68416.m06425 zinc finger (C2H2 type) protein (WIP2) ... 30 2.0 At3g55950.1 68416.m06217 protein kinase family protein contains ... 30 2.0 At3g55730.1 68416.m06191 myb family transcription factor (MYB109... 30 2.0 At3g22330.1 68416.m02820 DEAD box RNA helicase, putative similar... 30 2.0 At3g13225.1 68416.m01660 WW domain-containing protein contains P... 30 2.0 At2g43680.2 68415.m05430 calmodulin-binding family protein simil... 30 2.0 At2g43680.1 68415.m05429 calmodulin-binding family protein simil... 30 2.0 At1g68390.1 68414.m07813 expressed protein contains Pfam profile... 30 2.0 At1g51090.1 68414.m05744 heavy-metal-associated domain-containin... 30 2.0 At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identica... 30 2.0 At1g27880.1 68414.m03416 ATP-dependent DNA helicase, putative si... 30 2.0 At1g15130.1 68414.m01807 hydroxyproline-rich glycoprotein family... 30 2.0 At5g61090.1 68418.m07665 proline-rich family protein contains pr... 30 2.7 At5g56140.1 68418.m07003 KH domain-containing protein 30 2.7 At5g52490.1 68418.m06512 fibrillarin, putative similar to fibril... 30 2.7 At5g25220.1 68418.m02990 homeobox protein knotted-1 like 3 (KNAT... 30 2.7 At5g13910.1 68418.m01627 AP2/EREBP-like transcription factor LEA... 30 2.7 At5g07530.1 68418.m00862 glycine-rich protein (GRP17) olesin; gl... 30 2.7 At4g23882.1 68417.m03434 heavy-metal-associated domain-containin... 30 2.7 At4g14750.1 68417.m02270 calmodulin-binding family protein conta... 30 2.7 At4g12480.1 68417.m01973 protease inhibitor/seed storage/lipid t... 30 2.7 At3g56590.1 68416.m06293 hydroxyproline-rich glycoprotein family... 30 2.7 At3g49840.1 68416.m05449 proline-rich family protein contains pr... 30 2.7 At3g46740.1 68416.m05074 chloroplast outer envelope protein, put... 30 2.7 At3g10300.3 68416.m01236 calcium-binding EF hand family protein ... 30 2.7 At3g10300.2 68416.m01235 calcium-binding EF hand family protein ... 30 2.7 At3g10300.1 68416.m01234 calcium-binding EF hand family protein ... 30 2.7 At3g09770.2 68416.m01158 zinc finger (C3HC4-type RING finger) fa... 30 2.7 At3g09770.1 68416.m01157 zinc finger (C3HC4-type RING finger) fa... 30 2.7 At2g31590.1 68415.m03859 hypothetical protein 30 2.7 At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putat... 30 2.7 At1g54060.1 68414.m06160 expressed protein similar to 6b-interac... 30 2.7 At1g45688.1 68414.m05202 expressed protein 30 2.7 At1g23050.1 68414.m02880 hydroxyproline-rich glycoprotein family... 30 2.7 At1g19960.1 68414.m02501 expressed protein 30 2.7 At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp... 30 2.7 At4g09270.1 68417.m01535 hypothetical protein same aa sequence a... 26 3.0 At4g09220.1 68417.m01528 hypothetical protein 26 3.0 At3g29060.1 68416.m03635 EXS family protein / ERD1/XPR1/SYG1 fam... 25 3.1 At2g38650.1 68415.m04747 glycosyl transferase family 8 protein c... 25 3.2 At3g50870.1 68416.m05570 zinc finger (GATA type) family protein ... 25 3.4 At5g67060.1 68418.m08455 basic helix-loop-helix (bHLH) family pr... 29 3.6 At5g42860.1 68418.m05224 expressed protein 29 3.6 At5g28640.1 68418.m03503 SSXT protein-related / glycine-rich pro... 29 3.6 At5g10060.1 68418.m01165 expressed protein 29 3.6 At4g25110.1 68417.m03612 latex-abundant family protein (AMC2) / ... 29 3.6 At4g23470.2 68417.m03383 hydroxyproline-rich glycoprotein family... 29 3.6 At4g23470.1 68417.m03382 hydroxyproline-rich glycoprotein family... 29 3.6 At4g19590.1 68417.m02879 DNAJ heat shock N-terminal domain-conta... 29 3.6 At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein... 29 3.6 At3g46240.1 68416.m05005 protein kinase-related similar to light... 29 3.6 At3g24250.1 68416.m03044 glycine-rich protein 29 3.6 At3g05220.2 68416.m00570 heavy-metal-associated domain-containin... 29 3.6 At2g39750.1 68415.m04881 dehydration-responsive family protein s... 29 3.6 At2g34870.1 68415.m04281 hydroxyproline-rich glycoprotein family... 29 3.6 At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein... 29 3.6 At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 pro... 29 3.6 At1g29230.1 68414.m03575 CBL-interacting protein kinase 18 (CIPK... 29 3.6 At1g17790.1 68414.m02202 DNA-binding bromodomain-containing prot... 29 3.6 At4g12050.1 68417.m01917 DNA-binding protein-related contains Pf... 25 4.3 At5g55070.1 68418.m06864 2-oxoacid dehydrogenase family protein ... 29 4.7 At5g24316.1 68418.m02864 proline-rich family protein contains pr... 29 4.7 At5g22790.1 68418.m02664 expressed protein 29 4.7 At5g22560.1 68418.m02635 hypothetical protein contains Pfam prof... 29 4.7 At4g38080.1 68417.m05378 hydroxyproline-rich glycoprotein family... 29 4.7 At4g29240.1 68417.m04182 leucine-rich repeat family protein / ex... 29 4.7 At3g42130.1 68416.m04326 glycine-rich protein 29 4.7 At3g07195.1 68416.m00858 proline-rich family protein 29 4.7 At3g02980.1 68416.m00293 GCN5-related N-acetyltransferase (GNAT)... 29 4.7 At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 29 4.7 At2g23990.2 68415.m02866 plastocyanin-like domain-containing pro... 29 4.7 At2g23990.1 68415.m02865 plastocyanin-like domain-containing pro... 29 4.7 At2g22510.1 68415.m02670 hydroxyproline-rich glycoprotein family... 29 4.7 At1g53260.1 68414.m06035 hypothetical protein low similarity to ... 29 4.7 At1g52560.1 68414.m05933 26.5 kDa class I small heat shock prote... 29 4.7 At1g35617.1 68414.m04424 hypothetical protein 29 4.7 At2g37860.2 68415.m04648 expressed protein 24 5.5 At3g11820.1 68416.m01449 syntaxin 121 (SYP121) / syntaxin-relate... 24 5.6 At2g37860.1 68415.m04647 expressed protein 24 5.6 At3g11820.2 68416.m01448 syntaxin 121 (SYP121) / syntaxin-relate... 24 5.7 At5g60050.1 68418.m07530 PRLI-interacting factor-related contain... 29 6.2 At5g21160.1 68418.m02528 La domain-containing protein / proline-... 29 6.2 At5g18690.1 68418.m02218 hydroxyproline-rich glycoprotein family... 29 6.2 At5g07520.1 68418.m00861 glycine-rich protein (GRP18) Oleosin; g... 29 6.2 At3g54920.1 68416.m06086 pectate lyase, putative / powdery milde... 29 6.2 At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, ... 29 6.2 At3g19860.1 68416.m02515 basic helix-loop-helix (bHLH) family pr... 29 6.2 At3g18370.1 68416.m02336 C2 domain-containing protein contains P... 29 6.2 At2g41420.1 68415.m05111 proline-rich family protein contains pr... 29 6.2 At2g41260.2 68415.m05096 glycine-rich protein / late embryogenes... 29 6.2 At2g41260.1 68415.m05095 glycine-rich protein / late embryogenes... 29 6.2 At2g35230.2 68415.m04322 VQ motif-containing protein contains PF... 29 6.2 At2g35230.1 68415.m04321 VQ motif-containing protein contains PF... 29 6.2 At2g22470.1 68415.m02664 arabinogalactan-protein (AGP2) identica... 29 6.2 At2g17770.1 68415.m02058 ABA-responsive element binding protein,... 29 6.2 At1g68480.1 68414.m07823 zinc finger (C2H2 type) family protein ... 29 6.2 At1g47660.1 68414.m05295 hypothetical protein 29 6.2 At1g14710.2 68414.m01759 hydroxyproline-rich glycoprotein family... 29 6.2 At1g14710.1 68414.m01758 hydroxyproline-rich glycoprotein family... 29 6.2 At1g08520.1 68414.m00943 magnesium-chelatase subunit chlD, chlor... 23 6.8 At1g33250.1 68414.m04110 fringe-related protein + weak similarit... 25 7.0 At2g47700.1 68415.m05957 zinc finger (C3HC4-type RING finger) fa... 24 7.2 At2g37590.1 68415.m04612 Dof-type zinc finger domain-containing ... 25 7.3 At1g30475.1 68414.m03725 expressed protein 24 7.9 At5g52470.1 68418.m06510 fibrillarin 1 (FBR1) (FIB1) (SKIP7) ide... 28 8.2 At5g03160.1 68418.m00264 DNAJ heat shock N-terminal domain-conta... 28 8.2 At5g02530.1 68418.m00187 RNA and export factor-binding protein, ... 28 8.2 At4g39660.1 68417.m05608 alanine--glyoxylate aminotransferase, p... 28 8.2 At4g36020.1 68417.m05128 cold-shock DNA-binding family protein c... 28 8.2 At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-l... 28 8.2 At3g55790.1 68416.m06199 expressed protein predicted protein, Ar... 28 8.2 At3g12400.1 68416.m01545 tumour susceptibility gene 101 (TSG101)... 28 8.2 At3g07540.1 68416.m00900 formin homology 2 domain-containing pro... 28 8.2 At3g01650.1 68416.m00096 copine-related low similarity to SP|Q99... 28 8.2 At1g35880.1 68414.m04457 hypothetical protein 28 8.2 At1g29030.1 68414.m03553 apoptosis inhibitory 5 (API5) family pr... 28 8.2 At1g20990.1 68414.m02627 DC1 domain-containing protein contains ... 28 8.2 At1g02460.1 68414.m00195 glycoside hydrolase family 28 protein /... 28 8.2 At1g28240.1 68414.m03466 expressed protein 23 9.0 At5g24580.2 68418.m02903 copper-binding family protein similar t... 25 9.5 At5g24580.1 68418.m02902 copper-binding family protein similar t... 25 9.5 At1g18170.1 68414.m02258 immunophilin / FKBP-type peptidyl-proly... 23 9.7 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 67.3 bits (157), Expect = 1e-11 Identities = 27/51 (52%), Positives = 28/51 (54%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 PP PPPPPP P P PP P P PP PP PP PPPPP PP+ Sbjct: 376 PPSPPPPPPPPPPPPPPPP---PPPPPPPPPPPPPYVYPSPPPPPPSPPPY 423 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/60 (46%), Positives = 29/60 (48%), Gaps = 5/60 (8%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP-----PPPPXPPF 981 P PP PPPPPP P P PP P PP PP PP PP PPPP PP+ Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPY 442 Score = 61.3 bits (142), Expect = 1e-09 Identities = 27/54 (50%), Positives = 27/54 (50%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PPPPPP P P P P PP PP PP PPPPPP PP Sbjct: 377 PSPPPPPPPPPPPPPPP---------PPPPPPPPPPPPPPYVYPSPPPPPPSPP 421 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/60 (43%), Positives = 27/60 (45%), Gaps = 5/60 (8%) Frame = +1 Query: 817 PXXXPPXPPPPPPX-----PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 P PP PPPPPP P P PP P P PP P PP PPPPP P+ Sbjct: 395 PPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPY 454 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/61 (42%), Positives = 26/61 (42%), Gaps = 5/61 (8%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXP-XXPXXPP----PXPPXP 974 P PP PPPPP PP P PPP PP P P P PP P PP P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSP 440 Query: 975 P 977 P Sbjct: 441 P 441 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/56 (44%), Positives = 26/56 (46%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P+ PP PPPPP PP P PPP PP P P PPP PP PP Sbjct: 377 PSPPPPPPPPPPPPP-------PP----PPPPPPPPPPPPPPYVYPSPPPPPPSPP 421 Score = 48.8 bits (111), Expect = 5e-06 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P PP PPPPP PP P P PP P P PPP PP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPP 431 Score = 48.8 bits (111), Expect = 5e-06 Identities = 23/58 (39%), Positives = 23/58 (39%), Gaps = 2/58 (3%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXP--XPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PPPPP PP P PPP PP P P P PP PP Sbjct: 392 PPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPP 449 Score = 47.6 bits (108), Expect = 1e-05 Identities = 23/57 (40%), Positives = 23/57 (40%) Frame = +2 Query: 806 SXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 S PP P PPPPP PPP P PP P P P PP PP P Sbjct: 371 SFGCSPPSPPPPPPPP-------PPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSP 420 Score = 46.4 bits (105), Expect = 3e-05 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPP-XXPPXPPLXXXXXPPPPP 966 PP PP PPP P PP P P PP PP PP P PP Sbjct: 414 PPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSPP 460 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/61 (37%), Positives = 23/61 (37%), Gaps = 6/61 (9%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXX----PXPPPX--PPXPXPXXPXXPPPXPPX 971 P PP PPPPP PP P PPP PP P P PPP P Sbjct: 393 PPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQ 452 Query: 972 P 974 P Sbjct: 453 P 453 Score = 41.9 bits (94), Expect = 6e-04 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +1 Query: 886 GXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 G P PP PP PP PPPPPP PP Sbjct: 373 GCSPPSPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 39.5 bits (88), Expect = 0.003 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXP-PXPP 977 P P PPPP PP P PPP PP P P P P P PP Sbjct: 405 PPPYVYPSPPPPPPSPPPYVYPPPPPPYVYP-PPPSPPYVYPPPPPSPQPYMYPSPP 460 Score = 36.7 bits (81), Expect = 0.024 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 3/52 (5%) Frame = +2 Query: 818 PPPXPXX---PPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP P PPPPP P P P P P PS P P P Sbjct: 416 PPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSPPCNDLPTP 467 Score = 28.3 bits (60), Expect = 8.2 Identities = 15/44 (34%), Positives = 16/44 (36%), Gaps = 6/44 (13%) Frame = +1 Query: 796 LYSLXQXPXXXPPXP------PPPPPXPXPXAXPPXGXXPXPXP 909 +Y P PP P PPPPP P P P P P Sbjct: 424 VYPPPPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSPPCNDLPTP 467 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/57 (50%), Positives = 30/57 (52%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXPP---PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP PPPP P P PP P P PP PP PP+ PPPPPP PP Sbjct: 454 PPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPP--PPPPPVYSPPPPPPPPPPPP 508 Score = 64.9 bits (151), Expect = 8e-11 Identities = 27/53 (50%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Frame = +1 Query: 829 PPXPPPP---PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PPPP PP P P PP P P PP PP PP+ P PPPP PP Sbjct: 441 PPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPP 493 Score = 63.7 bits (148), Expect = 2e-10 Identities = 25/50 (50%), Positives = 26/50 (52%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PPPP P P PP P PP PP PP+ PPPPPP PP Sbjct: 428 PPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPP 477 Score = 63.3 bits (147), Expect = 2e-10 Identities = 28/60 (46%), Positives = 29/60 (48%), Gaps = 6/60 (10%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXX------PPXPPLXXXXXPPPPPPXPP 978 P PP PPPPPP P + PP P P PP PP PP PPPPPP PP Sbjct: 447 PVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPP 506 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/55 (49%), Positives = 28/55 (50%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 P PP PPPPPP P P PP P P PP P PP PPPPPP P + Sbjct: 462 PVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPP------PPPPPPPPVY 510 Score = 61.3 bits (142), Expect = 1e-09 Identities = 26/58 (44%), Positives = 26/58 (44%) Frame = +3 Query: 804 TLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 T PT PP PPPP PP P PPP PP P P PPP PP PP Sbjct: 419 TPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPP 476 Score = 60.5 bits (140), Expect = 2e-09 Identities = 26/53 (49%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Frame = +1 Query: 829 PPXPPPPPPX---PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP P PPPP P P PP P P PP PP P PPPPPP PP Sbjct: 426 PPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPP 478 Score = 60.5 bits (140), Expect = 2e-09 Identities = 27/58 (46%), Positives = 27/58 (46%), Gaps = 4/58 (6%) Frame = +1 Query: 817 PXXXPPXPPPPPPX----PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PPPPPP P P PP P PP PP PP PPP PP PP Sbjct: 434 PVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPP 491 Score = 60.5 bits (140), Expect = 2e-09 Identities = 26/53 (49%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Frame = +1 Query: 829 PPXPPPPP---PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PPPPP P P P PP P PP PP PP PP PPP PP Sbjct: 440 PPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPP 492 Score = 60.1 bits (139), Expect = 2e-09 Identities = 24/54 (44%), Positives = 26/54 (48%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PPPPPP P + PP P PP P P+ PPPPP PP Sbjct: 493 PVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPP 546 Score = 58.4 bits (135), Expect = 7e-09 Identities = 24/53 (45%), Positives = 24/53 (45%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P PP PPP P P PP P P PP P PP PPPP P P Sbjct: 477 PPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAP 529 Score = 56.8 bits (131), Expect = 2e-08 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 4/58 (6%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP----PXPP 978 P PP PPPPP P PP P PP PP PP PPPPP P PP Sbjct: 467 PPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPP 524 Score = 56.4 bits (130), Expect = 3e-08 Identities = 27/60 (45%), Positives = 28/60 (46%), Gaps = 6/60 (10%) Frame = +1 Query: 817 PXXXPPXPPPPPP--XPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPP 978 P PP PPPPPP P P + PP PP PP PP PPPP PP PP Sbjct: 466 PPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPP 525 Score = 55.6 bits (128), Expect = 5e-08 Identities = 28/61 (45%), Positives = 29/61 (47%), Gaps = 7/61 (11%) Frame = +1 Query: 817 PXXXPPXPPPP---PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP----PPPPXP 975 P PP PPPP PP P P PP P P PP PP PP+ PP PPPP Sbjct: 468 PPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPP-PPPPPVYSPPPPPVYSSPPPPPS 526 Query: 976 P 978 P Sbjct: 527 P 527 Score = 54.4 bits (125), Expect = 1e-07 Identities = 26/60 (43%), Positives = 26/60 (43%), Gaps = 4/60 (6%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPX--PPPXPPXPXPXXP--XXPPPXPPXPP 977 P PP PPPPP PP P PPP PP P P P PPP PP PP Sbjct: 432 PPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPP 491 Score = 54.4 bits (125), Expect = 1e-07 Identities = 25/60 (41%), Positives = 25/60 (41%), Gaps = 4/60 (6%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPX----PPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PPPPP PP P PPP PP P P PPP PP PP Sbjct: 447 PVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPP 506 Score = 54.0 bits (124), Expect = 1e-07 Identities = 26/61 (42%), Positives = 26/61 (42%), Gaps = 5/61 (8%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPP---PXPPXPXPXXP--XXPPPXPPXP 974 P PP PPPPP PP P PP P PP P P P PPP PP P Sbjct: 445 PPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPP 504 Query: 975 P 977 P Sbjct: 505 P 505 Score = 53.6 bits (123), Expect = 2e-07 Identities = 24/54 (44%), Positives = 24/54 (44%), Gaps = 4/54 (7%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXP----XPPXXPPXPPLXXXXXPPPPPPXPP 978 P PPPP P P P P P PP PP PP PPPPPP PP Sbjct: 421 PTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPP 474 Score = 53.2 bits (122), Expect = 3e-07 Identities = 25/59 (42%), Positives = 25/59 (42%), Gaps = 5/59 (8%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP-----XXPPXPPLXXXXXPPPPPPXPP 978 P P P PPPP P P P P PP PP PP PPPPPP PP Sbjct: 401 PLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPP 459 Score = 53.2 bits (122), Expect = 3e-07 Identities = 26/59 (44%), Positives = 26/59 (44%), Gaps = 5/59 (8%) Frame = +1 Query: 817 PXXXPPXPPPPPPX---PXPXAXPPXGXXPXPX--PPXXPPXPPLXXXXXPPPPPPXPP 978 P P PPPP P P PP P P PP PP PP PPPPPP PP Sbjct: 403 PPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPP 461 Score = 52.0 bits (119), Expect = 6e-07 Identities = 24/56 (42%), Positives = 24/56 (42%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PPPPP PP P P P PP P P PPP PP PP Sbjct: 460 PPPVYSPPPPPPPPP-------PPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPP 508 Score = 51.6 bits (118), Expect = 8e-07 Identities = 23/53 (43%), Positives = 24/53 (45%), Gaps = 3/53 (5%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXPP 978 PP PPPP P P P P P P PP P+ PPP PPP PP Sbjct: 571 PPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPP 623 Score = 50.8 bits (116), Expect = 1e-06 Identities = 23/55 (41%), Positives = 23/55 (41%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P PP PPPP PP P PPP PP P P PPP PP P Sbjct: 455 PPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPP-PPPPVYSPPPPPPPPPPPP 508 Score = 50.8 bits (116), Expect = 1e-06 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 3/56 (5%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXP---PPXPPXPXPXXPXXPPPXPP 968 P PP PPPPP PP P P PP PP P P P PP PP Sbjct: 461 PPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPP 516 Score = 50.8 bits (116), Expect = 1e-06 Identities = 23/56 (41%), Positives = 23/56 (41%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PPPPP PP P PPP P P P PPP PP P Sbjct: 491 PPPVYSPPPPPPPPPPPPVYSPPPPPVYSSP-PPPPSPAPTPVYCTRPPPPPPHSP 545 Score = 50.8 bits (116), Expect = 1e-06 Identities = 23/52 (44%), Positives = 23/52 (44%), Gaps = 1/52 (1%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP-XXPPXPPLXXXXXPPPPPP 969 P P PPPPP P P P P PP PP PP PPPPPP Sbjct: 583 PPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPP 634 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/61 (40%), Positives = 25/61 (40%), Gaps = 5/61 (8%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPP--XPPXPXPXXPXXP---PPXPPXP 974 P P PPPPP PP P PPP PP P P P P PP PP P Sbjct: 444 PPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPP 503 Query: 975 P 977 P Sbjct: 504 P 504 Score = 50.4 bits (115), Expect = 2e-06 Identities = 24/58 (41%), Positives = 25/58 (43%), Gaps = 3/58 (5%) Frame = +2 Query: 803 HSXNXPPPXPXXPP---PPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 +S PPP P PP PPP PPP P PP P P S P PP PP Sbjct: 449 YSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPP 506 Score = 49.2 bits (112), Expect = 4e-06 Identities = 24/59 (40%), Positives = 25/59 (42%) Frame = +1 Query: 802 SLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 S+ P P PPP P P P A P P PP PP PPPPPP PP Sbjct: 391 SVSPRPPVVTPLPPPSLPSPPPPA--PIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPP 447 Score = 49.2 bits (112), Expect = 4e-06 Identities = 23/56 (41%), Positives = 23/56 (41%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P P PPPPP PP P PP PP P P PPP PP PP Sbjct: 459 PPPPVYSPPPPPPPP-------PPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPP 507 Score = 48.8 bits (111), Expect = 5e-06 Identities = 25/63 (39%), Positives = 25/63 (39%), Gaps = 7/63 (11%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXP---XPPPXPPXPXPXXPXXPPPXP----P 968 P PP PPPPP PP P PPP PP P P PPP P P Sbjct: 462 PVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSP 521 Query: 969 XPP 977 PP Sbjct: 522 PPP 524 Score = 48.8 bits (111), Expect = 5e-06 Identities = 24/56 (42%), Positives = 24/56 (42%), Gaps = 6/56 (10%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRX---PPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP PPPPP PP P PPP PP P P PPP PP PP Sbjct: 470 PPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPP 525 Score = 48.0 bits (109), Expect = 1e-05 Identities = 24/59 (40%), Positives = 26/59 (44%), Gaps = 4/59 (6%) Frame = +1 Query: 817 PXXXPPXP----PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 P PP P PP P P + PP P P PP PP P PPPPPP P + Sbjct: 408 PSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPP--PPPPVYSPPPPPPPPPPPPVY 464 Score = 48.0 bits (109), Expect = 1e-05 Identities = 23/53 (43%), Positives = 23/53 (43%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PPP PPPPP PPP P PP P P S P PP PP P Sbjct: 432 PPPVYSPPPPPPP------PPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPP 478 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PPPPP PP P P P P P PPP P PP Sbjct: 493 PVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPP 548 Score = 46.0 bits (104), Expect = 4e-05 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 6/56 (10%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXP------PXPXPXXPXXPPPXPPXPP 977 PP P PPP PP P PP P P P P PPP PP PP Sbjct: 404 PPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPP 459 Score = 46.0 bits (104), Expect = 4e-05 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PP P P P PP P PP P PP PPPP P Sbjct: 521 PPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSP 570 Score = 45.6 bits (103), Expect = 5e-05 Identities = 29/95 (30%), Positives = 32/95 (33%), Gaps = 8/95 (8%) Frame = +3 Query: 717 PPETMPSSCR-FXSXDQSXCXXX*LPXAXLTLP---TXXXXPPXXPPPPPXXXXXRXPPX 884 P + P C+ F S C + P T P PPPP P Sbjct: 364 PAQRSPGQCKAFLSRPPVNCGSFSCGRSVSPRPPVVTPLPPPSLPSPPPPAPIFSTPPTL 423 Query: 885 XXXXXPXPPP----XPPXPXPXXPXXPPPXPPXPP 977 P PPP PP P P P PP PP PP Sbjct: 424 TSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPP 458 Score = 45.6 bits (103), Expect = 5e-05 Identities = 23/54 (42%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Frame = +1 Query: 817 PXXXPPXPP---PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP PP PPP P P P P P PP PP P PPPP P Sbjct: 508 PVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQF----SPPPPEP 557 Score = 45.6 bits (103), Expect = 5e-05 Identities = 23/58 (39%), Positives = 23/58 (39%), Gaps = 5/58 (8%) Frame = +3 Query: 810 PTXXXXPPXXP---PPPPXXXXXRXPPXXXXXXPXPPP--XPPXPXPXXPXXPPPXPP 968 P PP P PPPP PP P PPP PP P P PPP PP Sbjct: 577 PPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPP 634 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/62 (33%), Positives = 23/62 (37%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P +LP+ P PP P P PPP PP P P PPP PP Sbjct: 401 PLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPP 460 Query: 969 XP 974 P Sbjct: 461 PP 462 Score = 45.2 bits (102), Expect = 7e-05 Identities = 24/58 (41%), Positives = 26/58 (44%), Gaps = 8/58 (13%) Frame = +1 Query: 817 PXXXPPXPPPP---PPXPXP---XAXPPXGXXPXP--XPPXXPPXPPLXXXXXPPPPP 966 P P PPPP PP P P + PP P P PP P PP+ PPPPP Sbjct: 538 PPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPP 595 Score = 45.2 bits (102), Expect = 7e-05 Identities = 26/70 (37%), Positives = 28/70 (40%), Gaps = 9/70 (12%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP----XXPPXPPLXXXXXPPPP 963 +YS P P PPPP P PP P PP PP PP+ PPPP Sbjct: 606 VYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPP 665 Query: 964 P-----PXPP 978 P P PP Sbjct: 666 PVHYSSPPPP 675 Score = 44.8 bits (101), Expect = 9e-05 Identities = 21/55 (38%), Positives = 21/55 (38%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P PP PPPPP PP P PP P P P PPP P P Sbjct: 477 PPVYSPPPPSPPPPPPPVY--SPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAP 529 Score = 44.8 bits (101), Expect = 9e-05 Identities = 23/60 (38%), Positives = 25/60 (41%), Gaps = 5/60 (8%) Frame = +1 Query: 817 PXXXPPXPPP--PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXPPF 981 P PP PPP PP P + PP P P P PP PPP PPP P+ Sbjct: 499 PPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPY 558 Score = 44.8 bits (101), Expect = 9e-05 Identities = 22/51 (43%), Positives = 23/51 (45%), Gaps = 4/51 (7%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXX-PPXPPLXXXXXPPPP---PPXPP 978 PPPP P P + PP P P P PP PP PP P PP PP Sbjct: 563 PPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPP 613 Score = 44.4 bits (100), Expect = 1e-04 Identities = 26/67 (38%), Positives = 27/67 (40%), Gaps = 9/67 (13%) Frame = +1 Query: 805 LXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP----XXPPXPPLXXXXXPPPPP-- 966 L P P PPP P P PP P P PP PP PP+ PPPPP Sbjct: 589 LSPPPPPTPVSSPPPTPVYSPPPPPPC-IEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVY 647 Query: 967 ---PXPP 978 P PP Sbjct: 648 YSSPPPP 654 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXPXS 982 PPP PPPP PPP P PP P P P PP P S Sbjct: 545 PPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVS 599 Score = 42.7 bits (96), Expect = 4e-04 Identities = 22/53 (41%), Positives = 22/53 (41%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PPP PPPPP PPP P PP P P S P PP P P Sbjct: 482 PPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPP--PPPVYSSP-PPPPSPAPTP 531 Score = 42.3 bits (95), Expect = 5e-04 Identities = 21/63 (33%), Positives = 22/63 (34%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P + P PP PP P PP PPP P P P PPP P Sbjct: 524 PPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSP--PPPHSP 581 Query: 969 XPP 977 PP Sbjct: 582 PPP 584 Score = 41.9 bits (94), Expect = 6e-04 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 4/59 (6%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXP----PPXPPXP 974 P PP PPPP PP P PPP PP P P P PP PP P Sbjct: 476 PPPVYSPPPPSPPPP-------PPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSP 527 Score = 41.5 bits (93), Expect = 8e-04 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXP-PXPXPXXPXXPPPXPPXP 974 P P PPPP PP P PP P P P P PP PP P Sbjct: 542 PHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTP 597 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 1/57 (1%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPX-PPXPXPXXPXXPPPXPPXPP 977 P PP P P P PP P PP PP P P PPP PP Sbjct: 515 PPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPP 571 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/62 (37%), Positives = 25/62 (40%), Gaps = 8/62 (12%) Frame = +1 Query: 817 PXXXPPXPP--PPPPXPXPXAXPPX---GXXPXPXPPXXPPXPPLXXXXXPPPP---PPX 972 P PP P PPPP P + PP P PP P PP+ PPPP Sbjct: 541 PPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSS 600 Query: 973 PP 978 PP Sbjct: 601 PP 602 Score = 40.3 bits (90), Expect = 0.002 Identities = 25/67 (37%), Positives = 26/67 (38%), Gaps = 13/67 (19%) Frame = +1 Query: 817 PXXXPPXPPP----PPPXPX----PXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---- 960 P PP P P PP P P + PP P P P P PP PPP Sbjct: 548 PQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVY 607 Query: 961 -PPPXPP 978 PPP PP Sbjct: 608 SPPPPPP 614 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 4/57 (7%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXP----XPPPXPPXPXPXXPXXPPPXPP 968 P PP PPPP PP P PPP PP P PPP P Sbjct: 501 PPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEP 557 Score = 39.1 bits (87), Expect = 0.004 Identities = 25/68 (36%), Positives = 26/68 (38%), Gaps = 7/68 (10%) Frame = +1 Query: 796 LYSLXQXPXXXPPXP-----PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP- 957 +YS P P P PPPPP P PP P P P PP PP Sbjct: 517 VYSSPPPPPSPAPTPVYCTRPPPPPPHSP---PPPQFSPPPPEPYYYSSPPPPHSSPPPH 573 Query: 958 -PPPPXPP 978 PPPP P Sbjct: 574 SPPPPHSP 581 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 PP PP PP P PP PP PP PPPP P+ Sbjct: 538 PPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPY 588 Score = 38.3 bits (85), Expect = 0.008 Identities = 21/60 (35%), Positives = 22/60 (36%), Gaps = 5/60 (8%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPP-----XXPXPXPSXPXXXPPXPP 967 +S PPP PPPPP PPP PP P P P PP PP Sbjct: 607 YSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPP 666 Score = 37.9 bits (84), Expect = 0.010 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = +2 Query: 818 PPPXPX---XPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PPP P PPPP PPP P P P P P PP P Sbjct: 553 PPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTP 605 Score = 37.9 bits (84), Expect = 0.010 Identities = 23/61 (37%), Positives = 23/61 (37%), Gaps = 6/61 (9%) Frame = +2 Query: 803 HSXNXP--PPXPXXP---PPPPXXXXXXRPPPXXXXPXXXPP-XXPXPXPSXPXXXPPXP 964 HS P PP P P PPPP PP P PP P P P PP P Sbjct: 573 HSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPP 632 Query: 965 P 967 P Sbjct: 633 P 633 Score = 37.9 bits (84), Expect = 0.010 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PPP P PPP PPP P P P P P PP P Sbjct: 593 PPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPP 645 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 5/61 (8%) Frame = +3 Query: 810 PTXXXXPPXXP-----PPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 PT PP P PPPP PP P PPP P P PP P Sbjct: 595 PTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPP 654 Query: 975 P 977 P Sbjct: 655 P 655 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 4/61 (6%) Frame = +1 Query: 799 YSLXQXPXXXPPXPPPPPPXPXPXAXPP----XGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 YS P PPPPPP PP P P PP PP PPP Sbjct: 648 YSSPPPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEESPPPA 707 Query: 967 P 969 P Sbjct: 708 P 708 Score = 37.5 bits (83), Expect = 0.013 Identities = 20/54 (37%), Positives = 22/54 (40%), Gaps = 7/54 (12%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXX---PPXPPLXXXXXPPPPP----PXPP 978 PPPPP P + PP PP P PP+ PPP P P PP Sbjct: 692 PPPPPSAPCEESPPPAPVVHHSPPPPMVHHSPPPPVIHQSPPPPSPEYEGPLPP 745 Score = 37.1 bits (82), Expect = 0.018 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 2/62 (3%) Frame = +1 Query: 799 YSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXP--PXPPLXXXXXPPPPPPX 972 YS P PPPPP PP P PP PP PPPPP Sbjct: 638 YSSPPPPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPS 697 Query: 973 PP 978 P Sbjct: 698 AP 699 Score = 36.7 bits (81), Expect = 0.024 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +2 Query: 818 PPPXPXX---PPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PPP P PPPPP PPP PP P P PP P Sbjct: 682 PPPSPVHYSSPPPPPSAPCEESPPPAPVVHHSPPPPMVHHSPPPPVIHQSPPPPSP 737 Score = 34.7 bits (76), Expect = 0.095 Identities = 19/61 (31%), Positives = 19/61 (31%), Gaps = 5/61 (8%) Frame = +3 Query: 810 PTXXXXPPXXPP-----PPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P PP PP PPP PP PPP P P P P P Sbjct: 655 PVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEESPPPAPVVHHSP 714 Query: 975 P 977 P Sbjct: 715 P 715 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PPPPP PP P PPP P P PP P Sbjct: 641 PPPPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSP 686 Score = 34.3 bits (75), Expect = 0.13 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 10/56 (17%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPP-----XPPXPXPXXPXXPPPXP-----PXPP 977 PPPPP PP P P P PP P PPP P P PP Sbjct: 662 PPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEESPPPAPVVHHSPPPP 717 Score = 33.5 bits (73), Expect = 0.22 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 6/53 (11%) Frame = +1 Query: 829 PPXP----PPPPPXPXPXAXPPX--GXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PP P PPPP PP P P P P PP+ PPPP Sbjct: 705 PPAPVVHHSPPPPMVHHSPPPPVIHQSPPPPSPEYEGPLPPVIGVSYASPPPP 757 Score = 33.1 bits (72), Expect = 0.29 Identities = 23/71 (32%), Positives = 24/71 (33%), Gaps = 10/71 (14%) Frame = +1 Query: 799 YSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXX--PPXPPLXXXXXPPPP--- 963 YS P P PPP + PP P PP P PP P PP Sbjct: 689 YSSPPPPPSAPCEESPPPAPVVHHSPPPPMVHHSPPPPVIHQSPPPPSPEYEGPLPPVIG 748 Query: 964 -----PPXPPF 981 PP PPF Sbjct: 749 VSYASPPPPPF 759 Score = 32.3 bits (70), Expect = 0.51 Identities = 21/59 (35%), Positives = 22/59 (37%), Gaps = 9/59 (15%) Frame = +1 Query: 829 PPXPP----PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP-----PXPP 978 PP P PPP P + PP P P P PP PPPP P PP Sbjct: 672 PPPPEVHYHSPPPSPVHYSSPP----PPPSAPCEESPPPAPVVHHSPPPPMVHHSPPPP 726 Score = 32.3 bits (70), Expect = 0.51 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P P PPP PP P PP P P P P PP Sbjct: 693 PPPPSAPCEESPPPAPVVHHSPPPPMVHHSPPPPVIHQSPPPPSPEYEGPLPP 745 Score = 31.5 bits (68), Expect = 0.88 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 843 PPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PPPP PP P P P P P PP PP Sbjct: 714 PPPPMVHHSPPPPVIHQSPPPPSPEYEGPLPPVIGVSYASPPPPP 758 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 9/56 (16%) Frame = +3 Query: 828 PPXXPPP---PPXXXXXRXPPXXXXXXPXPPP------XPPXPXPXXPXXPPPXPP 968 PP P P PP PP P PPP PP P P PP PP Sbjct: 591 PPPPPTPVSSPPPTPVYSPPPPPPCIEP-PPPPPCIEYSPPPPPPVVHYSSPPPPP 645 Score = 29.9 bits (64), Expect = 2.7 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 6/56 (10%) Frame = +2 Query: 818 PPPXPX---XPPPPPXXXXXXRPPPXXXXPXXXPPXXP---XPXPSXPXXXPPXPP 967 PPP P PPPP P P PP P P P+ P PP Sbjct: 662 PPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEESPPPAPVVHHSPPPP 717 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 65.3 bits (152), Expect = 6e-11 Identities = 27/54 (50%), Positives = 28/54 (51%), Gaps = 4/54 (7%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPP----LXXXXXPPPPPPXPP 978 PP PPPPPP P PP P P PP PP PP + PPPPPP PP Sbjct: 573 PPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPP 626 Score = 56.8 bits (131), Expect = 2e-08 Identities = 34/92 (36%), Positives = 36/92 (39%), Gaps = 4/92 (4%) Frame = +3 Query: 714 PPPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXX 893 PPP +PS F + D P L P PP PPPPP PP Sbjct: 547 PPPPPLPS---FSNRD---------PLTTLHQPINKTPPPPPPPPPPLPSRSIPPPLAQP 594 Query: 894 XXPXPPPXPPXPXP----XXPXXPPPXPPXPP 977 P PPP PP P P PPP PP PP Sbjct: 595 PPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPP 626 Score = 54.4 bits (125), Expect = 1e-07 Identities = 24/50 (48%), Positives = 24/50 (48%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PPPPP P P A P PP PP PP PPPPP PP Sbjct: 676 PPSTPPPPPPPPPKA----NISNAPKPPAPPPLPPSSTRLGAPPPPPPPP 721 Score = 51.2 bits (117), Expect = 1e-06 Identities = 23/52 (44%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPL--XXXXXPPPPPPXPP 978 PP PPPPPP P P P P PP P PPPPPP PP Sbjct: 596 PPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPP 647 Score = 50.4 bits (115), Expect = 2e-06 Identities = 29/70 (41%), Positives = 30/70 (42%), Gaps = 11/70 (15%) Frame = +1 Query: 802 SLXQXPXXXPPXPPPPPP------XPXPXAXPPXGXXPXP-XPPXXPPXPPLXXXXXPPP 960 S+ P PP PPPPPP P P A PP P PP PPL PPP Sbjct: 671 SIRVGPPSTPPPPPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPP 730 Query: 961 PP----PXPP 978 PP P PP Sbjct: 731 PPLSKTPVPP 740 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/51 (41%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPP-LXXXXXPPPPPPXPP 978 P PPPPPP P P PP PP P + PPPPP PP Sbjct: 615 PSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPPPP 665 Score = 47.6 bits (108), Expect = 1e-05 Identities = 24/66 (36%), Positives = 25/66 (37%), Gaps = 2/66 (3%) Frame = +3 Query: 786 LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPP--XPXPXXPXXPPP 959 LP + P PP PPPPP R P P PPP P PPP Sbjct: 582 LPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPP 641 Query: 960 XPPXPP 977 PP PP Sbjct: 642 PPPPPP 647 Score = 47.6 bits (108), Expect = 1e-05 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P PPPPPP P P PP PP PPPPPP P Sbjct: 613 PSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPPPP 665 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/56 (42%), Positives = 24/56 (42%), Gaps = 6/56 (10%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPL------XXXXXPPPPPPXPPF 981 P PPPPP P P P PP PP PPL PPPPPP P F Sbjct: 501 PSQPPPPPPPPPLFMSTTSFSP-SQPPPPPPPPPLFTSTTSFSPSQPPPPPPLPSF 555 Score = 47.2 bits (107), Expect = 2e-05 Identities = 23/52 (44%), Positives = 24/52 (46%), Gaps = 5/52 (9%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXP-----PLXXXXXPPPPPPXPP 978 PPPPPP P P P P P PP PP + PPPPPP PP Sbjct: 639 PPPPPPPPPPTRIPAAKCAPPPPPP--PPTSHSGSIRVGPPSTPPPPPPPPP 688 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 PP PPP PP PP P PP PPL PPPPP Sbjct: 698 PPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVPPPPP 743 Score = 46.4 bits (105), Expect = 3e-05 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 6/54 (11%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXP------PLXXXXXPPPPPPXPPF 981 PPPPPP P P P PP PP P PPPPPP P F Sbjct: 482 PPPPPPPPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPPPLF 535 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/52 (40%), Positives = 22/52 (42%), Gaps = 3/52 (5%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP---XPPLXXXXXPPPPPPXPP 978 P PPPPPP P + P PP PP PPPPPP PP Sbjct: 482 PPPPPPPPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPPP 533 Score = 45.6 bits (103), Expect = 5e-05 Identities = 25/63 (39%), Positives = 25/63 (39%), Gaps = 13/63 (20%) Frame = +1 Query: 829 PPXPPPPPPXPX-------PXAXPPXGXXPXPXPPXXPP------XPPLXXXXXPPPPPP 969 P PPPPPP P P P P PP PP PPL P PPPP Sbjct: 543 PSQPPPPPPLPSFSNRDPLTTLHQPINKTPPPPPPPPPPLPSRSIPPPLAQPPPPRPPPP 602 Query: 970 XPP 978 PP Sbjct: 603 PPP 605 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/49 (40%), Positives = 22/49 (44%), Gaps = 2/49 (4%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPP--LXXXXXPPPPPPXPP 978 PPPPPP P + P PP PP P + PP PPP PP Sbjct: 658 PPPPPPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPPAPPPLPP 706 Score = 44.0 bits (99), Expect = 2e-04 Identities = 32/96 (33%), Positives = 33/96 (34%), Gaps = 8/96 (8%) Frame = +3 Query: 714 PPPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPP---- 881 PPP S+ F S Q P L T P PPPPP P Sbjct: 509 PPPPLFMSTTSF-SPSQPPPPP---PPPPLFTSTTSFSPSQPPPPPPLPSFSNRDPLTTL 564 Query: 882 -XXXXXXPXPPPXPPXPXPXXPXXPP---PXPPXPP 977 P PPP PP P P PP P PP PP Sbjct: 565 HQPINKTPPPPPPPPPPLPSRSIPPPLAQPPPPRPP 600 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/58 (37%), Positives = 23/58 (39%), Gaps = 4/58 (6%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXP----PPPPPXPP 978 P PP PPPPP + P P P P PL P PPPPP PP Sbjct: 522 PSQPPPPPPPPPLFTSTTSFSPSQPPPPPPLPSFSNRDPLTTLHQPINKTPPPPPPPP 579 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = +3 Query: 813 TXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 T PP PPPP P P PPP P PPP PP PP Sbjct: 479 TLLPPPPPPPPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPPP 533 Score = 43.2 bits (97), Expect = 3e-04 Identities = 26/87 (29%), Positives = 29/87 (33%), Gaps = 2/87 (2%) Frame = +3 Query: 714 PPPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXXPPPPPXXXXXRX--PPXX 887 PPP PS + Q+ P +P PP PPPP PP Sbjct: 620 PPPPPPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPST 679 Query: 888 XXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P PPP P PPP PP Sbjct: 680 PPPPPPPPPKANISNAPKPPAPPPLPP 706 Score = 41.9 bits (94), Expect = 6e-04 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 8/56 (14%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPX--------PPLXXXXXPPPPPPXP 975 P PPPPPP A PP P PP P PPL PPPP P Sbjct: 714 PPPPPPPPLSKTPAPPPPPLSKTPVPPPPPGLGRGTSSGPPPLGAKGSNAPPPPPP 769 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 4/66 (6%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPP----XPXPXXPXXPP 956 P L T P PPPPP P PPP PP P PP Sbjct: 488 PPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPPPLFTSTTSFSPSQPP 547 Query: 957 PXPPXP 974 P PP P Sbjct: 548 PPPPLP 553 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PPPPP P P PP PPP PP PP Sbjct: 599 PPPPPPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPPP 648 Score = 37.5 bits (83), Expect = 0.013 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 7/56 (12%) Frame = +3 Query: 831 PXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP-------XPPXPP 977 P PPPPP PP P PPP PP PPP PP PP Sbjct: 714 PPPPPPPPLSKTPAPPPPPLSKTPVPPP-PPGLGRGTSSGPPPLGAKGSNAPPPPP 768 Score = 36.7 bits (81), Expect = 0.024 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXPXS 982 PPP P PP P P P P P P P P PP P S Sbjct: 680 PPPPPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLS 734 Score = 36.3 bits (80), Expect = 0.031 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 H PPP P PPPPP P P PP S PP PP P Sbjct: 477 HVTLLPPPPP--PPPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPP 532 Score = 35.9 bits (79), Expect = 0.041 Identities = 22/63 (34%), Positives = 24/63 (38%), Gaps = 2/63 (3%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXP--SXPXXXPPXPPXX 973 +HS + P PPPPP PPP P P P P S PP PP Sbjct: 667 SHSGSIRVGPPSTPPPPPP------PPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPP 720 Query: 974 PXS 982 P S Sbjct: 721 PLS 723 Score = 35.1 bits (77), Expect = 0.072 Identities = 21/65 (32%), Positives = 23/65 (35%) Frame = +2 Query: 782 LTTXXXTHSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPX 961 L T + S + PPP PPPPP P P PP S PP Sbjct: 492 LFTSTTSFSPSQPPP---PPPPPPLFMSTTSFSPSQPPPPPPPPPLFTSTTSFSPSQPPP 548 Query: 962 PPXXP 976 PP P Sbjct: 549 PPPLP 553 Score = 35.1 bits (77), Expect = 0.072 Identities = 18/59 (30%), Positives = 19/59 (32%) Frame = +2 Query: 806 SXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXPXS 982 S + P P PPPPP P PP P PP PP P S Sbjct: 609 SRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPPPPTS 667 Score = 34.7 bits (76), Expect = 0.095 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PP P PPPPP P P P PP + PP PP P Sbjct: 596 PPRPPPPPPPPPSSRSI--PSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPP 646 Score = 34.3 bits (75), Expect = 0.13 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +2 Query: 824 PXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXPXS 982 P PPPPP PPP PP P P P PP PP P S Sbjct: 567 PINKTPPPPP-------PPPPPLPSRSIPPPLAQPPPPRP---PPPPPPPPSS 609 Score = 33.1 bits (72), Expect = 0.29 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 7/49 (14%) Frame = +1 Query: 853 PXPXPXAXPPXGXXPXPXPPXXPPXPP-------LXXXXXPPPPPPXPP 978 P P P G PP PP PP PPPPPP PP Sbjct: 464 PLNLPSDPPSSGDHVTLLPPPPPPPPPPLFTSTTSFSPSQPPPPPPPPP 512 Score = 33.1 bits (72), Expect = 0.29 Identities = 22/82 (26%), Positives = 25/82 (30%) Frame = +3 Query: 714 PPPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXX 893 PPP + S R P A ++ PP P PP PP Sbjct: 663 PPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPPAPP--PLPPSSTRLGAPPPPPPP 720 Query: 894 XXPXPPPXPPXPXPXXPXXPPP 959 P PP P P PPP Sbjct: 721 PLSKTPAPPPPPLSKTPVPPPP 742 Score = 33.1 bits (72), Expect = 0.29 Identities = 18/54 (33%), Positives = 19/54 (35%), Gaps = 4/54 (7%) Frame = +1 Query: 829 PPXPPP----PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PPP P P P P + P P PP PPP PP Sbjct: 716 PPPPPPLSKTPAPPPPPLSKTPVPPPPPGLGRGTSSGPPPLGAKGSNAPPPPPP 769 Score = 32.3 bits (70), Expect = 0.51 Identities = 17/56 (30%), Positives = 19/56 (33%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 + S P P PPPPP P PP P P+ PP PP Sbjct: 609 SRSIPSPSAPPPPPPPPPSFGSTGN-KRQAQPPPPPPPPPPTRIPAAKCAPPPPPP 663 Score = 31.5 bits (68), Expect = 0.88 Identities = 22/75 (29%), Positives = 25/75 (33%), Gaps = 8/75 (10%) Frame = +2 Query: 782 LTTXXXTHSXNXPPPXPXXP------PPPPXXXXXXR--PPPXXXXPXXXPPXXPXPXPS 937 L T + S + PPP P P P + PPP P P P Sbjct: 534 LFTSTTSFSPSQPPPPPPLPSFSNRDPLTTLHQPINKTPPPPPPPPPPLPSRSIPPPLAQ 593 Query: 938 XPXXXPPXPPXXPXS 982 P PP PP P S Sbjct: 594 PPPPRPPPPPPPPPS 608 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/50 (30%), Positives = 16/50 (32%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PPP P PPP PP P P + PP PP Sbjct: 719 PPPLSKTPAPPPPPLSKTPVPPPPPGLGRGTSSGPPPLGAKGSNAPPPPP 768 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 60.5 bits (140), Expect = 2e-09 Identities = 26/57 (45%), Positives = 26/57 (45%) Frame = +1 Query: 805 LXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 L P PP PP PP P P P P PP PP PPL PPPPPP P Sbjct: 1072 LPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPPP 1128 Score = 50.4 bits (115), Expect = 2e-06 Identities = 22/56 (39%), Positives = 22/56 (39%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PPP P PP P P PP P P PPP PP PP Sbjct: 1070 PPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPP 1125 Score = 49.2 bits (112), Expect = 4e-06 Identities = 23/54 (42%), Positives = 24/54 (44%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP PP P P + PP P PP PPL PPPPP P Sbjct: 1065 PQESPPPLPPLPPSPPPPS-PPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSP 1117 Score = 46.0 bits (104), Expect = 4e-05 Identities = 23/55 (41%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Frame = +1 Query: 817 PXXXPPXPPP-PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P PPP P PP P P P PP PP PPPP PP Sbjct: 1058 PEDSPPLPQESPPPLPPLPPSPPPPSPPLP-PSSLPPPPPAALFPPLPPPPSQPP 1111 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/61 (39%), Positives = 24/61 (39%), Gaps = 5/61 (8%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPX---PPXPXPXXPXXPPP--XPPXP 974 P PP PP PP PP P PPP PP P P PPP PP P Sbjct: 1063 PLPQESPPPLPPLPPSPPPPS-PPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSP 1121 Query: 975 P 977 P Sbjct: 1122 P 1122 Score = 41.5 bits (93), Expect = 8e-04 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPP 956 P+ P PPPPP PP P PPP P P P P PP Sbjct: 1082 PSPPLPPSSLPPPPPAALFPPLPPPPSQ--PPPPPLSPPPSPPPPPPPP 1128 Score = 40.7 bits (91), Expect = 0.001 Identities = 24/54 (44%), Positives = 25/54 (46%), Gaps = 5/54 (9%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP-----PPXPP 978 P P PP P + PP P P PP PP PPL PPPP PP PP Sbjct: 1056 PLPEDSPPLPQE-SPPPLPPLP-PSPP--PPSPPLPPSSLPPPPPAALFPPLPP 1105 Score = 37.9 bits (84), Expect = 0.010 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPL 936 PP PPPP P P PP P P PP PP L Sbjct: 1101 PPLPPPPSQPPPPPLSPP----PSPPPPPPPPSQSL 1132 Score = 36.3 bits (80), Expect = 0.031 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 5/59 (8%) Frame = +2 Query: 821 PPXPXXPPPP-PXXXXXXRPPPXXXXPXXXPPXXP----XPXPSXPXXXPPXPPXXPXS 982 PP P PPP P PP P PP P P P P PP P P S Sbjct: 1062 PPLPQESPPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPS 1120 Score = 35.1 bits (77), Expect = 0.072 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 879 PXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P P P PP P P PPP PP PP Sbjct: 1056 PLPEDSPPLPQESPPPLPPLPPSPPPPSPPLPP 1088 Score = 35.1 bits (77), Expect = 0.072 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 2/57 (3%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPX--PPXXPXS 982 PPP P PP PP PP P PP P P P PP PP P S Sbjct: 1069 PPPLPPLPPSPP-------PPSPPLPPSSLPP--PPPAALFPPLPPPPSQPPPPPLS 1116 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/48 (37%), Positives = 20/48 (41%) Frame = +3 Query: 786 LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXP 929 LP + L P P PPPP + PP P PPP PP P Sbjct: 1086 LPPSSLPPPPPAALFPPLPPPP-----SQPPPPPLSPPPSPPPPPPPP 1128 Score = 32.3 bits (70), Expect = 0.51 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 2/50 (4%) Frame = +2 Query: 824 PXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXP--XPXPSXPXXXPPXPP 967 P P PP P PP P PP P P P PP PP Sbjct: 1056 PLPEDSPPLPQESPPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPP 1105 Score = 31.9 bits (69), Expect = 0.67 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPS 937 PPP P PP PPP P PP P P S Sbjct: 1092 PPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPPPSQS 1131 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = +3 Query: 831 PXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP--XPPXPP 977 P PP P PP P PP PP P P PP PP PP Sbjct: 1058 PEDSPPLPQESPPPLPPLPPS--PPPPS-PPLPPSSLPPPPPAALFPPLPP 1105 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 57.6 bits (133), Expect = 1e-08 Identities = 22/47 (46%), Positives = 24/47 (51%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PPPPPP P P + P P PP PP + PPPPPP PP Sbjct: 417 PPPPPPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPPPP 463 Score = 55.2 bits (127), Expect = 6e-08 Identities = 23/49 (46%), Positives = 23/49 (46%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PPPPPP P A PP P PP PP PPPPP PP Sbjct: 508 PPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPP 556 Score = 52.8 bits (121), Expect = 3e-07 Identities = 45/159 (28%), Positives = 60/159 (37%), Gaps = 15/159 (9%) Frame = +1 Query: 547 SQRPVAEPXETTSTNVSREEMEFTTESN-VRDVDVGLETAHXTNEIAKAVEATTYAVHLQ 723 SQ+ EP E+ +V E + + + +DV +ET N ++V + Sbjct: 330 SQKEAQEPNESNDEDVISVVEEIKQKKDEIESIDVKMETEESVNLDEESVVLNGEQDTIM 389 Query: 724 RRCRVLADSYHXINLXVXXTDYLXLYSLXQXPXXXPPXPPPPP---------PXPXPXAX 876 + + + S +N Y L P PP PPPPP P P P Sbjct: 390 KISSLESTSESKLN---HSEKYENSSQLFPPP---PPPPPPPPLSFIKTASLPLPSPPPT 443 Query: 877 PPXGXXPX--PXPPXXPPXPPLXXXXX---PPPPPPXPP 978 PP P PP PP PP PPPPPP PP Sbjct: 444 PPIADIAISMPPPPPPPPPPPAVMPLKHFAPPPPPPLPP 482 Score = 51.6 bits (118), Expect = 8e-07 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PPPPPP P P P P P PP P PL PPP PP Sbjct: 455 PPPPPPPPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTPP 498 Score = 51.6 bits (118), Expect = 8e-07 Identities = 21/47 (44%), Positives = 21/47 (44%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PPPPPP P PP P PP PP PPPPP PP Sbjct: 523 PPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPP 569 Score = 50.8 bits (116), Expect = 1e-06 Identities = 22/53 (41%), Positives = 22/53 (41%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PPPPPP A PP P PP PP PPPPPP P Sbjct: 517 PTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPP 569 Score = 50.4 bits (115), Expect = 2e-06 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = +3 Query: 807 LPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 LPT PP PPPP PP PPP PP P PPP PP Sbjct: 516 LPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPP 569 Score = 48.0 bits (109), Expect = 1e-05 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXP-PXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PP PPPP P P P G PP PP PL PPPPPP Sbjct: 563 PPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPPPPP 610 Score = 47.6 bits (108), Expect = 1e-05 Identities = 25/57 (43%), Positives = 25/57 (43%), Gaps = 7/57 (12%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAX--PPXGXXPXPXP-----PXXPPXPPLXXXXXPPPPPPXPP 978 PP PPP PP P PP P P P PP PPL PPPPP PP Sbjct: 474 PPPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPP 530 Score = 47.2 bits (107), Expect = 2e-05 Identities = 26/63 (41%), Positives = 26/63 (41%), Gaps = 9/63 (14%) Frame = +1 Query: 817 PXXXPPXPP---------PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP PP PPPP P P A P P PP P PL PPPPPP Sbjct: 456 PPPPPPPPPAVMPLKHFAPPPPPPLPPAVMPLKHF-APPPPTPPAFKPLKGSAPPPPPPP 514 Query: 970 XPP 978 P Sbjct: 515 PLP 517 Score = 47.2 bits (107), Expect = 2e-05 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PPPPPP P A PP P PP PP P PPP P Sbjct: 536 PPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMP 581 Score = 46.4 bits (105), Expect = 3e-05 Identities = 26/60 (43%), Positives = 26/60 (43%), Gaps = 9/60 (15%) Frame = +1 Query: 817 PXXXPPXPP---------PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP PP PPPP P P P G P P PP PP P PPPPPP Sbjct: 474 PPPPPPLPPAVMPLKHFAPPPPTP-PAFKPLKGSAPPPPPP--PPLPTTIAAPPPPPPPP 530 Score = 45.6 bits (103), Expect = 5e-05 Identities = 24/59 (40%), Positives = 25/59 (42%), Gaps = 5/59 (8%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP-----XXPPXPPLXXXXXPPPPPPXPP 978 P PPPPPP P A PP P P PP PP P+ PPPP PP Sbjct: 542 PPGTAAAPPPPPPPPGTQAAPP----PPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPP 596 Score = 45.2 bits (102), Expect = 7e-05 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P PP PPPP PP P PP P P PPP PP P Sbjct: 502 PLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPP 556 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 4/50 (8%) Frame = +1 Query: 832 PXPPPPPPX----PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PPPPPP P P P PP PP P PPPPPP Sbjct: 562 PPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPPPPPP 611 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXP 965 P PP PPPP PP PPP PP P PPP P Sbjct: 530 PRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMP 581 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/63 (39%), Positives = 26/63 (41%), Gaps = 14/63 (22%) Frame = +1 Query: 829 PPXPPPPP--PXPXPXAXPPXGXXPXPXPPXXPP-------XPPL-----XXXXXPPPPP 966 PP PPPPP P PP G P PP PP PP+ PPPPP Sbjct: 536 PPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPP 595 Query: 967 PXP 975 P P Sbjct: 596 PMP 598 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P A L PP PP P PP PPP PP P PPP PP Sbjct: 497 PPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPP 556 Score = 42.3 bits (95), Expect = 5e-04 Identities = 25/68 (36%), Positives = 26/68 (38%), Gaps = 7/68 (10%) Frame = +3 Query: 795 AXLTLPTXXXXPPXX-------PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXP 953 A L LP+ PP PPPPP P P PPP PP P P Sbjct: 433 ASLPLPSPPPTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAP 492 Query: 954 PPXPPXPP 977 P PP PP Sbjct: 493 P--PPTPP 498 Score = 42.3 bits (95), Expect = 5e-04 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = +1 Query: 829 PPXPPPPPPXPXPX-AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP P PP P A PP P P PP PP PPPP PP Sbjct: 492 PPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPP 542 Score = 42.3 bits (95), Expect = 5e-04 Identities = 24/65 (36%), Positives = 25/65 (38%), Gaps = 15/65 (23%) Frame = +1 Query: 829 PPXPPPPP-------PXPXPXAXPPXGXXPXPXPPXX--------PPXPPLXXXXXPPPP 963 PP PPPPP P P P G P P PP PP PP+ P Sbjct: 562 PPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPPPPPPMAMANGAAGP 621 Query: 964 PPXPP 978 PP PP Sbjct: 622 PPPPP 626 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 6/55 (10%) Frame = +3 Query: 831 PXXPPPPPXXXXXRXPPXXXXXXPXPPP------XPPXPXPXXPXXPPPXPPXPP 977 P PPPPP PP P PPP PP P P PP PP PP Sbjct: 508 PPPPPPPPLPTTIAAPP------PPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPP 556 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 2/57 (3%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXP--PPXPPXPXPXXPXXPPPXPPXP 974 P P PPPPP PP PP PP P P PP PP P Sbjct: 555 PPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPPPPPP 611 Score = 39.5 bits (88), Expect = 0.003 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 4/59 (6%) Frame = +3 Query: 810 PTXXXXPPXX----PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P P PPPPP PP P PP P P PPP PP P Sbjct: 511 PPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPP 569 Score = 38.7 bits (86), Expect = 0.006 Identities = 24/87 (27%), Positives = 27/87 (31%) Frame = +3 Query: 714 PPPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXX 893 PPP +P++ P P PP PPPPP PP Sbjct: 511 PPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPP-PPPPPGTQAAPPPPPPPP 569 Query: 894 XXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P PP P PP PP P Sbjct: 570 MQNRAPSPPPMPMGNSGSGGPPPPPPP 596 Score = 38.3 bits (85), Expect = 0.008 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 6/56 (10%) Frame = +2 Query: 818 PPPX----PXXPPPPPXXXXXXRPP--PXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PPP P PPPPP PP P PP P P P PP PP Sbjct: 554 PPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPPPP 609 Score = 37.9 bits (84), Expect = 0.010 Identities = 24/88 (27%), Positives = 26/88 (29%) Frame = +3 Query: 714 PPPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXX 893 PPP P + LP A + L PP P P PP Sbjct: 456 PPPPPPPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPP 515 Query: 894 XXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP P P PP PP PP Sbjct: 516 LPTTIAAPPPPPPPPRAAVAPPPPPPPP 543 Score = 36.7 bits (81), Expect = 0.024 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +1 Query: 829 PPXPPPPPPX-----PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PP PPPP P P P P PP PP + PPPPP Sbjct: 590 PPPPPPPMPLANGATPPPPPPPMAMANGAAGPPPPPPRMGMANGAAGPPPPP 641 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/54 (48%), Positives = 26/54 (48%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P PPPP P P PP P P PP PP PP PP P P PP Sbjct: 62 PPPPPPPPCPPPPSP-PPCPPPPSPPPSPPPPQLPP-PPQLPPPAPPKPQPSPP 113 Score = 52.8 bits (121), Expect = 3e-07 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = +1 Query: 829 PPXPPPPPPXPXPX-AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP P P P P P PP P P PP PP PP PPPP PP Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPP 96 Score = 49.6 bits (113), Expect = 3e-06 Identities = 25/56 (44%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXP-XPXXPXXPPPXPPXP 974 P PP PPPPP PP P PPP PP P P P PPP PP P Sbjct: 56 PEPADCPPP-PPPPPCPPPPSPPP--CPPPPSPPPSPPPPQLPPPPQLPPPAPPKP 108 Score = 47.6 bits (108), Expect = 1e-05 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P P P P PP P P PP PP PP PPP P PP Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPP-PPSPPPSPPPPQLPPPP 98 Score = 45.2 bits (102), Expect = 7e-05 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP P P PPP PP PP P P P P PP P Sbjct: 67 PPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTP 115 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = +2 Query: 812 NXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 N PPP P P P PPP P PP P P P PP P P Sbjct: 44 NNPPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPP 98 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXP-XPSXPXXXPPXPP 967 P P PPPPP PP P PP P P P P PP PP Sbjct: 56 PEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPP 106 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP 958 PPP P PPPP PP P PP P P PS P P Sbjct: 72 PPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTPDLP 118 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 2/57 (3%) Frame = +3 Query: 810 PTXXXXPPXXPPP--PPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P PP PPP PP PP PPP P P P P PP P P Sbjct: 62 PPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTPDLP 118 Score = 34.7 bits (76), Expect = 0.095 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPS 937 PP P PPPP PPP P PP P S Sbjct: 82 PPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTPDLPFAS 121 Score = 30.3 bits (65), Expect = 2.0 Identities = 22/72 (30%), Positives = 25/72 (34%) Frame = +3 Query: 714 PPPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXX 893 P PE P+ C C P + P PP PPPP + PP Sbjct: 52 PEPEPEPADCP-PPPPPPPCPP---PPSPPPCPPPPSPPP-SPPPPQLPPPPQLPP---P 103 Query: 894 XXPXPPPXPPXP 929 P P P PP P Sbjct: 104 APPKPQPSPPTP 115 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 56.0 bits (129), Expect = 4e-08 Identities = 25/58 (43%), Positives = 26/58 (44%), Gaps = 2/58 (3%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXP--PPPPPXPP 978 Q P PP PPPPPP P P PP PP PP+ P PPPP PP Sbjct: 40 QSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPP 97 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PPPPPP P P P PP PL P PPP P Sbjct: 49 PPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPRSQP 102 Score = 45.2 bits (102), Expect = 7e-05 Identities = 27/77 (35%), Positives = 31/77 (40%) Frame = +1 Query: 748 SYHXINLXVXXTDYLXLYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPX 927 S + L + T + L Q P P PPPPPP PP P P PP PP Sbjct: 12 SLYVFILALFFTIHCFLLVQSQDPPLFPQSPPPPPP----PPPPP----PPPPPPPPPPP 63 Query: 928 PPLXXXXXPPPPPPXPP 978 P + PPP PP Sbjct: 64 PAVNMSVETGIPPPPPP 80 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 3/58 (5%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXX---PPXXPXPXPSXPXXXPPXPPXXPXS 982 PPP P PPPPP PPP PP P P PP P P S Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPRS 100 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 13/67 (19%) Frame = +1 Query: 817 PXXXPPXPP----------PPPPXPXPXAXPPXGXXPXPXPP---XXPPXPPLXXXXXPP 957 P PP PP PPPP P P P P PP PP PP Sbjct: 56 PPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPRSQPPPKPPQKNLPRRH 115 Query: 958 PPPPXPP 978 PPPP P Sbjct: 116 PPPPRSP 122 Score = 37.9 bits (84), Expect = 0.010 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPX-PXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PPP P + PP P PP PP L PPP P P Sbjct: 75 PPPPPPVTDMIKPLSSPPPPQPPPRSQPPPKPPQKNLPRRHPPPPRSPEKP 125 Score = 37.5 bits (83), Expect = 0.013 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXP--XPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PPPPP PP PPP PP P PP P PP Sbjct: 47 PPPPPPPPPPPPPPP------PPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPP 98 Score = 33.9 bits (74), Expect = 0.17 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXP--XPXPPXXPPXP 930 P PP PP PPP P PP P P PP P P Sbjct: 87 PLSSPP-PPQPPPRSQPPPKPPQKNLPRRHPPPPRSPEKP 125 Score = 33.5 bits (73), Expect = 0.22 Identities = 17/50 (34%), Positives = 18/50 (36%), Gaps = 4/50 (8%) Frame = +3 Query: 840 PPPPPXXXXXRX----PPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PPPPP + PP PPP PP PPP P P Sbjct: 76 PPPPPVTDMIKPLSSPPPPQPPPRSQPPPKPPQKNLPRRHPPPPRSPEKP 125 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 4/57 (7%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXR----XPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P PP PPPP PP P PP P P PPP PP Sbjct: 53 PPPPPPPP--PPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPRSQPPPKPP 107 Score = 28.3 bits (60), Expect = 8.2 Identities = 24/71 (33%), Positives = 25/71 (35%), Gaps = 18/71 (25%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR------PPPXXXX--------PXXXPP-XXPXPXP---SXP 943 PPP P PPPPP PPP P PP P P P + P Sbjct: 53 PPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPRSQPPPKPPQKNLP 112 Query: 944 XXXPPXPPXXP 976 PP PP P Sbjct: 113 RRHPP-PPRSP 122 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 54.8 bits (126), Expect = 8e-08 Identities = 27/58 (46%), Positives = 27/58 (46%), Gaps = 4/58 (6%) Frame = +1 Query: 817 PXXXPPXPPPP--PPXPXPXAXPPXGXXPXPXPPXXPPXP-PLXXXXXPPPPP-PXPP 978 P PP PP P PP P P PP P P P PP P P PPPPP P PP Sbjct: 117 PTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPP 174 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/57 (42%), Positives = 24/57 (42%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP---PPXPP 978 P PP PP P P P PP P PP P PP PPPP PP PP Sbjct: 93 PYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPP 149 Score = 50.8 bits (116), Expect = 1e-06 Identities = 24/55 (43%), Positives = 25/55 (45%), Gaps = 2/55 (3%) Frame = +1 Query: 817 PXXXPPXPPP--PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PP PP PPP P P PP P P PP PP+ PPPP P P Sbjct: 109 PYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPV---VTPPPPTPTP 160 Score = 49.6 bits (113), Expect = 3e-06 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP P P P PP P PP P PP PPPP PP Sbjct: 101 PTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPP 154 Score = 49.2 bits (112), Expect = 4e-06 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 2/56 (3%) Frame = +1 Query: 817 PXXXPPXPP--PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP PPP P PP P P P PP PP PP P PP Sbjct: 85 PTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPP 140 Score = 48.8 bits (111), Expect = 5e-06 Identities = 23/58 (39%), Positives = 23/58 (39%), Gaps = 2/58 (3%) Frame = +3 Query: 810 PTXXXXPPXXP--PPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PT PP P PPPP P P P PP P P P PPP P PP Sbjct: 117 PTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPP 174 Score = 47.6 bits (108), Expect = 1e-05 Identities = 24/60 (40%), Positives = 25/60 (41%), Gaps = 5/60 (8%) Frame = +1 Query: 817 PXXXPPXPPPP--PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP---PPPPXPPF 981 P P PPPP P P PP P P P PP PP PP PPPP P+ Sbjct: 69 PPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPY 128 Score = 46.4 bits (105), Expect = 3e-05 Identities = 24/59 (40%), Positives = 24/59 (40%), Gaps = 6/59 (10%) Frame = +1 Query: 817 PXXXPPXPPP--PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP----PPPPXP 975 P P PP PPP P PP P P P PP PP PP PPPP P Sbjct: 77 PPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTP 135 Score = 46.4 bits (105), Expect = 3e-05 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP PPPP PP P PPP P P P P PPP PP PP Sbjct: 100 PPTVKPPPPPYVK---PPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPP 149 Score = 45.6 bits (103), Expect = 5e-05 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXPPPPP---PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P PP P P P PP P PP PP PPPP P P Sbjct: 74 PCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTP 130 Score = 45.6 bits (103), Expect = 5e-05 Identities = 23/57 (40%), Positives = 24/57 (42%), Gaps = 2/57 (3%) Frame = +3 Query: 810 PTXXXXPPXXP--PPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 PT PP P PPPP + PP P P P P P P P P P PP P Sbjct: 125 PTPYTPPPPTPYTPPPPTV---KPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPPKP 178 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/56 (37%), Positives = 22/56 (39%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PPPP + PP P PP P P P PPP P PP Sbjct: 78 PPYTPKPPTVKPPPP--PYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPP 131 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/58 (39%), Positives = 24/58 (41%), Gaps = 2/58 (3%) Frame = +3 Query: 810 PTXXXXPPXX--PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PT PP PPPPP + PP P PP P P P PPP P PP Sbjct: 85 PTVKPPPPPYVKPPPPPTV---KPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPP 139 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PPPP PP P PP P P P P P P PP Sbjct: 92 PPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPP 141 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PT PP PPP PP P P P P P P PP P PP Sbjct: 101 PTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPP 156 Score = 44.0 bits (99), Expect = 2e-04 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PP P PPP PP P P P P PP PPPP P Sbjct: 132 PPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPPKP 178 Score = 43.6 bits (98), Expect = 2e-04 Identities = 24/62 (38%), Positives = 25/62 (40%), Gaps = 6/62 (9%) Frame = +3 Query: 810 PTXXXXPPXXP--PPP--PXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP--XPPX 971 PT PP P PPP P + PP P PP P P P PPP PP Sbjct: 64 PTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPP 123 Query: 972 PP 977 PP Sbjct: 124 PP 125 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/53 (37%), Positives = 21/53 (39%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PPP P PPPP +PPP PP P P P PP P P Sbjct: 89 PPPPPYVKPPPP---PTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTP 138 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/60 (38%), Positives = 23/60 (38%), Gaps = 4/60 (6%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXP--PXXXXXXPXPPP--XPPXPXPXXPXXPPPXPPXPP 977 PT PP PPPP P P P PPP PP P P PP P PP Sbjct: 57 PTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPP 116 Score = 42.7 bits (96), Expect = 4e-04 Identities = 25/56 (44%), Positives = 25/56 (44%), Gaps = 6/56 (10%) Frame = +1 Query: 829 PPXPPPPP--PXPXPXAXP-PXGXXPXPXPPXXPPXPPLXXXXXPPPP---PPXPP 978 P PPPP P P P P P P P P PP PP PPPP PP PP Sbjct: 64 PTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPP--TVKPPPPPYVKPPPPP 117 Score = 41.5 bits (93), Expect = 8e-04 Identities = 23/58 (39%), Positives = 24/58 (41%), Gaps = 3/58 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP---PPXPPF 981 P P PP P P PP P P P PP PP PPPP PP PP+ Sbjct: 56 PPTHTPKPPTVKPPPPYIPCPPPPYTPKP-PTVKPPPPPYVKP--PPPPTVKPPPPPY 110 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P P PP PP P P PP P P P P P PP PP Sbjct: 38 PVKPPKHPAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPP 93 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 P PP PP P P P PP P PP P PP PP+ Sbjct: 45 PAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPY 94 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/54 (38%), Positives = 22/54 (40%), Gaps = 4/54 (7%) Frame = +1 Query: 829 PPXPP---PPPPXPXPXAX-PPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PP PP P P PP P P PP P P + P PP PP Sbjct: 48 PPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPP 101 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXP 955 PP P PPPP P P P PP P P P P P Sbjct: 138 PPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPPKPETCP 182 Score = 39.9 bits (89), Expect = 0.003 Identities = 28/97 (28%), Positives = 30/97 (30%), Gaps = 5/97 (5%) Frame = +3 Query: 702 HVRCPPPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXX---PPPPPXXXXXR 872 ++ CPPP P P P PP PPPPP Sbjct: 72 YIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTP- 130 Query: 873 XPPXXXXXXPXPPPXPPXPXPXXPXXPPPXP--PXPP 977 PP P P PP P P P P P P PP Sbjct: 131 -PPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPP 166 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXP--XPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P PP P PP P P PP P PP PPP P PP Sbjct: 31 PPKPSPHPVKPPKHPAKPPKPPTVKPPTHTPKPPTVKPPPP-YIPCPPPPYTPKPP 85 Score = 38.3 bits (85), Expect = 0.008 Identities = 24/67 (35%), Positives = 26/67 (38%), Gaps = 6/67 (8%) Frame = +2 Query: 785 TTXXXTHSXNXP---PPXPXXP-PPPP--XXXXXXRPPPXXXXPXXXPPXXPXPXPSXPX 946 T TH+ P PP P P PPPP +PPP PP P P P Sbjct: 53 TVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPP--PY 110 Query: 947 XXPPXPP 967 PP PP Sbjct: 111 VKPPPPP 117 Score = 37.9 bits (84), Expect = 0.010 Identities = 24/58 (41%), Positives = 24/58 (41%), Gaps = 2/58 (3%) Frame = +3 Query: 810 PTXXXXPPXX--PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PT PP PPPPP PP P PPP PP P P PPP P P Sbjct: 133 PTPYTPPPPTVKPPPPPVVTP--PPPTPTPEAPCPPP-PPTPYP-----PPPKPETCP 182 Score = 37.9 bits (84), Expect = 0.010 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 4/42 (9%) Frame = +1 Query: 817 PXXXPPXPP---PPPPXPXPXA-XPPXGXXPXPXPPXXPPXP 930 P PP PP PPPP P P A PP P P PP P Sbjct: 141 PTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPPKPETCP 182 Score = 35.9 bits (79), Expect = 0.041 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Frame = +1 Query: 829 PPXPPPPPPXPXPX-AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 PP P P P P A PP P PP P PP P P P PP+ Sbjct: 31 PPKPSPHPVKPPKHPAKPPK--PPTVKPPTHTPKPPTVKPPPPYIPCPPPPY 80 Score = 35.1 bits (77), Expect = 0.072 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP P PP PP P PPP P P P PP P PP Sbjct: 56 PPTHTPKPPTVK----PPPPYIPCP-PPPYTPKPPTVKPPPPPYVKPPPP 100 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 4/54 (7%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXP----XPSXPXXXPPXPP 967 PP P PP PP P PP P P P P PP PP Sbjct: 48 PPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPP 101 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 54.0 bits (124), Expect = 1e-07 Identities = 22/50 (44%), Positives = 24/50 (48%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PPPPPP P + P P P PP P + PPPPPP PP Sbjct: 687 PRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPP 736 Score = 52.4 bits (120), Expect = 4e-07 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPP-LXXXXXPPPPPPXPP 978 PP PPPPPP P P G P PP PP L PPPP PP Sbjct: 727 PPPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPPPTAPP 777 Score = 48.0 bits (109), Expect = 1e-05 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PP PP P A PP PP PP PPL P PPP PP Sbjct: 754 PPAPPAPPRLPTHSASPP--------PPTAPPPPPLGQTRAPSAPPPPPP 795 Score = 47.6 bits (108), Expect = 1e-05 Identities = 20/50 (40%), Positives = 21/50 (42%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PPPPP P P + P P PP P PPP P PP Sbjct: 730 PPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPPPTAPPPP 779 Score = 46.4 bits (105), Expect = 3e-05 Identities = 23/56 (41%), Positives = 24/56 (42%), Gaps = 6/56 (10%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPP------LXXXXXPPPPPPXPP 978 PP PPP PP P P P P PP PP PP + PP PP PP Sbjct: 707 PPPPPPAPPAP-PTPIVHTSSPPPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPP 761 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/57 (38%), Positives = 23/57 (40%), Gaps = 1/57 (1%) Frame = +3 Query: 810 PTXXXXPPXXPPPP-PXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PPPP + PP P PP PP P PPP PP PP Sbjct: 684 PALPRPPPPPPPPPMQHSTVTKVPP----PPPPAPPAPPTPIVHTSSPPPPPPPPPP 736 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 2/52 (3%) Frame = +3 Query: 828 PPXXPPPPPXXXXX--RXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PPPPP + PP P PP P PPP PP PP Sbjct: 689 PPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPP 740 Score = 41.5 bits (93), Expect = 8e-04 Identities = 23/58 (39%), Positives = 23/58 (39%), Gaps = 9/58 (15%) Frame = +1 Query: 829 PPXPPPPPPX---------PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PP PPPPPP P P PP P PP PP PPP PP P Sbjct: 689 PPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPP----PPPPPAPPTP 742 Score = 39.5 bits (88), Expect = 0.003 Identities = 24/71 (33%), Positives = 25/71 (35%), Gaps = 8/71 (11%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXP-------- 944 P T+ PP PP PP P P PPP PP P P P Sbjct: 697 PMQHSTVTKVPPPPPPAPPAPPTPIVHTSSP------PPPPPPPPPPAPPTPQSNGISAM 750 Query: 945 XXPPPXPPXPP 977 PP PP PP Sbjct: 751 KSSPPAPPAPP 761 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +1 Query: 847 PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PPP P P P PP PP PPPPPP PP Sbjct: 674 PPPISNSDKKPALPRPPPPPPP--PPMQHSTVTKVPPPPPPAPP 715 Score = 37.1 bits (82), Expect = 0.018 Identities = 26/92 (28%), Positives = 29/92 (31%), Gaps = 4/92 (4%) Frame = +3 Query: 714 PPPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPP---- 881 PPP P + + + P A T P P PPPPP P Sbjct: 689 PPPPPPPPPMQHSTVTKVPPPPPPAPPAPPT-PIVHTSSPPPPPPPPPPPAPPTPQSNGI 747 Query: 882 XXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PP PPP P PP Sbjct: 748 SAMKSSPPAPPAPPRLPTHSASPPPPTAPPPP 779 Score = 33.5 bits (73), Expect = 0.22 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 1/63 (1%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPX-PPPXPPXPXPXXPXXPPPXP 965 P A LPT PP PPP PP P PPP PP P P Sbjct: 757 PPAPPRLPTHSASPPPPTAPPP-------PPLGQTRAPSAPPPPPPKLGTKLSPSGPNVP 809 Query: 966 PXP 974 P P Sbjct: 810 PTP 812 Score = 33.1 bits (72), Expect = 0.29 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PPP P PP G P P PP PP P P PP Sbjct: 760 PPRLPTHSASPPPPTAP-PPPPLGQTRAPSAP--PPPPPKLGTKLSPSGPNVPP 810 Score = 32.7 bits (71), Expect = 0.38 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 895 PXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P PP P P L PPPPPP P Sbjct: 530 PTPSPPH-PVRPQLAQAGAPPPPPPLP 555 Score = 31.1 bits (67), Expect = 1.2 Identities = 22/62 (35%), Positives = 23/62 (37%), Gaps = 1/62 (1%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXP-PXPPXXP 976 THS + PPP PPPPP P P P PS P P P P P Sbjct: 765 THSASPPPPTA--PPPPPLGQTRAPSAP----PPPPPKLGTKLSPSGPNVPPTPALPTGP 818 Query: 977 XS 982 S Sbjct: 819 LS 820 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/45 (33%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = +3 Query: 846 PPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPX-PPXPP 977 PPP + P P PPP PPP PP PP Sbjct: 674 PPPISNSDKKPALPRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPP 718 Score = 28.3 bits (60), Expect = 8.2 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 7/57 (12%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXP------PPXPPXPXP-XXPXXPPPXPPXPP 977 PP P PP PP P P P PP P P P P PP Sbjct: 754 PPAPPAPPRLPTHSASPPPPTAPPPPPLGQTRAPSAPPPPPPKLGTKLSPSGPNVPP 810 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/56 (46%), Positives = 26/56 (46%), Gaps = 6/56 (10%) Frame = +1 Query: 829 PPXPP---PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP---PXPP 978 PP PP PPPP P PP P P PP P PP PPPPP P PP Sbjct: 493 PPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPP 548 Score = 48.8 bits (111), Expect = 5e-06 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PPPPP P PP P P P PP PP PP P PP Sbjct: 502 PPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPP 555 Score = 47.2 bits (107), Expect = 2e-05 Identities = 26/67 (38%), Positives = 27/67 (40%), Gaps = 6/67 (8%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPP---PPXPXPXAXPPXGXXPXPXPPXXPPXP---PLXXXXXPP 957 +YS P P PPPP PP P P PP P P PP P P PP Sbjct: 515 VYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP 574 Query: 958 PPPPXPP 978 PP PP Sbjct: 575 PPVHSPP 581 Score = 46.8 bits (106), Expect = 2e-05 Identities = 22/54 (40%), Positives = 23/54 (42%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PPPPP PP P P PP P PP+ PPPP PP Sbjct: 510 PPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPV---HSPPPPVHSPP 560 Score = 46.4 bits (105), Expect = 3e-05 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PPP P PPPP PPP P P P P P P PP PP Sbjct: 493 PPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPP--PVYSPPPPP 540 Score = 46.0 bits (104), Expect = 4e-05 Identities = 24/61 (39%), Positives = 27/61 (44%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 +YS P PP P PP P + PP P P PP P PP+ PPPP P Sbjct: 584 VYSPPPPPVHSPPPPVHSPPPPV-HSPPPPVYSPPPPPPVHSPPPPV---FSPPPPVHSP 639 Query: 976 P 978 P Sbjct: 640 P 640 Score = 46.0 bits (104), Expect = 4e-05 Identities = 20/54 (37%), Positives = 21/54 (38%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PPPP P P P P PP P PP+ PP P PP Sbjct: 611 PPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPP 664 Score = 45.6 bits (103), Expect = 5e-05 Identities = 25/64 (39%), Positives = 29/64 (45%), Gaps = 3/64 (4%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPP---PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 ++S P PP PPP PPP P + PP P PP P PP+ PPPP Sbjct: 507 IHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPV---HSPPPPV 563 Query: 967 PXPP 978 PP Sbjct: 564 HSPP 567 Score = 44.8 bits (101), Expect = 9e-05 Identities = 24/60 (40%), Positives = 24/60 (40%), Gaps = 6/60 (10%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXP---PLXXXXXPPPP---PPXPP 978 P PP PPP P P PP P P PP P P PPPP PP PP Sbjct: 532 PVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPP 591 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/57 (40%), Positives = 24/57 (42%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPP---XPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PPPP P P PP P P PP PP+ PPPPP P Sbjct: 616 PPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPV---KSPPPPPVYSP 669 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPP---PXPPXPXPXXPXXPPPXPPXPP 977 PP PPPP PP P PP P PP P P PP P PP Sbjct: 496 PPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPP 548 Score = 44.0 bits (99), Expect = 2e-04 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PPPP PP P PPP P P PP P PP Sbjct: 513 PPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPP 562 Score = 44.0 bits (99), Expect = 2e-04 Identities = 24/66 (36%), Positives = 26/66 (39%), Gaps = 5/66 (7%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPP---PPPPX--PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP 960 +YS P P PP PPPP P P P P PP P PP+ PP Sbjct: 533 VYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPV 592 Query: 961 PPPXPP 978 P PP Sbjct: 593 HSPPPP 598 Score = 44.0 bits (99), Expect = 2e-04 Identities = 24/56 (42%), Positives = 25/56 (44%), Gaps = 6/56 (10%) Frame = +1 Query: 829 PPXPPPPPPX---PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXPP 978 PP PPPP P P PP P PP P PP+ PPP PPP PP Sbjct: 568 PPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPV--HSPPPPVYSPPPPPP 621 Score = 44.0 bits (99), Expect = 2e-04 Identities = 25/60 (41%), Positives = 25/60 (41%), Gaps = 9/60 (15%) Frame = +1 Query: 817 PXXXPPXP---PPPPPX---PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP---PPPP 969 P PP P PPPPP P P PP P P PP PP PP PPPP Sbjct: 576 PVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPP 635 Score = 43.6 bits (98), Expect = 2e-04 Identities = 27/66 (40%), Positives = 28/66 (42%), Gaps = 12/66 (18%) Frame = +1 Query: 817 PXXXPPXP---PPPP---PXPXPXAXPPXGXXPXPXPPXXPPXP---PLXXXXXPPPP-- 963 P PP P PPPP P P + PP P P P PP P P PPPP Sbjct: 555 PVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVY 614 Query: 964 -PPXPP 978 PP PP Sbjct: 615 SPPPPP 620 Score = 43.6 bits (98), Expect = 2e-04 Identities = 26/63 (41%), Positives = 27/63 (42%), Gaps = 8/63 (12%) Frame = +1 Query: 817 PXXXPPXP---PPPP---PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP--PPPX 972 P PP P PPPP P P P PP P PP P PP+ PPP PP Sbjct: 569 PVHSPPPPVHSPPPPVYSPPPPPVHSPPP-PVHSPPPPVHSPPPPVYSPPPPPPVHSPPP 627 Query: 973 PPF 981 P F Sbjct: 628 PVF 630 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/54 (38%), Positives = 22/54 (40%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P PP P P PP P PP P PP+ P PP PP Sbjct: 605 PVHSPPPPVYSPPPPPPVHSPPPPVFSPP-PPVHSPPPPVYSPPPPVYSPPPPP 657 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/60 (38%), Positives = 25/60 (41%), Gaps = 6/60 (10%) Frame = +1 Query: 817 PXXXPPXP---PPPP---PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P PPPP P P + PP P P P PP PP+ PP PP Sbjct: 621 PVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPPLLPPKMSSPP 680 Score = 42.7 bits (96), Expect = 4e-04 Identities = 23/60 (38%), Positives = 25/60 (41%), Gaps = 6/60 (10%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXP---PPPP---PXPP 978 P PP PP P P + PP P P PP PP+ P PPPP P PP Sbjct: 583 PVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPP 642 Score = 42.7 bits (96), Expect = 4e-04 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P PP PPPP PP P P PP P P PP PP Sbjct: 605 PVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPP 657 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/58 (34%), Positives = 21/58 (36%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 +S PPP PPPPP PP P P P P P PP P P Sbjct: 516 YSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSP 573 Score = 41.9 bits (94), Expect = 6e-04 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPP--XPPXPXPXXPXXPPPXPPXPP 977 PP PPP PP P PPP PP P P PPP PP Sbjct: 495 PPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPP 546 Score = 41.5 bits (93), Expect = 8e-04 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXP---PXPP 977 P PP PPPP PP P P PP P P PP P P PP Sbjct: 598 PVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPP 656 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PP P PPP PPP P PP P P PP PP Sbjct: 493 PPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPP 541 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = +1 Query: 829 PPXPPPPPPX--PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PPPP P P P P PP P PP PP P PP Sbjct: 554 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPP 605 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PPP PP P PPP P P PPP PP Sbjct: 506 PIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPP 561 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/59 (33%), Positives = 22/59 (37%), Gaps = 3/59 (5%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXPP 978 + P P P PP P P P PP PP+ PPP PPP PP Sbjct: 474 ESPQPNDPYDQSPVKFRRSPPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPP 532 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PPPP PP P P PP P P PP P PP Sbjct: 576 PVHSPPPPVYSPPPPPV---HSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPP 628 Score = 39.5 bits (88), Expect = 0.003 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P PP PPPP PP P P PP P P PP PP Sbjct: 569 PVHSPPPPVHSPPPPVYSPP-PPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPP 620 Score = 39.1 bits (87), Expect = 0.004 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PPP P PPPP PPP P PP P P P PP P P Sbjct: 587 PPPPPVHSPPPPVHS----PPPPVHSP---PPPVYSPPPPPPVHSPPPPVFSP 632 Score = 38.7 bits (86), Expect = 0.006 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 6/62 (9%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXP---PPXPPXPXPXXPXXPPPXP---PX 971 P PP PPPP PP P P PP PP P P PP P P Sbjct: 555 PVHSPPPPVHSPPPPV----HSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPP 610 Query: 972 PP 977 PP Sbjct: 611 PP 612 Score = 38.7 bits (86), Expect = 0.006 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 6/62 (9%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPP---PXPPXPXPXXPXXPPPXP---PX 971 P PP PPPP PP P PP P PP P P PP P P Sbjct: 562 PVHSPPPPVHSPPPPV----HSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPP 617 Query: 972 PP 977 PP Sbjct: 618 PP 619 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PPPP PP P P PP P P PP P PP Sbjct: 590 PPVHSPPPPV----HSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPP 635 Score = 38.3 bits (85), Expect = 0.008 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = +3 Query: 810 PTXXXXPPXXPP---PPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PP PPP PP P PPP P P PP P PP Sbjct: 512 PPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSP-PPPVHSPPPPVHSPPPPVHSPPPP 569 Score = 37.9 bits (84), Expect = 0.010 Identities = 28/94 (29%), Positives = 29/94 (30%), Gaps = 4/94 (4%) Frame = +3 Query: 708 RCPPPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXX 887 R PPP P S + P P PP P P P Sbjct: 431 RSPPPPQQPHHHVVHSPPPASSPPTSPPVHSTPSPVHKPQPPKESPQPNDPYDQS--PVK 488 Query: 888 XXXXPXPPP--XPPXPXPXXPXXPPP--XPPXPP 977 P PPP PP P P PPP PP PP Sbjct: 489 FRRSPPPPPVHSPPPPSPIHSPPPPPVYSPPPPP 522 Score = 37.5 bits (83), Expect = 0.013 Identities = 18/47 (38%), Positives = 20/47 (42%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 PPPPP P P P P PP PP+ PPPP P + Sbjct: 493 PPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYS-----PPPPPPVY 534 Score = 37.1 bits (82), Expect = 0.018 Identities = 21/58 (36%), Positives = 21/58 (36%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 HS P P PPPP PPP P PP P P P PP P P Sbjct: 499 HSPPPPSPIHSPPPPP---VYSPPPPPPVYSPPPPPPVY-SPPPPPPVHSPPPPVHSP 552 Score = 37.1 bits (82), Expect = 0.018 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXP---PXPP 977 PP PPPP PP P P PP P P PP P P PP Sbjct: 540 PPVHSPPPPVHSPP--PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPP 590 Score = 37.1 bits (82), Expect = 0.018 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P PP PPPP PP P PP P P P P PP P Sbjct: 591 PVHSPPPPVHSPPPPVHSP---PPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPP 642 Score = 36.7 bits (81), Expect = 0.024 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 4/59 (6%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP----XPPF 981 P P PPPPP P PP P P P P PPP PPF Sbjct: 653 PPPPPVKSPPPPPVYSPPLLPPKMSSPPTQTPVNSPPPRTPSQTVEAPPPSEEFIIPPF 711 Score = 36.3 bits (80), Expect = 0.031 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PPPP PP P P PP P P PP PP Sbjct: 628 PVFSPPPPVHSPPPPVYSP---PPPVYSPPPPPVKSPPPPPVYSPPLLPPKMSSPP 680 Score = 35.9 bits (79), Expect = 0.041 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 4/53 (7%) Frame = +1 Query: 832 PXPPPPPPXPX-PXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP---PXPP 978 P PP P P P P P PP PP PPPPP P PP Sbjct: 469 PQPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPPPSPIHSPPPPPVYSPPPP 521 Score = 35.5 bits (78), Expect = 0.054 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 6/62 (9%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXP---PPXPPXPXPXXPXXPPPXP---PX 971 P PP PPPP PP P P PP P P P PP P P Sbjct: 548 PVHSPPPPVHSPPPPV----HSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPP 603 Query: 972 PP 977 PP Sbjct: 604 PP 605 Score = 35.1 bits (77), Expect = 0.072 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P PP P PP P P P PP P P P P Sbjct: 635 PVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPPLLPPKMSSPPTQTPVNSP 688 Score = 34.3 bits (75), Expect = 0.13 Identities = 21/58 (36%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXP-PXGXXPXPXPPXXPPXPPLXXXXXPPPPP---PXPP 978 P PP PP P P P P P P P P+ PPPPP P PP Sbjct: 449 PASSPPTSPPVHSTPSPVHKPQPPKESPQPNDPYDQS--PVKFRRSPPPPPVHSPPPP 504 Score = 34.3 bits (75), Expect = 0.13 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 5/58 (8%) Frame = +2 Query: 818 PPPXPXXPPPP---PXXXXXXRPPPXXX--XPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PPP PPPP P PPP P P P P P PP P P Sbjct: 559 PPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSP 616 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = +1 Query: 817 PXXXPPXPP-PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP P PPP P PP P PP P PPP P Sbjct: 642 PVYSPPPPVYSPPPPPVKSPPPPPVYSPPLLPPKMSSPPTQTPVNSPPPRTP 693 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 3/52 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXP---PXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P PPPPP P P P PP P P P P PP P Sbjct: 532 PVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 583 Score = 33.5 bits (73), Expect = 0.22 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP--XPPXPP 977 P PP PPPP PP P PP P P P PPP PP P Sbjct: 621 PVHSPPPPVFSPPPPVH--SPPPP---VYSPPPPVYSPPPPPVKSPPPPPVYSPPLLP 673 Score = 32.7 bits (71), Expect = 0.38 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 5/51 (9%) Frame = +2 Query: 821 PPXPXXPPP-----PPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP 958 PP P PP PP PPP P PP P P PP Sbjct: 639 PPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPPLLPPKMSSPPTQTPVNSPP 689 Score = 32.3 bits (70), Expect = 0.51 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = +2 Query: 818 PPPXPXXPPPP---PXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PPP PPPP P PPP P PP P P P PP Sbjct: 625 PPPPVFSPPPPVHSPPPPVYSPPPPVYSPP---PPPVKSPPPPPVYSPPLLPP 674 Score = 31.5 bits (68), Expect = 0.88 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P PP PPPP PP P PP P P PP P Sbjct: 635 PVHSPPPPVYSPPPPVYSP---PPPPVKSPPPPPVYSPPLLPPKMSSPPTQTP 684 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/60 (28%), Positives = 17/60 (28%) Frame = +2 Query: 788 TXXXTHSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 T HS P P P P P PP P P P PP PP Sbjct: 455 TSPPVHSTPSPVHKPQPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPPPSPIHSPPPPP 514 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXP-XXPPPXPP 968 P PP PPPP PP P PP P P PPP P Sbjct: 642 PVYSPPPPVYSPPPPPV--KSPPPPPVYSPPLLPPKMSSPPTQTPVNSPPPRTP 693 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 53.2 bits (122), Expect = 3e-07 Identities = 27/55 (49%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXG-GXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG G GGGG GG GG G G G GG G G GGGGGG GG G Sbjct: 78 GGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGG 132 Score = 48.0 bits (109), Expect = 1e-05 Identities = 24/50 (48%), Positives = 24/50 (48%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG G GGGG G GG GG G G G G G GGGGG GG Sbjct: 5 GGSGSGGGGKGGGGGGSGGGRGGGGGGGAK---GGCGGGGKSGGGGGGGG 51 Score = 47.6 bits (108), Expect = 1e-05 Identities = 24/53 (45%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGG-GXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG G GGG G G G GG G G G GG + GGGGG GG Sbjct: 76 GSGGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGG 128 Score = 46.0 bits (104), Expect = 4e-05 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGG-GGXGGXXXG 816 G GGGGGG GG G GG G G G G GGGG GG G G Sbjct: 81 GKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGGGSG 135 Score = 44.8 bits (101), Expect = 9e-05 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GGG G GG G GG G GG G G GGG GG Sbjct: 88 GGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGGGSGGG 137 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 2/50 (4%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGG--XGGGXGXXXXXXGGXRXXXXXGGGGG 839 G G G GGG G G G GG GGG G GG GGGGG Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGG 51 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/49 (42%), Positives = 22/49 (44%), Gaps = 2/49 (4%) Frame = -1 Query: 967 GGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGG--GGGXXGG 827 GG GG G G G GG G G G GG + GG GGG GG Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGG 50 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG G G G G G G GGG G GG GGG GG Sbjct: 86 GGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGGGSGGG 137 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -3 Query: 932 GGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GG G G GG G G GGGGG GG G Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGG 40 Score = 39.5 bits (88), Expect = 0.003 Identities = 23/56 (41%), Positives = 24/56 (42%), Gaps = 1/56 (1%) Frame = -2 Query: 981 EXGXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGG-GGGXXGXGGG 817 E GG GG G G G G GG G GGG+ GG GG G GGG Sbjct: 70 ESDPKGGSGGGGKGG-GGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGG 124 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G GG GG G G GG GGG GG GGG GG Sbjct: 87 GGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGGGSGGGG 138 Score = 36.7 bits (81), Expect = 0.024 Identities = 21/43 (48%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = -3 Query: 935 RGGXGGXXGGXGXGXXPXGGXAXG-XGXGGG--GGGXGGXXXG 816 +GG GG G G G GG A G G GGG GGG GG G Sbjct: 74 KGGSGGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNG 116 Score = 35.9 bits (79), Expect = 0.041 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG GG G G GG G GG GGGG GGG Sbjct: 81 GKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGGG 133 Score = 35.9 bits (79), Expect = 0.041 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGG 839 G GG GGG G G G GG GGG G G G G Sbjct: 100 GCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGGGSGGGGYMVAPGSNG 147 Score = 34.7 bits (76), Expect = 0.095 Identities = 26/81 (32%), Positives = 28/81 (34%) Frame = -1 Query: 955 GGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRVSXAXGSQXF 776 GG G G G GGG G GG G GGG G G A GS Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGGYMVAPGSNRS 61 Query: 775 XQXD*SNDXNRQELGIVSGGG 713 N + + G SGGG Sbjct: 62 SYISRDNFESDPKGG--SGGG 80 Score = 34.7 bits (76), Expect = 0.095 Identities = 22/55 (40%), Positives = 23/55 (41%), Gaps = 5/55 (9%) Frame = -2 Query: 966 GGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXX-----GXGGG 817 GG GG G G G GG G GGG+ GGGGG G GGG Sbjct: 85 GGGGGISGGGAGGKSGCGGGKSGGGG--GGGKNGGGCGGGGGGKGGKSGGGSGGG 137 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXR 869 G G GG GG G G G G GGG G G R Sbjct: 23 GGRGGGGGGGAKGGCGGGGKSGGGGGGGGYMVAPGSNR 60 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/56 (46%), Positives = 26/56 (46%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXW 810 GG GGGGG GG G GG G G GG G G GGG GG G G W Sbjct: 115 GGYSGGGGGGYERRSGGYGSGGGGGGRGYG-GGGRREGGGYGGGDGGSYGGGGGGW 169 Score = 48.0 bits (109), Expect = 1e-05 Identities = 27/55 (49%), Positives = 28/55 (50%), Gaps = 6/55 (10%) Frame = -3 Query: 977 GGXGGGGGGXXXXXR-GGXGGXXGGXGXGXXPXGG-----XAXGXGXGGGGGGXG 831 GG GGG GG R GG GG GG G G GG + G G GGGGGG G Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRG 142 Score = 42.7 bits (96), Expect = 4e-04 Identities = 23/59 (38%), Positives = 23/59 (38%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGR 806 G GG GG GGG G G G GGG G R G GGG G GR Sbjct: 90 GGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGR 148 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/62 (41%), Positives = 26/62 (41%), Gaps = 5/62 (8%) Frame = -2 Query: 975 GXXGGXGGXXXGXE-GXGXGXXGGXXXGXXXXGGG----RXXXXXXGGGGGXXGXGGGXL 811 G GG GG G G G G GG G GGG R GGGGG G GGG Sbjct: 89 GGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGR 148 Query: 810 XE 805 E Sbjct: 149 RE 150 Score = 41.1 bits (92), Expect = 0.001 Identities = 26/62 (41%), Positives = 26/62 (41%), Gaps = 8/62 (12%) Frame = -3 Query: 977 GGXGGG--GGGXXXXXRGGXGGXXGGXGXGXXPX------GGXAXGXGXGGGGGGXGGXX 822 GG GGG GG GG GG GG G G GG G G GGGG GG Sbjct: 95 GGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGRREGGGY 154 Query: 821 XG 816 G Sbjct: 155 GG 156 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG G GGG G G GGG G G GG GG GG Sbjct: 113 GGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGRREGGGYGGGDGGSYGG 164 Score = 36.7 bits (81), Expect = 0.024 Identities = 23/55 (41%), Positives = 24/55 (43%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXWXS 804 G GGGG RGG GG G G GG G G GGGGG G + S Sbjct: 86 GSGGGG---GGRGGSGGGYRSGGGGGYSGGG---GGGYSGGGGGGYERRSGGYGS 134 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGG 839 G GG GG G G G GGG GG GGGGG Sbjct: 121 GGGGYERRSGGYGSGGGGGGRGYGGGGRREGGGYGGGDGGSYGGGGGG 168 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = -1 Query: 943 GXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRVSXAXGS 785 G G G G G G G GG GGGGG GG R S GS Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGG----YSGGGGGGYSGGGGGGYERRSGGYGS 134 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 52.4 bits (120), Expect = 4e-07 Identities = 27/55 (49%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXG-GXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GG GGG G GG G G G G GG A G G GGGGG GG G Sbjct: 212 GGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYG 266 Score = 50.8 bits (116), Expect = 1e-06 Identities = 25/53 (47%), Positives = 25/53 (47%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G G GGGG G GG GG G G GG A G G G GGG GG G Sbjct: 194 GGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGG 246 Score = 50.8 bits (116), Expect = 1e-06 Identities = 24/53 (45%), Positives = 24/53 (45%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GGGGG GG G GG G G GG G G GGGG GG G Sbjct: 210 GGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGG 262 Score = 50.0 bits (114), Expect = 2e-06 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GGGGGG G G GG G G G G GGGGGG G Sbjct: 169 GGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSG 218 Score = 49.2 bits (112), Expect = 4e-06 Identities = 24/54 (44%), Positives = 25/54 (46%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG G GGGG G GG G G G GG + G G GGGG GG G Sbjct: 167 GGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGG 220 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGGG G GG GG G GG G GGGG G GG G Sbjct: 172 GGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGG 225 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGG G G GG GG G G G G G GGG GG G G Sbjct: 173 GGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGG 226 Score = 48.4 bits (110), Expect = 7e-06 Identities = 25/55 (45%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGG-GGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGG GGG GG GG GG G GG G G GGG GG G Sbjct: 191 GGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGG 245 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/52 (44%), Positives = 23/52 (44%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG G GGG G G GG G G G GG GGGGG GG Sbjct: 211 GGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGG 262 Score = 48.4 bits (110), Expect = 7e-06 Identities = 25/56 (44%), Positives = 26/56 (46%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXW 810 G GG GGG GG GG GG G GG G G GGG GG GG G + Sbjct: 234 GSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGG-EHGGGSGGGHGGGGGHGGGGY 288 Score = 47.6 bits (108), Expect = 1e-05 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG G GGG GG G GG G G GG G GG GGG GG Sbjct: 230 GGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGG 279 Score = 47.2 bits (107), Expect = 2e-05 Identities = 27/58 (46%), Positives = 27/58 (46%), Gaps = 4/58 (6%) Frame = -3 Query: 977 GGXGGGGG---GXXXXXRGGXGGXXG-GXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGGGG G G G G G G G GG A G G G GGGG GG G Sbjct: 125 GGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGG 182 Score = 46.8 bits (106), Expect = 2e-05 Identities = 26/53 (49%), Positives = 26/53 (49%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GGG GG GG G GG G G GG A G G GGG GG GG G Sbjct: 68 GAGGGYGGAEGYASGGGSGHGGGGG-GAASSGGYASGAGEGGG-GGYGGAAGG 118 Score = 46.8 bits (106), Expect = 2e-05 Identities = 23/52 (44%), Positives = 23/52 (44%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G GG GGG G G G GG GG G GG GGGG GG Sbjct: 236 GGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGGGGHGGGG 287 Score = 46.4 bits (105), Expect = 3e-05 Identities = 25/54 (46%), Positives = 25/54 (46%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGGGG GG GG GG G GG G G GG GG GG G Sbjct: 162 GGAYGGGGGHGG---GGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGG 212 Score = 46.4 bits (105), Expect = 3e-05 Identities = 28/59 (47%), Positives = 28/59 (47%), Gaps = 5/59 (8%) Frame = -3 Query: 977 GGXGGGG--GGXXXXXRGGXGGXXGGX--GXGXXPXGGXAXGXGXGGG-GGGXGGXXXG 816 GG GGGG GG GG GG GG G G GG G G GGG GGG G G Sbjct: 195 GGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGG 253 Score = 45.6 bits (103), Expect = 5e-05 Identities = 26/57 (45%), Positives = 26/57 (45%), Gaps = 3/57 (5%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGG-XAXGXGXG--GGGGGXGGXXXG 816 GG GGG GG G G G G G GG A G G G GGGGG GG G Sbjct: 121 GGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGGGGGG 177 Score = 44.8 bits (101), Expect = 9e-05 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GG GG GG GG GG G G A G G G G GG G Sbjct: 107 GGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAG 156 Score = 44.8 bits (101), Expect = 9e-05 Identities = 26/56 (46%), Positives = 26/56 (46%), Gaps = 2/56 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGG--XGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGGG GG GG GG G G GG A G G GG GG GG G Sbjct: 161 GGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGG-EGGGAGGGGSHGGAGGYGGGGGG 215 Score = 44.8 bits (101), Expect = 9e-05 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G G GGG G G GG GGG G GG G GGG GG Sbjct: 191 GGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGG 242 Score = 44.8 bits (101), Expect = 9e-05 Identities = 24/54 (44%), Positives = 24/54 (44%), Gaps = 2/54 (3%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXG--XGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG GG GGG G G G G GGG G GG G GGG GG Sbjct: 205 GAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGG 258 Score = 44.4 bits (100), Expect = 1e-04 Identities = 28/66 (42%), Positives = 29/66 (43%), Gaps = 8/66 (12%) Frame = -3 Query: 977 GGXGGGG-------GGXXXXXRGGXGGXXG-GXGXGXXPXGGXAXGXGXGGGGGGXGGXX 822 GG GGGG GG GG GG G G G G G A G G G GGGG G Sbjct: 37 GGHGGGGGSGGVSSGGYGGESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGGGGGAAS 96 Query: 821 XGXWXS 804 G + S Sbjct: 97 SGGYAS 102 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG G GGGG GG G G G GG A G GGGGG GG Sbjct: 83 GGSGHGGGGGGAASSGGYASGAGEGGGGGY--GGAAGGHAGGGGGGSGGG 130 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/58 (37%), Positives = 22/58 (37%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 G GG GG GGG G G GGG G G GGGGG G G Sbjct: 167 GGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYG 224 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG G GGG G GG GG G G G G G GGG GG G Sbjct: 231 GGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGGGGHG 284 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 GG G G G GG G GG G GG G G GGG GG G Sbjct: 153 GGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGG 201 Score = 43.6 bits (98), Expect = 2e-04 Identities = 23/54 (42%), Positives = 23/54 (42%), Gaps = 2/54 (3%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXG--GGGGXXGG 827 G G GG GGG G G GG GGG GG G GGGG GG Sbjct: 232 GYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGGGGHGG 285 Score = 43.2 bits (97), Expect = 3e-04 Identities = 24/56 (42%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGG--GGXGGXXXG 816 GG GGGG G GG GG G G G G G GGGG GG G G Sbjct: 219 GGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSG 274 Score = 42.7 bits (96), Expect = 4e-04 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG GG GG G G G GG GGG G G G G G GG Sbjct: 105 GEGGGGGYGGAAGGHAGGGGGGSGGGGG--SAYGAGGEHASGYGNGAGEGGG 154 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/52 (46%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXG-GXGXGXXPXGGXAXGXGXGGG-GGGXGG 828 G GGG G G GG G G G G GG G G GGG GGG GG Sbjct: 148 GAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGG 199 Score = 42.3 bits (95), Expect = 5e-04 Identities = 23/50 (46%), Positives = 24/50 (48%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG G GGG GG G GG G G GG + G G GGGG GG Sbjct: 185 GGSGYGGGEGGGAGGGGSHGGAGGYGGG---GGGGSGGGGAYGGGGAHGG 231 Score = 41.9 bits (94), Expect = 6e-04 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGGG-GGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GG G GG GG G G G G GG G GGGG GG G Sbjct: 182 GAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSG 236 Score = 41.9 bits (94), Expect = 6e-04 Identities = 22/58 (37%), Positives = 22/58 (37%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 G G GG GG G G G GG GGG G G GGG GG G Sbjct: 195 GGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYG 252 Score = 41.9 bits (94), Expect = 6e-04 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 GG G GGG G G G G GG G GG GG GG GG Sbjct: 230 GGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGG 279 Score = 41.5 bits (93), Expect = 8e-04 Identities = 24/67 (35%), Positives = 25/67 (37%), Gaps = 1/67 (1%) Frame = -1 Query: 982 GXGGXGGXGG-GXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGR 806 G GG GG GG G G GG GGG G G GGG G GG Sbjct: 38 GHGGGGGSGGVSSGGYGGESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGGGGGAASS 97 Query: 805 VSXAXGS 785 A G+ Sbjct: 98 GGYASGA 104 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/54 (42%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGG-GGGXGGXXXG 816 G G G GG G G GG G G GG A G G G GGG GG G Sbjct: 146 GNGAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGG 199 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG GG GG G G G G G G GGGGG GG Sbjct: 123 GGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGGG 174 Score = 40.7 bits (91), Expect = 0.001 Identities = 23/58 (39%), Positives = 23/58 (39%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 G GG G G G G G G GG GGG G G GGG G GG G Sbjct: 188 GYGGGEGGGAGGGGSHG-GAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYG 244 Score = 40.3 bits (90), Expect = 0.002 Identities = 26/54 (48%), Positives = 26/54 (48%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGGGG GG GG GG G G GG G G GGG GG G G Sbjct: 36 GGGHGGGGGSGGVSSGGYGGESGG-GYG----GGS--GEGAGGGYGGAEGYASG 82 Score = 40.3 bits (90), Expect = 0.002 Identities = 24/56 (42%), Positives = 24/56 (42%), Gaps = 4/56 (7%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXG----GXRXXXXXGGGGGXXGG 827 G GG GG GG G G G GG GGG G G G GGGG GG Sbjct: 172 GGGGGGGSAGGAHGGSGYG-GGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGG 226 Score = 40.3 bits (90), Expect = 0.002 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGG-GGGGXGGXXXG 816 GG GGG G GG GG G G G GG G GG GGG GG G Sbjct: 226 GGAHGGGYGSGGGEGGGYGGGAAG-GYGGGGGGGEGGGGSYGGEHGGGSGGGHGG 279 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/53 (41%), Positives = 22/53 (41%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG GG G G G GG G GGG GG GG G GGG Sbjct: 234 GSGGGEGGGYGGGAAGGYGGGGGGGEG----GGGSYGGEHGGGSGGGHGGGGG 282 Score = 39.5 bits (88), Expect = 0.003 Identities = 24/59 (40%), Positives = 24/59 (40%), Gaps = 1/59 (1%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXG-GXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 G G GG GGG G G G GGG G GG GGGGG GG G Sbjct: 83 GGSGHGGGGGGAASSGGYASGAGEGGGGG-----YGGAAGGHAGGGGGGSGGGGGSAYG 136 Score = 39.5 bits (88), Expect = 0.003 Identities = 25/66 (37%), Positives = 25/66 (37%), Gaps = 1/66 (1%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGG-GGXXGGXXXXVGR 806 G G G GGG G G G G GGG G GG G G GG GG G Sbjct: 144 GYGNGAGEGGG-AGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGS 202 Query: 805 VSXAXG 788 A G Sbjct: 203 HGGAGG 208 Score = 39.5 bits (88), Expect = 0.003 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG G GGG G G GG G G G GG G GGG GG Sbjct: 166 GGGGGHG-GGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGG 216 Score = 39.1 bits (87), Expect = 0.004 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXG--XGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG GGG G G G GG GG G GG GG GG GG Sbjct: 159 GYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGG 212 Score = 39.1 bits (87), Expect = 0.004 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G G GGG G G G G GG G GG GGGG GG Sbjct: 182 GAHGGSGYGGGEGGGAGGG-GSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGG 232 Score = 37.5 bits (83), Expect = 0.013 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G GG GG G G GG GGG G G G GGG GG Sbjct: 231 GGYGSGGGEGG--GYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGG 280 Score = 37.1 bits (82), Expect = 0.018 Identities = 23/60 (38%), Positives = 23/60 (38%), Gaps = 2/60 (3%) Frame = -1 Query: 982 GXGGXGGXGG--GXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 G G GG GG G G G GG GGG GG GGGGG G G Sbjct: 66 GEGAGGGYGGAEGYASGGGSGHGGGGGGAA----SSGGYASGAGEGGGGGYGGAAGGHAG 121 Score = 35.9 bits (79), Expect = 0.041 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G G G G G GG G G G GG G GG G GG G Sbjct: 144 GYGNGAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGG 196 Score = 34.7 bits (76), Expect = 0.095 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G G GG G G G GG G GGG GG G GGG Sbjct: 224 GGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGG 276 Score = 34.3 bits (75), Expect = 0.13 Identities = 23/72 (31%), Positives = 24/72 (33%), Gaps = 3/72 (4%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGG-XGGGXGXXXXXXGGXRXXXXXGG--GGGXXGGXXXXV 812 G G GG G G G G GG G G GG GG GGG G Sbjct: 118 GHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGGGGGG 177 Query: 811 GRVSXAXGSQXF 776 G A G + Sbjct: 178 GSAGGAHGGSGY 189 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGG 820 G GG G G G G G G GG GG GG G GG Sbjct: 150 GEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGG 201 Score = 31.5 bits (68), Expect = 0.88 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 3/55 (5%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXG---XGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G GG G G G GG G G G GGGGG GG Sbjct: 75 GAEGYASGGGSGHGGGGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGGGSGG 129 Score = 31.5 bits (68), Expect = 0.88 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -2 Query: 966 GGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 GG G G G G GG G G GGGGG GG Sbjct: 90 GGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGG 139 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/69 (28%), Positives = 22/69 (31%), Gaps = 2/69 (2%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXG--GGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 G GG G G G G GG GG GG GG G GG G Sbjct: 72 GYGGAEGYASGGGSGHGGGGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGGGSGGGG 131 Query: 808 RVSXAXGSQ 782 + G + Sbjct: 132 GSAYGAGGE 140 Score = 29.9 bits (64), Expect = 2.7 Identities = 18/66 (27%), Positives = 18/66 (27%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRV 803 G GG G G G GG GG G G GG G G Sbjct: 93 GAASSGGYASGAGEGGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEG 152 Query: 802 SXAXGS 785 A S Sbjct: 153 GGAGAS 158 Score = 28.3 bits (60), Expect = 8.2 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -2 Query: 942 GXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G G G GG G GG GGG G GGG Sbjct: 31 GQASGGGGHGGGGGSGGVSSGGYGGESGGGYGGGSGEGAGGG 72 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 52.0 bits (119), Expect = 6e-07 Identities = 25/59 (42%), Positives = 25/59 (42%), Gaps = 5/59 (8%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP-----PXPP 978 P PP PP PPP P PP P P PP PP PPPPP P PP Sbjct: 411 PPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHSSPPPP 469 Score = 49.2 bits (112), Expect = 4e-06 Identities = 27/63 (42%), Positives = 27/63 (42%), Gaps = 12/63 (19%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXX---PXPXPPXX-PPXPPLXXXXXPPPPP--------PX 972 PP PPP PP P P PP P P PP PP PP PPPPP P Sbjct: 411 PPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHSSPPPPS 470 Query: 973 PPF 981 P F Sbjct: 471 PEF 473 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 PP PPP P PP P P PP P PP PPPPP Sbjct: 405 PPIVALPPPPPPSPPLPPPVYSPPPSPPVFSP-PPSPPVYSPPPPP 449 Score = 39.5 bits (88), Expect = 0.003 Identities = 25/73 (34%), Positives = 28/73 (38%), Gaps = 12/73 (16%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPP----PPPXPXPXAXPPXGXXPXPXPP----XXPPXPPLXXXXX 951 + +L P PP PPP PP P P P PP PP PP+ Sbjct: 407 IVALPPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHSSP 466 Query: 952 PPPPP----PXPP 978 PPP P P PP Sbjct: 467 PPPSPEFEGPLPP 479 Score = 37.5 bits (83), Expect = 0.013 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PP PP PP PP P P P PP PP Sbjct: 405 PPIVALPPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPP 460 Score = 37.5 bits (83), Expect = 0.013 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 4/55 (7%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPX----GXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P P PPPPP + PP P P P P PP+ PPPP Sbjct: 437 PPSPPVYSPPPPPSIHYSSPPPPPVHHSSPPPPSPEFEGPLPPVIGVSYASPPPP 491 Score = 36.7 bits (81), Expect = 0.024 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 9/65 (13%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPP-----XPPXPXPXXPXXPPPXP--- 965 P PP PPP PP P PPP PP P PPP P Sbjct: 415 PPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHSSPPPPSPEFE 474 Query: 966 -PXPP 977 P PP Sbjct: 475 GPLPP 479 Score = 35.5 bits (78), Expect = 0.054 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXP--XXPPPXPPXPP 977 P PPPPP PP PPP P P P PP PP Sbjct: 441 PVYSPPPPPSIHYSSPPPPPVHHSSPPPPSPEFEGPLPPVIGVSYASPPPPP 492 Score = 33.1 bits (72), Expect = 0.29 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 853 PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P P A PP P PP PP PPP PP Sbjct: 403 PSPPIVALPPPPPPSPPLPPPVYSPPPSPPVFSPPPSPP 441 Score = 31.9 bits (69), Expect = 0.67 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXPXS 982 PP PPPPP P P P PP P P S P P P P S Sbjct: 405 PPIVALPPPPP-------PSPPLPPPVYSPPPSP-PVFSPPPSPPVYSPPPPPS 450 Score = 31.9 bits (69), Expect = 0.67 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 6/60 (10%) Frame = +3 Query: 807 LPTXXXXPPXXPP--PPPXXXXXRXPPXXXXXXPXPPPXPP----XPXPXXPXXPPPXPP 968 LP PP PP PP PP PP PP P P P P PP Sbjct: 420 LPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHSSPPPPSPEFEGPLPP 479 Score = 31.1 bits (67), Expect = 1.2 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 9/62 (14%) Frame = +3 Query: 810 PTXXXXPPXXPP---PPPXXXXXRXPPXXXXXXPXPPPXP------PXPXPXXPXXPPPX 962 P PP PP PPP PP P PPP P P P PPP Sbjct: 412 PPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPP--SIHYSSPPPPPVHHSSPPPP 469 Query: 963 PP 968 P Sbjct: 470 SP 471 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 52.0 bits (119), Expect = 6e-07 Identities = 22/46 (47%), Positives = 23/46 (50%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PPPPP P P + P P P PP PP PPPPPP PP Sbjct: 49 PPPPPSPPPPSCTPSPPPPSPPPPKKSSCPP---SPLPPPPPPPPP 91 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/48 (43%), Positives = 22/48 (45%), Gaps = 5/48 (10%) Frame = +1 Query: 829 PPXPPPPP--PXPXPXAXPPX---GXXPXPXPPXXPPXPPLXXXXXPP 957 PP PPPP P P P + PP P P PP PP PP PP Sbjct: 52 PPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPPPNYVFTYPP 99 Score = 43.2 bits (97), Expect = 3e-04 Identities = 22/57 (38%), Positives = 23/57 (40%) Frame = +3 Query: 807 LPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 +P PP P PPP PP P PPP P P PPP PP PP Sbjct: 42 IPCLQNQPPPPPSPPPPSCTPSPPP------PSPPPPKKSSCPPSPLPPPP-PPPPP 91 Score = 38.3 bits (85), Expect = 0.008 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 2/57 (3%) Frame = +2 Query: 812 NXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPS--XPXXXPPXPPXXP 976 N P PPPPP PPP P PP P P S P PP PP P Sbjct: 40 NCIPCLQNQPPPPP------SPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPP 90 Score = 35.1 bits (77), Expect = 0.072 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = +2 Query: 812 NXPPPXPXXPPPP-PXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 N PPP P PPP PPP P P P P P PP Sbjct: 47 NQPPPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPPPNYVFTYPP 99 Score = 32.7 bits (71), Expect = 0.38 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 4/53 (7%) Frame = +3 Query: 828 PPXXPPP---PPXXXXXRXPPXXXXXXPXP-PPXPPXPXPXXPXXPPPXPPXP 974 PP PPP P PP P P PP PP P P PP P Sbjct: 52 PPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPPPNYVFTYPPGDLYP 104 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 51.6 bits (118), Expect = 8e-07 Identities = 25/57 (43%), Positives = 26/57 (45%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXPPPPP---PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PPPPP P P PP P PP PP P + P PPPP PP Sbjct: 22 PLPPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPP--PPPPAMRRRVLPRPPPPPPP 76 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/54 (44%), Positives = 24/54 (44%), Gaps = 4/54 (7%) Frame = +1 Query: 829 PPXPPPPPPX----PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PPPPPP P P PP P PP PP PPPPPP P Sbjct: 25 PPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPPPLP 78 Score = 40.7 bits (91), Expect = 0.001 Identities = 24/68 (35%), Positives = 26/68 (38%), Gaps = 8/68 (11%) Frame = +3 Query: 795 AXLTLPTXXXXPPXXPPPPPXXXXXR-------XPPXXXXXXPXPPPXPP-XPXPXXPXX 950 A ++ P P PPPPP R PP P PPP PP P Sbjct: 11 AVVSPPMRGRVPLPPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRP 70 Query: 951 PPPXPPXP 974 PPP PP P Sbjct: 71 PPPPPPLP 78 Score = 38.3 bits (85), Expect = 0.008 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 877 PPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P G P P PP PP P PPPPPP Sbjct: 16 PMRGRVPLPPPPPPPPPPMRRRAPLPPPPPP 46 Score = 37.9 bits (84), Expect = 0.010 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 879 PXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P P PPP PP P P P P PP PP Sbjct: 15 PPMRGRVPLPPPPPPPPPPMRRRAPLPPPPPPP 47 Score = 32.3 bits (70), Expect = 0.51 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 4/46 (8%) Frame = +1 Query: 850 PPXPXPXAXPPXGXXPXP----XPPXXPPXPPLXXXXXPPPPPPXP 975 PP PP P P P PP PP P PPPP P Sbjct: 15 PPMRGRVPLPPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPP 60 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 51.6 bits (118), Expect = 8e-07 Identities = 23/54 (42%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXP-XPPXXPPXPPLXXXXXPPPPPPXP 975 P P PPP P P P PP P P PP PP PP PPP P P Sbjct: 34 PPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKP 87 Score = 49.2 bits (112), Expect = 4e-06 Identities = 24/56 (42%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXP-PXGXXPXPXPPXXP-PXPPLXXXXXPPPPPPXPP 978 P PP P P P P P P P P P PP P P PP P P PP PP Sbjct: 50 PCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPP 105 Score = 48.4 bits (110), Expect = 7e-06 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P PPP P P PP P P P P PP PPP P P Sbjct: 44 PAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVP 97 Score = 47.6 bits (108), Expect = 1e-05 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P PP P P P P P P P PP PP P P P P P Sbjct: 83 PEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAP 135 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Frame = +1 Query: 829 PPXPPP---PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP P P PPP P P P P P PP P P+ PP PP P Sbjct: 25 PPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQP 77 Score = 46.4 bits (105), Expect = 3e-05 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXP---PXPPLXXXXXPPPPPPXPP 978 PP PP PP P P PP P P P P P PP P P PP P Sbjct: 65 PPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGP 117 Score = 46.0 bits (104), Expect = 4e-05 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 2/56 (3%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP--PPXPP 978 P P PP P P P P P P P P P PP PPP PP PP Sbjct: 18 PSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPP 73 Score = 46.0 bits (104), Expect = 4e-05 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 4/57 (7%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP--XXPPXPPLXXXXXPPP--PPPXP 975 P PP PP P P P P P P P P PP PP PP PPP P Sbjct: 65 PPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKP 121 Score = 44.8 bits (101), Expect = 9e-05 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXP-PXXPPXPPLXXXXXPPPPPPXP 975 P P PPP P P P P P P P P P PP PP P P P Sbjct: 26 PGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKP 79 Score = 44.8 bits (101), Expect = 9e-05 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Frame = +1 Query: 817 PXXXPPXP-PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P P P PPP P P P P P PP P P PPP P P Sbjct: 70 PTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAP 123 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXP-PPPPPXPP 978 P P PP P P P P P P P P P PP P P P P PP Sbjct: 28 PSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPP 82 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Frame = +1 Query: 817 PXXXPPXP-PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PP PP PP P P PP P P PP P P PP P P P Sbjct: 60 PKPVPPPACPPTPPKPQPKPAPP--PEPKPAPPPAPKPVPCPSPPKPPAPTPKP 111 Score = 44.0 bits (99), Expect = 2e-04 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PP P P PP PP P PP P P P P PP PP Sbjct: 25 PPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPP 73 Score = 44.0 bits (99), Expect = 2e-04 Identities = 19/53 (35%), Positives = 20/53 (37%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P PPP P P P P P P P P P+ PP P P P Sbjct: 73 PKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAP 125 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P PP PP P P PP G P P P P P P P PP P Sbjct: 93 PKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSP-----KPAPSPPKP 140 Score = 43.2 bits (97), Expect = 3e-04 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 2/55 (3%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXP-PXPPLXXXXXP-PPPPPXP 975 P P P PP P P G P P PP P P PP P P PPP P Sbjct: 4 PTPDPSPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKP 58 Score = 43.2 bits (97), Expect = 3e-04 Identities = 22/67 (32%), Positives = 23/67 (34%), Gaps = 4/67 (5%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPX----PPXPXPXXPXXPP 956 P P+ P PPP P PP P PPP PP P P P Sbjct: 25 PPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPE 84 Query: 957 PXPPXPP 977 P P PP Sbjct: 85 PKPAPPP 91 Score = 42.7 bits (96), Expect = 4e-04 Identities = 22/58 (37%), Positives = 23/58 (39%), Gaps = 2/58 (3%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXP-PXXXXXXPXPPPXP-PXPXPXXPXXPPPXPPXPP 977 P+ PP P P P P P P PPP P P P P P P PP PP Sbjct: 48 PSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPP 105 Score = 42.7 bits (96), Expect = 4e-04 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P P PPP P P P P P PP P PP PP P Sbjct: 55 PPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAP 107 Score = 42.3 bits (95), Expect = 5e-04 Identities = 21/62 (33%), Positives = 22/62 (35%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P + P P P PPP P P PPP P P P P PP PP Sbjct: 15 PPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPP-KPQPKPVPPPACPPTPP 73 Query: 969 XP 974 P Sbjct: 74 KP 75 Score = 41.5 bits (93), Expect = 8e-04 Identities = 24/58 (41%), Positives = 24/58 (41%), Gaps = 8/58 (13%) Frame = +1 Query: 829 PPXP---PPPPPXPXPXAXPPXGXXPXPXPPXXP-----PXPPLXXXXXPPPPPPXPP 978 PP P P PP P P PP P P PP P P PP P PPP PP Sbjct: 15 PPGPSSKPVAPPGPSPCPSPPP--KPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPP 70 Score = 39.5 bits (88), Expect = 0.003 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXP-PXPXPXXPXXPPPXPPXPP 977 P P P PP PP P PPP P P P P P P P P PP Sbjct: 12 PVAPPGPSSKPVAPPGPSPCPSPPPKPQ--PKPPPAPSPSPCPSPPPKPQPKPVPPP 66 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P PP P P P P P P PP P PPP P P Sbjct: 8 PSPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQP 60 Score = 38.3 bits (85), Expect = 0.008 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 4/60 (6%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXP-PPXPPXPXPXXPXXPPPXP---PXPP 977 P P PPP P PP P P PP P P P P P P P PP Sbjct: 79 PAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPP 138 Score = 37.5 bits (83), Expect = 0.013 Identities = 20/58 (34%), Positives = 21/58 (36%), Gaps = 3/58 (5%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPX--PPPXP-PXPXPXXPXXPPPXPPXP 974 P PP P P P + P P PPP P P P P P P PP P Sbjct: 83 PEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPPKP 140 Score = 35.9 bits (79), Expect = 0.041 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P P P PPP P P P P PP P P P P P Sbjct: 77 PKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSP 131 Score = 34.7 bits (76), Expect = 0.095 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 6/62 (9%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPP---XPPXPXPXXPXXPPPXP---PX 971 PT P PP P P P P P PP P P PPP P P Sbjct: 4 PTPDPSPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPV 63 Query: 972 PP 977 PP Sbjct: 64 PP 65 Score = 33.1 bits (72), Expect = 0.29 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPP-XXPXPXPSXPXXXPPXPP 967 PPP P P P P P P P PP P P P+ P PP Sbjct: 89 PPPAPK-PVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPP 138 Score = 33.1 bits (72), Expect = 0.29 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXP 930 P PP PPP P P P P P P P P Sbjct: 109 PKPVPPHGPPPKPAPAPTPAPSPKPAPSPPKPENKTIP 146 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/52 (46%), Positives = 24/52 (46%), Gaps = 3/52 (5%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPP-XGXXPXPXPPXXPPXP--PLXXXXXPPPPPPXP 975 PP PPPPPP P P PP P P P P P PL PP P P P Sbjct: 161 PPLPPPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTP 212 Score = 41.5 bits (93), Expect = 8e-04 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 3/56 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXP-PXGXXPXPXP--PXXPPXPPLXXXXXPPPPPPXP 975 P PP P P PP P P P P P P P P P PP P P P P Sbjct: 164 PPPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLP 219 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXP--PXXPPXPPLXXXXXPPPPPPXP 975 P P P P P P P PP P P P P P PP P P P P Sbjct: 212 PGPDSPLPSPGPDSPLPLPGPPPSSSPTPGPDSPLPSPGPPPSPSPTPGPDSPLP 266 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXP-PLXXXXXPPPPPPXPP 978 P P P P P P P PP P P P P P P P PPP P Sbjct: 184 PGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSSSP 238 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P P P P P P P P P P P P P PP Sbjct: 200 PLPGPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSSSPTPGPDSPLPSPGPPP 253 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 7/57 (12%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXX------PXPPPXPPXPXPXXPXXPPPXP-PXPP 977 PP PPPPP PP P P P P P P P P P P P P Sbjct: 161 PPLPPPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSP 217 Score = 37.5 bits (83), Expect = 0.013 Identities = 29/97 (29%), Positives = 30/97 (30%), Gaps = 4/97 (4%) Frame = +3 Query: 696 SDHVRCPPPETMPSSCRFX-SXDQSXCXXX*LPXAXLTLPTXXXXPPXXPPPPPXXXXXR 872 SD PPP PS S + LP P PP P P P Sbjct: 159 SDPPLPPPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPL 218 Query: 873 XPPXXXXXXPXPPPXP---PXPXPXXPXXPPPXPPXP 974 P P P P P P P P P P PP P Sbjct: 219 PSPGPDSPLPLPGPPPSSSPTPGPDSPLPSPGPPPSP 255 Score = 37.5 bits (83), Expect = 0.013 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 4/57 (7%) Frame = +1 Query: 817 PXXXPPX---PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXP-PLXXXXXPPPPPPXP 975 P PP P P P P P PP P P P P P P P P PP P Sbjct: 228 PLPGPPPSSSPTPGPDSPLPSPGPPPSPSPTPGPDSPLPSPGPDSPLPSPGPDPPLP 284 Score = 36.7 bits (81), Expect = 0.024 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXP-PXXPPXPPLXXXXXPPPPPPXP 975 P PP PP P P P P + P P P P PP P P P P P Sbjct: 171 PSPLPP-PPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGP 223 Score = 36.7 bits (81), Expect = 0.024 Identities = 19/53 (35%), Positives = 20/53 (37%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P PP P P P P + P P P P P PP P P P P Sbjct: 198 PLPLPGPPPSPSPTPGPDSPLP---SPGPDSPLPLPGPPPSSSPTPGPDSPLP 247 Score = 35.9 bits (79), Expect = 0.041 Identities = 21/63 (33%), Positives = 22/63 (34%), Gaps = 1/63 (1%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXP-PXPXPXXPXXPPPXP 965 P LP+ P P PP P P PPP P P P P P P P P Sbjct: 212 PGPDSPLPSPGPDSPLPLPGPPPSSSPTPGPDSPLPSPGPPPSPSPTPGPDSP-LPSPGP 270 Query: 966 PXP 974 P Sbjct: 271 DSP 273 Score = 35.9 bits (79), Expect = 0.041 Identities = 21/57 (36%), Positives = 22/57 (38%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAX-PPXGXXPXPXPPXXPPXP-PLXXXXXP-PPPPPXPP 978 P P PP P P P + P G P P P P P P P P P P PP Sbjct: 226 PLPLPGPPPSSSPTPGPDSPLPSPGPPPSPSPTPGPDSPLPSPGPDSPLPSPGPDPP 282 Score = 35.5 bits (78), Expect = 0.054 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P P P P P P + P P P PP P P P P P P Sbjct: 175 PPPPSPSPTPGPDSPLP-SPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPDSP 226 Score = 35.5 bits (78), Expect = 0.054 Identities = 19/55 (34%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = +1 Query: 817 PXXXPPXPPP--PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P P P P P P P + P P P P PL PP P P P Sbjct: 205 PPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSSSPTPGPDSPLPSPGPPPSPSPTP 259 Score = 35.1 bits (77), Expect = 0.072 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P P P PP P P P PP P P P P P P Sbjct: 221 PGPDSPLPLPGPPPSSSPTPGPDSPLPSPGPPPSPSPTPGPDSPLPSPGPDSP 273 Score = 33.9 bits (74), Expect = 0.17 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P P P P + P P P PP P P P PP P Sbjct: 208 PSPTPGPDSPLP-SPGPDSPLPLPGPPPSSSPTPGPDSPLPSPGPPPSP 255 Score = 32.7 bits (71), Expect = 0.38 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 844 PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP P P P P P P P P P P P P PP Sbjct: 161 PPLPPPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPP 205 Score = 32.7 bits (71), Expect = 0.38 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P P P P P P P P P PL PP P P Sbjct: 193 PGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSSSPTP 240 Score = 31.9 bits (69), Expect = 0.67 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXP-PXPP 977 PT P P P PP P P P P P P P P P P P P Sbjct: 210 PTPGPDSPLPSPGPDSPLPLPGPPPSSS--PTPGPDSPLPSPGPPPSPSPTPGPDSP 264 Score = 31.9 bits (69), Expect = 0.67 Identities = 20/64 (31%), Positives = 20/64 (31%), Gaps = 2/64 (3%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRX-PPXXXXXXPXPPPXPPXPXPXXPXXPP-PX 962 P LP P P P P PP P P P P P P P P Sbjct: 221 PGPDSPLPLPGPPPSSSPTPGPDSPLPSPGPPPSPSPTPGPDSPLPSPGPDSPLPSPGPD 280 Query: 963 PPXP 974 PP P Sbjct: 281 PPLP 284 Score = 31.5 bits (68), Expect = 0.88 Identities = 26/84 (30%), Positives = 28/84 (33%), Gaps = 1/84 (1%) Frame = +2 Query: 719 SRDDAEFLPXXXXXXXXLXEXLTTXXXTHSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXP 898 SR FLP L L + S + P P P P P P PPP P Sbjct: 131 SRLSPNFLPLRYLLVAVLL--LLSVIVLWSSDPPLPPPPPPYPSPL------PPPPSPSP 182 Query: 899 XXXP-PXXPXPXPSXPXXXPPXPP 967 P P P P P P PP Sbjct: 183 TPGPDSPLPSPGPDSPLPLPGPPP 206 Score = 31.5 bits (68), Expect = 0.88 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 1/49 (2%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXP-PXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P P P P P P P P P P P PP P P P Sbjct: 240 PGPDSPLPSPGPPPSPSPTPGPDSPLPSPGPDSPLPSPGPDPPLPSPGP 288 Score = 31.5 bits (68), Expect = 0.88 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXP 935 P PP P P P P P P P PP P P Sbjct: 245 PLPSPGPPPSPSPTPGPDSPLPSPGPDSPLPSPGPDPPLPSP 286 Score = 29.1 bits (62), Expect = 4.7 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 PT P P PP P P P P P P P PP P P Sbjct: 238 PTPGPDSPLPSPGPPPSPS----PTPGPDSPLPSPGPDSPLPSPGPDPPLPSPGP 288 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/53 (30%), Positives = 16/53 (30%), Gaps = 3/53 (5%) Frame = +2 Query: 818 PPPXPXXP---PPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 P P P P P P PPP P P P P P PP Sbjct: 182 PTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPP 234 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 51.2 bits (117), Expect = 1e-06 Identities = 23/49 (46%), Positives = 24/49 (48%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PP P PPP P P + PP P P P PP PP P PPPP P Sbjct: 63 PPPPQTPPPPPPPQSLPPPS--PSPEPEHYPP-PPYHHYITPSPPPPRP 108 Score = 46.4 bits (105), Expect = 3e-05 Identities = 28/65 (43%), Positives = 28/65 (43%), Gaps = 3/65 (4%) Frame = +1 Query: 784 DYLXLYSLXQXPXXXPPXPPP---PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXP 954 DYL L Q P PP PPP PPP P P P P P P PP P Sbjct: 58 DYLPLPPPPQTP---PPPPPPQSLPPPSPSP---EPEHYPPPPYHHYITPSPPPPRPLPP 111 Query: 955 PPPPP 969 PPPPP Sbjct: 112 PPPPP 116 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPP-----XPPXPXPXXPXXPPPXPP 968 PP PPPPP P PPP P P P P PPP PP Sbjct: 65 PPQTPPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPPPPP 116 Score = 39.1 bits (87), Expect = 0.004 Identities = 22/63 (34%), Positives = 22/63 (34%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P L LP PP PPPPP P P PP P P P PP Sbjct: 56 PEDYLPLPPPPQTPP--PPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPP 113 Query: 969 XPP 977 PP Sbjct: 114 PPP 116 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 P P P P P PP P P P PP P PPPP Sbjct: 50 PAPSPEPEDYLPLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPPP 94 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPX--PPXPXPXXPXXPPP 959 P P P PP P PP PP P P PPP Sbjct: 52 PSPEPEDYLPLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPP 93 Score = 29.9 bits (64), Expect = 2.7 Identities = 19/63 (30%), Positives = 19/63 (30%), Gaps = 7/63 (11%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPP-------PXPPXPXPXXPXXPPPXPP 968 P P P PP PP P P P PP P PPP P Sbjct: 50 PAPSPEPEDYLPLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPL 109 Query: 969 XPP 977 PP Sbjct: 110 PPP 112 Score = 29.9 bits (64), Expect = 2.7 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +1 Query: 847 PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP---PXPPF 981 P P P P P P PP PP P P P P P PP+ Sbjct: 50 PAPSPEPEDYLPLPPPPQTPPP--PPPPQSLPPPSPSPEPEHYPPPPY 95 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +2 Query: 875 PPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 P P P PP P P P PP P P Sbjct: 54 PEPEDYLPLPPPPQTPPPPPPPQSLPPPSPSPEP 87 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/53 (47%), Positives = 25/53 (47%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GGGGGG GG GG GG G G GG G GGGG G G G Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKGKGREGRG 122 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/49 (46%), Positives = 23/49 (46%) Frame = -3 Query: 962 GGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG G GG GG GG G G GG G G GGGGGG G G Sbjct: 60 GGSGSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWG 108 Score = 48.0 bits (109), Expect = 1e-05 Identities = 24/53 (45%), Positives = 24/53 (45%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GGGGGG GG GG GG G G GG G GGGG G G Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKGKGREG 120 Score = 46.0 bits (104), Expect = 4e-05 Identities = 24/51 (47%), Positives = 24/51 (47%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXG 830 G GG GG GGG G G G GG GGG G GG GGGG G Sbjct: 68 GWGGGGG-GGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKGKG 117 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGG 837 GG G GG GG GG G G GG G G GGGGGG Sbjct: 60 GGSGSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGG 103 Score = 39.5 bits (88), Expect = 0.003 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Frame = -2 Query: 966 GGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGX---XGXGGG 817 GG G G G G G GG G GGG GGGGG G GGG Sbjct: 60 GGSGSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGG 112 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -3 Query: 911 GGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXW 810 GG G GG G G GGGGGG GG G W Sbjct: 60 GGSGSYRWGWGGGGGGGGGGGGGGGGGGGGGGGW 93 Score = 37.1 bits (82), Expect = 0.018 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXG 830 GG G G G G G GG GGG G GG GGGGG G Sbjct: 60 GGSGSYRWGWGGGGGGGGGGGGGGGG-----GGGGGGGWGWGGGGGGGG 103 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGG 840 G GGGGGG GG G G G G A G G G Sbjct: 96 GGGGGGGGWYKWGCGGGGKGKGREGRGEFVKREYAECKGRGKCSG 140 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 50.0 bits (114), Expect = 2e-06 Identities = 23/63 (36%), Positives = 26/63 (41%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P + ++ P PP PPPP PP P PPP P P P P PP P Sbjct: 27 PPSHISPPPPPFSPPHH-PPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPPPHVLP 85 Query: 969 XPP 977 PP Sbjct: 86 PPP 88 Score = 47.2 bits (107), Expect = 2e-05 Identities = 23/53 (43%), Positives = 24/53 (45%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PP PPP P P P PP P P P PP P + PPPP P P Sbjct: 47 PHFSPPHQPPPSPYPHPHPPPPS---PYPHPHQPPPPPHVLP---PPPPTPAP 93 Score = 46.4 bits (105), Expect = 3e-05 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PPP PPPP PPP P PP P P P P P P P Sbjct: 25 PPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQP 77 Score = 46.4 bits (105), Expect = 3e-05 Identities = 25/57 (43%), Positives = 25/57 (43%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP---PPXPP 978 P PP PPPP P PP P P PP PP P PPPP PP PP Sbjct: 36 PPFSPPHHPPPPHFSPPHQPPP-SPYPHPHPP--PPSPYPHPHQPPPPPHVLPPPPP 89 Score = 46.0 bits (104), Expect = 4e-05 Identities = 28/68 (41%), Positives = 28/68 (41%), Gaps = 14/68 (20%) Frame = +1 Query: 817 PXXXPPXP----PPPPPX------PXPXAXPPXGXXPXPXP-PXXPPXPPLXXXXXPPPP 963 P PP P PPPPP P P PP P P P P PP P PPPP Sbjct: 21 PSPVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPP 80 Query: 964 P---PXPP 978 P P PP Sbjct: 81 PHVLPPPP 88 Score = 43.2 bits (97), Expect = 3e-04 Identities = 24/68 (35%), Positives = 26/68 (38%), Gaps = 4/68 (5%) Frame = +1 Query: 784 DYLXLYSLXQXPXXXPPXPPPPP----PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXX 951 +Y YS P PPPP P P P + P P PP PP P Sbjct: 6 EYFPYYSPPSHQHPLPSPVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSP-YPHPH 64 Query: 952 PPPPPPXP 975 PPPP P P Sbjct: 65 PPPPSPYP 72 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXX-PPXPPLXXXXXPPPPPPXPPF 981 P P PPPP PP P PP PP P P PPP P+ Sbjct: 21 PSPVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPY 71 Score = 37.9 bits (84), Expect = 0.010 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP 959 P PP PPP P PP P PP PP P P P P Sbjct: 45 PPPHFSPPHQPPPSPYPHP-HPPPPSPYPHPHQPPPPPHVLPPPPPTPAP 93 Score = 33.5 bits (73), Expect = 0.22 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Frame = +2 Query: 824 PXPXXPPPPPXXXXXXRPPPXXXXPXXXPP---XXPXPXPSXPXXXPPXPPXXP 976 P P PPPP PPP P PP P P P P PP P Sbjct: 19 PLPSPVPPPPSHISP--PPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSP 70 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 50.0 bits (114), Expect = 2e-06 Identities = 28/67 (41%), Positives = 31/67 (46%), Gaps = 1/67 (1%) Frame = +1 Query: 781 TDYLXLYSLXQXPXXXP-PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP 957 T+Y +YS P P PPPPP P A PP P PP P PP+ PP Sbjct: 34 TNYQPIYSPPPPPYRSPVTIPPPPPVYSRPVAFPPPPPIYSPPPPPIYP-PPI---YSPP 89 Query: 958 PPPPXPP 978 PPP PP Sbjct: 90 PPPIYPP 96 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 4/60 (6%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXX-RXPPXXXXXXPXPPPXPPXP---XPXXPXXPPPXPPXPP 977 P P PPPPP PP P PPP P P P P PPP PP Sbjct: 44 PPPYRSPVTIPPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPP 103 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P P PPPPP PP PPP P P P PPP P PP Sbjct: 57 PPVYSRPVAFPPPPPIYSPP-PPPIYPPPIYSPPPPPIYPPPI--YSPPPTPISPP 109 Score = 37.9 bits (84), Expect = 0.010 Identities = 22/54 (40%), Positives = 23/54 (42%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP P P P PP P PP P PP+ PPP P PP Sbjct: 63 PVAFPPPPPIYSPPPPPIYPPP--IYSPPPPPIYP--PPI---YSPPPTPISPP 109 Score = 36.7 bits (81), Expect = 0.024 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 6/63 (9%) Frame = +3 Query: 807 LPTXXXXPPXXPPPPP----XXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP--XPP 968 L T P PPPP PP PPP P P P PPP PP Sbjct: 30 LQTTTNYQPIYSPPPPPYRSPVTIPPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPP 89 Query: 969 XPP 977 PP Sbjct: 90 PPP 92 Score = 36.3 bits (80), Expect = 0.031 Identities = 21/61 (34%), Positives = 23/61 (37%), Gaps = 3/61 (4%) Frame = +1 Query: 796 LYSLXQXPXXXPPX--PPPPPPXPXP-XAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 +YS P PP PPPPP P P + PP P P P PPP Sbjct: 72 IYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPPTPISPPPKVHHPAPQAQKAFYYRQSPPP 131 Query: 967 P 969 P Sbjct: 132 P 132 Score = 35.5 bits (78), Expect = 0.054 Identities = 24/72 (33%), Positives = 26/72 (36%), Gaps = 3/72 (4%) Frame = +2 Query: 770 LXEXLTTXXXTHSXNXPP---PXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSX 940 L + T +S PP P PPPP PPP P PP P P Sbjct: 29 LLQTTTNYQPIYSPPPPPYRSPVTIPPPPPVYSRPVAFPPPP---PIYSPPPPPIYPP-- 83 Query: 941 PXXXPPXPPXXP 976 P PP PP P Sbjct: 84 PIYSPPPPPIYP 95 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = +2 Query: 818 PPPXPXXPPPP--PXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP P PPP P PP P P P P P Sbjct: 69 PPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPP--PTPISPPPKVHHPAP 117 Score = 30.3 bits (65), Expect = 2.0 Identities = 20/58 (34%), Positives = 21/58 (36%), Gaps = 5/58 (8%) Frame = +1 Query: 817 PXXXPPXPP--PPP---PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PP PP PPP P P P + PP P P PPPP P Sbjct: 84 PIYSPPPPPIYPPPIYSPPPTPISPPPKVHHPAP-----QAQKAFYYRQSPPPPSGQP 136 Score = 28.7 bits (61), Expect = 6.2 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXP 935 P PP P PP PP PPP P P P Sbjct: 69 PPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPPTPISPPP 110 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 50.0 bits (114), Expect = 2e-06 Identities = 24/54 (44%), Positives = 24/54 (44%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GG GGG R G GG GG G G GG G GGG GG G G Sbjct: 96 GASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIG 149 Score = 50.0 bits (114), Expect = 2e-06 Identities = 26/57 (45%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGX---GXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG G GGGG G GG GG G G GG + G G GGG GG GG G Sbjct: 193 GGIGSGGGGTVGAGGRGSGGASGGGGTVGAGGRGSGGASGGVGVGGGAGGSGGGSVG 249 Score = 50.0 bits (114), Expect = 2e-06 Identities = 25/56 (44%), Positives = 25/56 (44%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 G GG GGG G G G GG GGG G GG G GGG GG VG Sbjct: 450 GAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVG 505 Score = 49.6 bits (113), Expect = 3e-06 Identities = 24/54 (44%), Positives = 24/54 (44%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GGGGGG G GG GG G GG G G G GGG GG G Sbjct: 450 GAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGG 503 Score = 48.0 bits (109), Expect = 1e-05 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 G GG GGG GG G GG G G GG G G GGG G GG Sbjct: 80 GAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGG 129 Score = 48.0 bits (109), Expect = 1e-05 Identities = 24/58 (41%), Positives = 24/58 (41%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 G G GG GGG G G GG GGG G GG GGG G GG G Sbjct: 149 GGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAG 206 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/60 (46%), Positives = 29/60 (48%), Gaps = 6/60 (10%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGG------GGGGXGGXXXG 816 GG GGGGGG G GG GG G G GG + G G GG GGGG GG G Sbjct: 64 GGGGGGGGGIGGSGGVGAGGGVGG-GAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGG 122 Score = 47.6 bits (108), Expect = 1e-05 Identities = 24/58 (41%), Positives = 24/58 (41%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 G G GG GGG G G G G GG G GG GGG G GG VG Sbjct: 78 GVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVG 135 Score = 47.6 bits (108), Expect = 1e-05 Identities = 27/57 (47%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Frame = -3 Query: 977 GGXGG--GGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGG-GGGXGGXXXG 816 GG GG GGGG GG G G G G GG G G GGG GGG GG G Sbjct: 454 GGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGG 510 Score = 47.6 bits (108), Expect = 1e-05 Identities = 26/56 (46%), Positives = 26/56 (46%), Gaps = 2/56 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGX--GGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG G GGGG GG GG GG G G G A G G GG G G GG G Sbjct: 482 GGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGRGSGGASGG 537 Score = 47.6 bits (108), Expect = 1e-05 Identities = 27/53 (50%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Frame = -3 Query: 977 GGXGGG-GGGXXXXXRGGXGG-XXGGXGXGXXPXGGXAXGXGXGGG-GGGXGG 828 GG GGG GGG RG GG GG G GG + G G GGG GGG GG Sbjct: 498 GGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGRGSGGASGGAGAGGGAGGGVGG 550 Score = 47.2 bits (107), Expect = 2e-05 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG G GGGG GG GG G G G G G G GGGG G G Sbjct: 59 GGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKG 112 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGG-GGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGG GGG G GG GG G G GG G GG GG G G Sbjct: 348 GGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASG 402 Score = 46.4 bits (105), Expect = 3e-05 Identities = 29/72 (40%), Positives = 29/72 (40%), Gaps = 6/72 (8%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGX------GXXXXXXGGXRXXXXXGGGGGXXGGXX 821 G GG GG GGG G G G GG GG G GG GGGG GG Sbjct: 62 GVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVG 121 Query: 820 XXVGRVSXAXGS 785 VG A GS Sbjct: 122 GGVGAGGGAGGS 133 Score = 46.4 bits (105), Expect = 3e-05 Identities = 24/54 (44%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGG-GGGXGGXXXG 816 G GGG GG GG G GG G G G G GGG GGG GG G Sbjct: 235 GVGGGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGG 288 Score = 46.4 bits (105), Expect = 3e-05 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGG-GGGXGGXXXG 816 GG GG GGG G GG G G G G G GGG GGG GG G Sbjct: 238 GGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVGG 292 Score = 46.4 bits (105), Expect = 3e-05 Identities = 23/54 (42%), Positives = 24/54 (44%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GGGGGG G GG GG G G + G G G GGG GG G Sbjct: 300 GAVGGGGGGSVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGG 353 Score = 46.0 bits (104), Expect = 4e-05 Identities = 24/58 (41%), Positives = 25/58 (43%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 G G GG GGG G G GG GGG G GG G GGG GG +G Sbjct: 94 GGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGA--GGSVGAGGGIGGGAGGAIG 149 Score = 46.0 bits (104), Expect = 4e-05 Identities = 26/55 (47%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGG-GGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGG GGG G GG GG G G GG G G GGG GG G G Sbjct: 430 GGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSG-GAGGGTGGSVGAGGG 483 Score = 45.6 bits (103), Expect = 5e-05 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGX-GGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGG GG GG GG GG G G GG G GG GG G G Sbjct: 280 GGVGGGVGGSVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGAGG 334 Score = 45.2 bits (102), Expect = 7e-05 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 G GG GGG GG G GG G G G G G GGG G GG Sbjct: 135 GAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGG 184 Score = 45.2 bits (102), Expect = 7e-05 Identities = 26/57 (45%), Positives = 26/57 (45%), Gaps = 3/57 (5%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGG--XGGXXGGXGXGXXPXGGXAXGXGXGGGGGG-XGGXXXG 816 GG GG GG GG GG GG G G G A G GGGGGG GG G Sbjct: 410 GGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRG 466 Score = 44.8 bits (101), Expect = 9e-05 Identities = 25/55 (45%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXR-GGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGG GG GG GG GG G G GG G G G G GG G G Sbjct: 138 GGIGGGAGGAIGGGASGGVGG--GGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVG 190 Score = 44.8 bits (101), Expect = 9e-05 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GG GG G GG GG G G G A G GG GG GG G Sbjct: 326 GGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVG 379 Score = 44.8 bits (101), Expect = 9e-05 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GG GGG GG GG GG G GG G G G GG GG G Sbjct: 423 GAGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTGG 476 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/58 (39%), Positives = 23/58 (39%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 G G GG G G G G GG GG G GG G GGG GG VG Sbjct: 306 GGGSVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVG 363 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/65 (36%), Positives = 24/65 (36%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRV 803 G GG GG GG G G G GG G GG GGGGG GG G Sbjct: 411 GVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGA 470 Query: 802 SXAXG 788 G Sbjct: 471 GGGTG 475 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GG GG GG GG GG G G GG G G GGG GG G Sbjct: 52 GAGGGASGGIGVGGGGGGGGGIGGSG-GVGAGGGVGGGAGGAIGGGASGGAGGG 104 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGG-GGGXGG 828 GG GG G GG GG GG G GG G GGG GGG GG Sbjct: 127 GGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGG 177 Score = 44.0 bits (99), Expect = 2e-04 Identities = 25/55 (45%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGX-GXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG G G GG GG G GG G G GG G G GG GGG GG G Sbjct: 311 GGGGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVG-GGVGGGVGGAVGG 364 Score = 44.0 bits (99), Expect = 2e-04 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGG-GGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGG GGG GG GG GG G GG G G G GG G G Sbjct: 340 GGVGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASG 394 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/55 (41%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGG-GGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GG GG GG GG GG G G G A G GG GG G G Sbjct: 356 GGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASG 410 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GGG GG G GG G G G GG G G G GG GG G Sbjct: 518 GAVGGGVGGAGRGSGGASGGAGAGGGAGGGVGGGANVGVGVGAGGSTGGGAAGG 571 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/56 (39%), Positives = 22/56 (39%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 G GG GGG G G G GG GG G G GGG GG VG Sbjct: 300 GAVGGGGGGSVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVG 355 Score = 43.6 bits (98), Expect = 2e-04 Identities = 27/62 (43%), Positives = 27/62 (43%), Gaps = 1/62 (1%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGX-GGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGR 806 G GG G GGG G G G GG GGG G GG GGGGG GG G Sbjct: 331 GAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAV---GGAVGGAVGGGGGGSVGGGGRGSGG 387 Query: 805 VS 800 S Sbjct: 388 AS 389 Score = 43.6 bits (98), Expect = 2e-04 Identities = 24/56 (42%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGX-GGXXGGXGXGXXPXGGXAXGXGXGGG-GGGXGGXXXG 816 G GG GG GG GG GG G G G G GGG GGG GG G Sbjct: 387 GASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGG 442 Score = 43.6 bits (98), Expect = 2e-04 Identities = 24/56 (42%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXG-GXAXGXGXGGG-GGGXGGXXXG 816 G GG GG GG G GG G G G G G GGG GGG GG G Sbjct: 391 GASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGG 446 Score = 43.2 bits (97), Expect = 3e-04 Identities = 26/68 (38%), Positives = 28/68 (41%), Gaps = 2/68 (2%) Frame = -1 Query: 982 GXGGXGGXGG-GXXGXXGXGXGGX-GGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 G GG GG GG G G G G GG GGG G R GG GG GG G Sbjct: 69 GGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGG 128 Query: 808 RVSXAXGS 785 + G+ Sbjct: 129 GAGGSVGA 136 Score = 43.2 bits (97), Expect = 3e-04 Identities = 25/57 (43%), Positives = 25/57 (43%), Gaps = 3/57 (5%) Frame = -3 Query: 977 GGXGGGGGGXXXXXR-GGXGGXXGGXGX--GXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGG GG GG GG G G G GG G G GGG GG G G Sbjct: 83 GGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGG 139 Score = 43.2 bits (97), Expect = 3e-04 Identities = 24/57 (42%), Positives = 24/57 (42%), Gaps = 3/57 (5%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXG---GXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GG GG GG G G GG G G GG G G GG G GG G Sbjct: 87 GGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGG 143 Score = 43.2 bits (97), Expect = 3e-04 Identities = 26/61 (42%), Positives = 26/61 (42%), Gaps = 7/61 (11%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGX-GXGXXPXGGXAXGXGXGGGGGGX------GGXXX 819 GG GGGG G GG GG GG G G G G G GGG GG GG Sbjct: 99 GGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGG 158 Query: 818 G 816 G Sbjct: 159 G 159 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/65 (36%), Positives = 25/65 (38%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRV 803 G G GG GGG G G G GG GG G GG G GG GG G+ Sbjct: 109 GRKGGGGAGGGVGGGVGAG-GGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKS 167 Query: 802 SXAXG 788 G Sbjct: 168 GGGAG 172 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/56 (42%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXG--GXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGG GG G G G GG G G G G GGGG G GG G Sbjct: 114 GGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGG 169 Score = 42.7 bits (96), Expect = 4e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 2/58 (3%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXG--GGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 GG GG GGG G G G GG G GG G GG G GGG GG VG Sbjct: 238 GGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGL----GGGVGGGVGGGVGGSVG 291 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 5/55 (9%) Frame = -3 Query: 977 GGXGGG-----GGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GGG GG GG GG GG G G GG G GGG G GG Sbjct: 434 GGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGG 488 Score = 42.7 bits (96), Expect = 4e-04 Identities = 26/61 (42%), Positives = 26/61 (42%), Gaps = 3/61 (4%) Frame = -1 Query: 982 GXGGXG--GXGGGXXGXXGXGXG-GXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXV 812 G GG G G GGG G G G G G GGG G GG G GGG G V Sbjct: 461 GGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRGAVGGAV 520 Query: 811 G 809 G Sbjct: 521 G 521 Score = 42.3 bits (95), Expect = 5e-04 Identities = 24/56 (42%), Positives = 25/56 (44%), Gaps = 2/56 (3%) Frame = -3 Query: 977 GGXGGG-GGGXXXXXRGGXGGXXGGX-GXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGG GGG G GG GG G GG + G G G GG GG G Sbjct: 272 GGLGGGVGGGVGGGVGGSVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGG 327 Score = 42.3 bits (95), Expect = 5e-04 Identities = 24/54 (44%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXG-GXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GG GG GG GG G G G G GG G G GG GG GG G Sbjct: 316 GSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVG-GGVGGAVGGAVGG 368 Score = 42.3 bits (95), Expect = 5e-04 Identities = 23/49 (46%), Positives = 23/49 (46%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 GG GGG GG GG G GG G G GG G G G GGG G Sbjct: 468 GGAGGGTGG--SVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRG 514 Score = 41.9 bits (94), Expect = 6e-04 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG G GGG GG G G G G G A G G GG GG G G Sbjct: 112 GGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGG 165 Score = 41.9 bits (94), Expect = 6e-04 Identities = 22/56 (39%), Positives = 22/56 (39%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 G GG GGG G G G G GG G G GGG G GG VG Sbjct: 135 GAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVG 190 Score = 41.9 bits (94), Expect = 6e-04 Identities = 22/53 (41%), Positives = 22/53 (41%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GG GG G GG GG G G G A G GG GG GG G Sbjct: 259 GASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVGGAVGGAVGGAVGGGGGGSVG 311 Score = 41.9 bits (94), Expect = 6e-04 Identities = 25/61 (40%), Positives = 25/61 (40%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRV 803 G GG G GGG G G G GG GG GG GGGGG GG G Sbjct: 263 GAGGNVGAGGGLGGGVGGGVGGGVGGS--VGGAVGGAVGGAVGGGGGGSVGGGGRGSGGA 320 Query: 802 S 800 S Sbjct: 321 S 321 Score = 41.9 bits (94), Expect = 6e-04 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 G GGGGGG G GG GG G G A G GG GG GG Sbjct: 368 GAVGGGGGGSVGGGGRGSGGASGGASGG---ASGGASGGASGGASGGVGG 414 Score = 41.9 bits (94), Expect = 6e-04 Identities = 25/65 (38%), Positives = 25/65 (38%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRV 803 G GG GG GGG G G GG GGG G G GG G GG G Sbjct: 485 GVGGGGGIGGGAGGGVG---GGVGGGVGGGVRGAVGGAVGGGVGGAGRGSGGASGGAGAG 541 Query: 802 SXAXG 788 A G Sbjct: 542 GGAGG 546 Score = 41.9 bits (94), Expect = 6e-04 Identities = 27/71 (38%), Positives = 27/71 (38%), Gaps = 5/71 (7%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGX-----GGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXX 818 G G GG GGG G G G G GGG G GG GGG G G Sbjct: 493 GGGAGGGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGRGSGGASGGAGAGGGAGGGVGGGA 552 Query: 817 XVGRVSXAXGS 785 VG A GS Sbjct: 553 NVGVGVGAGGS 563 Score = 41.5 bits (93), Expect = 8e-04 Identities = 24/54 (44%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGG-GGGXGGXXXG 816 G G G GG G GG GG G G GG G G GGG GG GG G Sbjct: 48 GVGAGAGGGASGGIGVGGGGGGGGGIGG--SGGVGAGGGVGGGAGGAIGGGASG 99 Score = 41.5 bits (93), Expect = 8e-04 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGG G GG GG G G GG G G GG GG G Sbjct: 168 GGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGGGGTVG 221 Score = 41.5 bits (93), Expect = 8e-04 Identities = 23/50 (46%), Positives = 24/50 (48%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GGGG RG GG GG G G G + G GGGG G GG Sbjct: 211 GGASGGGGTVGAGGRGS-GGASGGVGVGGG--AGGSGGGSVGGGGRGSGG 257 Score = 41.5 bits (93), Expect = 8e-04 Identities = 25/55 (45%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGG-XGGXXXG 816 GG G GGG GG GG GG G G A G GGGGGG GG G Sbjct: 265 GGNVGAGGGLGGGVGGGVGGGVGGSVGGAV---GGAVGGAVGGGGGGSVGGGGRG 316 Score = 41.5 bits (93), Expect = 8e-04 Identities = 25/58 (43%), Positives = 25/58 (43%), Gaps = 4/58 (6%) Frame = -3 Query: 977 GGXGGG--GGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGG--GXGGXXXG 816 GG GG GG GG GG GG G G G A G GG GG G GG G Sbjct: 287 GGSVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVGG 344 Score = 41.5 bits (93), Expect = 8e-04 Identities = 23/55 (41%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGG-XGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GG GGG GG GG GG G G G GGGG G GG G Sbjct: 337 GAGGGVGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGG 391 Score = 41.5 bits (93), Expect = 8e-04 Identities = 25/66 (37%), Positives = 25/66 (37%), Gaps = 2/66 (3%) Frame = -1 Query: 976 GGXGGXGGGXXGXX--GXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRV 803 GG GG GG G G G G GGG GG G GG GG VG Sbjct: 356 GGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASGGVGGA 415 Query: 802 SXAXGS 785 A GS Sbjct: 416 GGAGGS 421 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GGGG G G GG GG GG A G GG GG GG G Sbjct: 109 GRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKG 162 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXG--GXGXGXXPXGGXAXGXGXGGGGGGXGG 828 G GGG GG G GG G G G G GG G G G GG GG Sbjct: 165 GKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGG 216 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/58 (41%), Positives = 24/58 (41%), Gaps = 4/58 (6%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGX-GXGXXPXGGXAXGXGXGGG---GGGXGGXXXG 816 GG G GG GG GG GG G G GG G GG GGG GG G Sbjct: 223 GGRGSGGASGGVGVGGGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVGG 280 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/55 (41%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGG-XGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GG GGG GG GG GG G G G GGGG G GG G Sbjct: 269 GAGGGLGGGVGGGVGGGVGGSVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGG 323 Score = 41.1 bits (92), Expect = 0.001 Identities = 26/53 (49%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXG--GXAXGXGXGG--GGGGXG 831 GG G GGG GG GG GG G G G G A G G GG GGGG G Sbjct: 333 GGSVGAGGGVGGGVGGGVGGGVGG-GVGGAVGGAVGGAVGGGGGGSVGGGGRG 384 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/54 (40%), Positives = 23/54 (42%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GGGG G G GG GG G GG + G G GG GG G G Sbjct: 376 GSVGGGGRGSGGASGGASGGASGGASGG--ASGGASGGVGGAGGAGGSVGAGGG 427 Score = 41.1 bits (92), Expect = 0.001 Identities = 25/66 (37%), Positives = 25/66 (37%), Gaps = 1/66 (1%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXV-GR 806 G G GG G G G G G G G G GG G GGG GG V G Sbjct: 456 GGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRGA 515 Query: 805 VSXAXG 788 V A G Sbjct: 516 VGGAVG 521 Score = 40.7 bits (91), Expect = 0.001 Identities = 27/68 (39%), Positives = 27/68 (39%), Gaps = 2/68 (2%) Frame = -1 Query: 982 GXGGXGGXGG--GXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 G G GG GG G G G G GG GG GG GGG G GG VG Sbjct: 123 GVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAG--GGVGGGVG 180 Query: 808 RVSXAXGS 785 A GS Sbjct: 181 AGGGAGGS 188 Score = 40.7 bits (91), Expect = 0.001 Identities = 24/56 (42%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Frame = -3 Query: 977 GGXGGG-GGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGG-GGXGGXXXG 816 GG GGG G G G GG G G G GG G GGGG G GG G Sbjct: 173 GGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGGGGTVGAGGRGSG 228 Score = 40.7 bits (91), Expect = 0.001 Identities = 24/56 (42%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Frame = -3 Query: 977 GGXGG--GGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GG G GG GG G GG G G GG G G G GG GG G Sbjct: 183 GGAGGSVGAGGGIGSGGGGTVGA-GGRGSGGASGGGGTVGAGGRGSGGASGGVGVG 237 Score = 40.3 bits (90), Expect = 0.002 Identities = 25/61 (40%), Positives = 25/61 (40%), Gaps = 3/61 (4%) Frame = -1 Query: 982 GXGGXG-GXGGGXXGXXGXGXGGXG--GGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXV 812 G GG G GGG G G G GG G GG G GG G GGG G V Sbjct: 235 GVGGGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVGGAV 294 Query: 811 G 809 G Sbjct: 295 G 295 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGG-GGGXGGXXXG 816 GG GG G GG G GG G G G G G GG GG GG G Sbjct: 318 GGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVGGAVGGAVGG 372 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGG-XGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G GG GGG G G G GG GG G GG G GG GG Sbjct: 339 GGGVGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGG 391 Score = 40.3 bits (90), Expect = 0.002 Identities = 24/56 (42%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGX-GGXXGGXGXGXXPXGGXAXGXGXG-GGGGGXGGXXXG 816 GG G G GG GG GG GG G G A G G G GGG GG G Sbjct: 379 GGGGRGSGGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGG 434 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGX-GGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GG GG GG GG GG G GG G GGG GG G G Sbjct: 384 GSGGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVG 437 Score = 40.3 bits (90), Expect = 0.002 Identities = 25/66 (37%), Positives = 25/66 (37%), Gaps = 1/66 (1%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGX-GGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGR 806 G GG G GGG G G G GG GG G G GGGG GG G Sbjct: 417 GAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTGG 476 Query: 805 VSXAXG 788 A G Sbjct: 477 SVGAGG 482 Score = 39.9 bits (89), Expect = 0.003 Identities = 24/66 (36%), Positives = 24/66 (36%), Gaps = 1/66 (1%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXG-XGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGR 806 G GG G GGG G G GG GG G GG GG GG G G Sbjct: 129 GAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGS 188 Query: 805 VSXAXG 788 V G Sbjct: 189 VGAGGG 194 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 GG G GG G G GG GG G GG G GGG G VG Sbjct: 312 GGGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVGGAVG 367 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG G G GG G GG GG G G G G GGG G GG Sbjct: 525 GGAGRGSGGASGGA-GAGGGAGGGVGGGANVGVGVGAGGSTGGGAAGGGG 573 Score = 39.5 bits (88), Expect = 0.003 Identities = 25/65 (38%), Positives = 25/65 (38%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRV 803 G GG G GGG G G G GG G G G G R GGGG G G Sbjct: 174 GVGGGVGAGGGAGGSVGAG-GGIGSGGG--GTVGAGGRGSGGASGGGGTVGAGGRGSGGA 230 Query: 802 SXAXG 788 S G Sbjct: 231 SGGVG 235 Score = 39.5 bits (88), Expect = 0.003 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 1/59 (1%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGG-GGGXXGGXXXXVG 809 G G GG GG G G GG GG G GG GG GG GG VG Sbjct: 279 GGGVGGGVGGSVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGAGGSVG 337 Score = 39.5 bits (88), Expect = 0.003 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGG-GGGXXGG 827 G G GG GGG G G GG GG G GG GG GG GG Sbjct: 347 GGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGG 399 Score = 39.5 bits (88), Expect = 0.003 Identities = 25/68 (36%), Positives = 26/68 (38%), Gaps = 2/68 (2%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGG-XGXXXXXXGGXRXXXXXGGGGGXXGGXXXXV-G 809 G G GG GG G G GG GGG G GG G GG GG G Sbjct: 351 GGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASG 410 Query: 808 RVSXAXGS 785 V A G+ Sbjct: 411 GVGGAGGA 418 Score = 39.5 bits (88), Expect = 0.003 Identities = 25/66 (37%), Positives = 25/66 (37%), Gaps = 3/66 (4%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGG--XGXXXXXXGGXRXXXXXG-GGGGXXGGXXXXVGR 806 G GG GGG G G G GG GG G GG G GG G GG G Sbjct: 368 GAVGGGGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGG 427 Query: 805 VSXAXG 788 V G Sbjct: 428 VGGGVG 433 Score = 39.5 bits (88), Expect = 0.003 Identities = 25/59 (42%), Positives = 25/59 (42%), Gaps = 1/59 (1%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGX-GGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 G G GG GGG G G GG GGG G GG R GGG G G VG Sbjct: 429 GGGVGGGVGGGVGGAVGGAVGGAVGGGGG--GSVGGGGRGSGGAGGGTGGSVGAGGGVG 485 Score = 39.1 bits (87), Expect = 0.004 Identities = 26/72 (36%), Positives = 28/72 (38%), Gaps = 8/72 (11%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXX---GGXRXXXXXGGG-----GGXXGGXX 821 GG G GGG G G G GG GG G GG GGG GG GG Sbjct: 193 GGIGSGGGGTVGAGGRGSGGASGGGGTVGAGGRGSGGASGGVGVGGGAGGSGGGSVGGGG 252 Query: 820 XXVGRVSXAXGS 785 G V + G+ Sbjct: 253 RGSGGVGASGGA 264 Score = 39.1 bits (87), Expect = 0.004 Identities = 24/65 (36%), Positives = 24/65 (36%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRV 803 G G G GGG G G G G GG GG GG GG GG G V Sbjct: 241 GGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVGGAVG--GAV 298 Query: 802 SXAXG 788 A G Sbjct: 299 GGAVG 303 Score = 38.7 bits (86), Expect = 0.006 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 2/55 (3%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXG--XGGGGGGXGGXXXG 816 G GG GG GG G GG G GG G G G GG G GG G Sbjct: 162 GRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGG 216 Score = 38.7 bits (86), Expect = 0.006 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 2/60 (3%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGG--GGGXXGGXXXXVG 809 G G G GG G G GG GG GG GG GGG GG VG Sbjct: 382 GRGSGGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVG 441 Score = 38.7 bits (86), Expect = 0.006 Identities = 22/65 (33%), Positives = 22/65 (33%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRV 803 G G G GG G G G GG GG G GG GGG GG G Sbjct: 437 GGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGA 496 Query: 802 SXAXG 788 G Sbjct: 497 GGGVG 501 Score = 38.3 bits (85), Expect = 0.008 Identities = 24/66 (36%), Positives = 24/66 (36%), Gaps = 1/66 (1%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGG-GGGXXGGXXXXVGR 806 G GG G GGG G G G GG GG G G GG G G G G Sbjct: 209 GSGGASG-GGGTVGAGGRGSGGASGGVGVGGGAGGSGGGSVGGGGRGSGGVGASGGAGGN 267 Query: 805 VSXAXG 788 V G Sbjct: 268 VGAGGG 273 Score = 38.3 bits (85), Expect = 0.008 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGG-GGGXGGXXXG 816 GG GG G G GG GG G G G G GG GG GG G Sbjct: 322 GGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGG 376 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG GG G G G G G G GR GG G G GGG Sbjct: 495 GAGGGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGRGSGGASGGAGAGGGAGGG 547 Score = 37.9 bits (84), Expect = 0.010 Identities = 24/60 (40%), Positives = 24/60 (40%), Gaps = 1/60 (1%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGG-GXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGR 806 G G GG G G G G G GG GG G G GG GG G GG GR Sbjct: 54 GGGASGGIGVGGGGGGGGGIGGSGGVGAGGGV---GGGAGGAIGGGASGGAGGGGKGRGR 110 Score = 37.9 bits (84), Expect = 0.010 Identities = 24/70 (34%), Positives = 24/70 (34%), Gaps = 4/70 (5%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXG----GGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXX 815 G G GG GG G G GG G GG G GG G GG GG Sbjct: 178 GVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGGGGTVGAGGRGSGGASGGVGVG 237 Query: 814 VGRVSXAXGS 785 G GS Sbjct: 238 GGAGGSGGGS 247 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG G GG G G G GG GGG G G GGG GG Sbjct: 523 GVGGAGRGSGGASGGAGAG-GGAGGGVGGGANVGVGVGAGGSTGGGAAGGGG 573 Score = 37.5 bits (83), Expect = 0.013 Identities = 22/66 (33%), Positives = 23/66 (34%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRV 803 G G GG GG G G GG G G G G G GGG G G Sbjct: 137 GGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIG 196 Query: 802 SXAXGS 785 S G+ Sbjct: 197 SGGGGT 202 Score = 37.5 bits (83), Expect = 0.013 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGG-XGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G GG GGG G G GG GG G GG G GG GG Sbjct: 271 GGGLGGGVGGGVGGGVGGSVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGG 323 Score = 37.5 bits (83), Expect = 0.013 Identities = 23/67 (34%), Positives = 23/67 (34%), Gaps = 2/67 (2%) Frame = -1 Query: 982 GXGGX--GGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 G GG G GG G G G GG GG G G GG GG G G Sbjct: 285 GVGGSVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVGG 344 Query: 808 RVSXAXG 788 V G Sbjct: 345 GVGGGVG 351 Score = 37.5 bits (83), Expect = 0.013 Identities = 21/65 (32%), Positives = 21/65 (32%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRV 803 G G GGG G G G G GG G G GG G GG G V Sbjct: 363 GGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASGGVGGAGGAGGSV 422 Query: 802 SXAXG 788 G Sbjct: 423 GAGGG 427 Score = 37.1 bits (82), Expect = 0.018 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 1/66 (1%) Frame = -1 Query: 982 GXGGXGGXG-GGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGR 806 G G GG G GG G G G G G G G G GG GG G G Sbjct: 218 GTVGAGGRGSGGASGGVGVGGGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGG 277 Query: 805 VSXAXG 788 V G Sbjct: 278 VGGGVG 283 Score = 37.1 bits (82), Expect = 0.018 Identities = 26/64 (40%), Positives = 26/64 (40%), Gaps = 1/64 (1%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGG-GGXXGGXXXXVGRVS 800 GG GG GG G G G GG GGG G G GG GG GG GR S Sbjct: 410 GGVGGAGGAG-GSVGAG-GGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGS 467 Query: 799 XAXG 788 G Sbjct: 468 GGAG 471 Score = 36.7 bits (81), Expect = 0.024 Identities = 21/65 (32%), Positives = 21/65 (32%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRV 803 G G G GG G G GG GGG G GG G GG G V Sbjct: 283 GGGVGGSVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGAGGSVGAGGGV 342 Query: 802 SXAXG 788 G Sbjct: 343 GGGVG 347 Score = 36.7 bits (81), Expect = 0.024 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 G GG GG G G GG GG G GG G GGG G VG Sbjct: 395 GASGGASGGASGGASGGVGG-AGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVG 449 Score = 36.7 bits (81), Expect = 0.024 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 G GG GG G G G GG GG G GG G GG G VG Sbjct: 399 GASGGASGGASGGVG-GAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGGAVG 453 Score = 36.3 bits (80), Expect = 0.031 Identities = 15/28 (53%), Positives = 16/28 (57%) Frame = -3 Query: 911 GGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 G G G GG + G G GGGGGG GG Sbjct: 45 GSVGVGAGAGGGASGGIGVGGGGGGGGG 72 Score = 36.3 bits (80), Expect = 0.031 Identities = 24/56 (42%), Positives = 24/56 (42%), Gaps = 4/56 (7%) Frame = -1 Query: 982 GXGGX--GGXGGGXXGXXGXGXGGXGG--GXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG GG GGG G G G GG GG G G GG G GG GG Sbjct: 162 GRGGKSGGGAGGGVGGGVGAG-GGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGG 216 Score = 36.3 bits (80), Expect = 0.031 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 3/59 (5%) Frame = -1 Query: 976 GGXGGX--GGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGG-GGGXXGGXXXXVG 809 G GG GGG G G GG G G G G GG GGG GG VG Sbjct: 229 GASGGVGVGGGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVG 287 Score = 35.9 bits (79), Expect = 0.041 Identities = 23/54 (42%), Positives = 23/54 (42%), Gaps = 2/54 (3%) Frame = -1 Query: 982 GXGGXG-GXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGG-GGXXGG 827 G G G G G G G G GG GGG G GG GGG GG GG Sbjct: 43 GRGSVGVGAGAGGGASGGIGVGGGGGG-GGGIGGSGGVGAGGGVGGGAGGAIGG 95 Score = 35.9 bits (79), Expect = 0.041 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G G GGG G G G GGG G GG GGG GG Sbjct: 104 GGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGG 155 Score = 35.9 bits (79), Expect = 0.041 Identities = 24/66 (36%), Positives = 25/66 (37%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRV 803 G G G GGG G G G G GGG G GG GGGG G G Sbjct: 160 GKGRGGKSGGGAGGGVGGGVGA-GGGAGGSVGAGGG-----IGSGGGGTVGAGGRGSGGA 213 Query: 802 SXAXGS 785 S G+ Sbjct: 214 SGGGGT 219 Score = 35.5 bits (78), Expect = 0.054 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 G G G GG G G G G G G GG G GG G VG Sbjct: 314 GRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVGGAVGGAVG 371 Score = 34.7 bits (76), Expect = 0.095 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 4/57 (7%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGG----GGXXGXGGG 817 G GG GG G G G GG G GGG GGG GG GG Sbjct: 151 GASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGG 207 Score = 34.7 bits (76), Expect = 0.095 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 3/59 (5%) Frame = -1 Query: 976 GGXGGX-GGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGG--GGGXXGGXXXXVG 809 G GG GG G G GG GG G G GG GGG GG VG Sbjct: 387 GASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVG 445 Score = 34.7 bits (76), Expect = 0.095 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGG-GGGXGGXXXG 816 GG GG GG GG G GG G G G G GG GG GG G Sbjct: 406 GGASGGVGGAGGA--GGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGG 458 Score = 34.7 bits (76), Expect = 0.095 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRV 803 G G G G G G G G GG G GG G GG GG GR Sbjct: 471 GGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGRG 530 Query: 802 S 800 S Sbjct: 531 S 531 Score = 34.7 bits (76), Expect = 0.095 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG GG G G GG G G G GG G GG GG Sbjct: 517 GGAVGGGVGGAGRG-SGGASGGAGAGGGAGGGVGGGANVGVGVGAGGSTGGG 567 Score = 34.3 bits (75), Expect = 0.13 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 3/56 (5%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXG---GGGGXXGXGGG 817 G GG GG G G G GG G GG G GGGG GGG Sbjct: 327 GASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGG 382 Score = 33.1 bits (72), Expect = 0.29 Identities = 27/74 (36%), Positives = 28/74 (37%), Gaps = 8/74 (10%) Frame = -1 Query: 982 GXGGXGGXG----GGXXGXXGXGXGGXGGG---XGXXXXXXGGXRXXXXXGGG-GGXXGG 827 G G GG GG G G G GG GG G GG GGG GG GG Sbjct: 187 GSVGAGGGIGSGGGGTVGAGGRGSGGASGGGGTVGAGGRGSGGASGGVGVGGGAGGSGGG 246 Query: 826 XXXXVGRVSXAXGS 785 GR S G+ Sbjct: 247 SVGGGGRGSGGVGA 260 Score = 32.3 bits (70), Expect = 0.51 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 4/62 (6%) Frame = -1 Query: 982 GXGGXG--GXGGGXXGXXGXGXGGXGGG--XGXXXXXXGGXRXXXXXGGGGGXXGGXXXX 815 G G G G GG G G GG GG G G G GGG GG Sbjct: 376 GSVGGGGRGSGGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGG 435 Query: 814 VG 809 VG Sbjct: 436 VG 437 Score = 31.5 bits (68), Expect = 0.88 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -2 Query: 942 GXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGG 820 G G G G GG G GGG GGGGG G GG Sbjct: 45 GSVGVGAGAGGGASGGIGVGGGG-------GGGGGIGGSGG 78 Score = 31.5 bits (68), Expect = 0.88 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 4/62 (6%) Frame = -1 Query: 982 GXGGXG--GXGGGXXGXXGXGXGGXGGG--XGXXXXXXGGXRXXXXXGGGGGXXGGXXXX 815 G GG G G G G G GG GG G GG GG G GG Sbjct: 372 GGGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGG 431 Query: 814 VG 809 VG Sbjct: 432 VG 433 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Frame = -2 Query: 963 GXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXX-GGGGGXXGXGGGXL 811 G G G G G G GG G GGG G GGG G GG + Sbjct: 43 GRGSVGVGA-GAGGGASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAI 93 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 929 GXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G G G G G GG G G GGGGGG G G Sbjct: 43 GRGSVGVGAGAGGGASGGI--GVGGGGGGGGGIGGSGG 78 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 50.0 bits (114), Expect = 2e-06 Identities = 23/47 (48%), Positives = 23/47 (48%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PP P PPPP P P A PP PP PP PP PPPPP Sbjct: 59 PPPPSPPPPSPPPPACPP--------PPALPPPPPKKVSSYCPPPPP 97 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 2/26 (7%) Frame = +3 Query: 906 PPPXPPXPXPXXPXXPPP--XPPXPP 977 PPP PP P P P PPP PP PP Sbjct: 60 PPPSPPPPSPPPPACPPPPALPPPPP 85 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P+ PP PPPP PP PP PP P PP PP Sbjct: 53 PSCIQNPPPPSPPPPSPPPPACPP--------PPALPPPPPKKVSSYCPPPPP 97 Score = 31.9 bits (69), Expect = 0.67 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 895 PXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PP PP PP PP PP PP Sbjct: 60 PPPSPP--PPSPPPPACPPPPALPPPPP 85 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 901 PXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP P PPP P PP Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPPP 84 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 49.6 bits (113), Expect = 3e-06 Identities = 27/56 (48%), Positives = 28/56 (50%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXW 810 GG G GGGG GG GG GG G G GG A G G G GGG GG G + Sbjct: 126 GGGGYGGGGGGYGGSGGYGGGAGGYG-GSGGYGGGAGGYG-GNSGGGYGGNAAGGY 179 Score = 45.6 bits (103), Expect = 5e-05 Identities = 24/52 (46%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGG--XGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GGG GG GG GG G G G GG A G G GGG G G Sbjct: 154 GGYGGGAGGYGGNSGGGYGGNAAGGYGGSGAGGYGGDATGHGGAGGGYGSSG 205 Score = 44.8 bits (101), Expect = 9e-05 Identities = 26/68 (38%), Positives = 26/68 (38%), Gaps = 2/68 (2%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGX--GGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 G GG GG GGG G G G GG GG G GG G G G GG G Sbjct: 136 GYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGGSGAGGYGGDATGHG 195 Query: 808 RVSXAXGS 785 GS Sbjct: 196 GAGGGYGS 203 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/55 (43%), Positives = 25/55 (45%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXW 810 G G GGGG GG GG GG G GG G GGG GG GG G + Sbjct: 122 GGGFGGGGY-----GGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGY 171 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/55 (45%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPX-GGXAXGXGXGGGGGGXGGXXXG 816 GG GGG GG GG GG GG G GG A G G G GG GG G Sbjct: 141 GGYGGGAGGYGGS--GGYGGGAGGYGGNSGGGYGGNAAGGYGGSGAGGYGGDATG 193 Score = 42.3 bits (95), Expect = 5e-04 Identities = 24/60 (40%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Frame = -3 Query: 977 GGXGGGGG-GXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXWXSE 801 GG GG GG G GG GG GG G G GG + G G GG GG G + + Sbjct: 132 GGGGGYGGSGGYGGGAGGYGG-SGGYGGGAGGYGGNSGGGYGGNAAGGYGGSGAGGYGGD 190 Score = 40.7 bits (91), Expect = 0.001 Identities = 24/54 (44%), Positives = 24/54 (44%), Gaps = 2/54 (3%) Frame = -1 Query: 982 GXGGXGGXG--GGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG GG G GG G G G GG GGG G GG GG GG G Sbjct: 133 GGGGYGGSGGYGGGAGGYG-GSGGYGGGAGGYGGNSGGGYGGNAAGGYGGSGAG 185 Score = 38.7 bits (86), Expect = 0.006 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 4/56 (7%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXG--GXG--GGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG GG GGG G G G G G G GG G GG G G GG Sbjct: 126 GGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGG 181 Score = 37.9 bits (84), Expect = 0.010 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 2/51 (3%) Frame = -3 Query: 977 GGXGGG-GGGXXXXXRGGXGG-XXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 GG GG GGG GG GG GG G GG G G GG G G Sbjct: 161 GGYGGNSGGGYGGNAAGGYGGSGAGGYGGDATGHGGAGGGYGSSGGFGSSG 211 Score = 36.7 bits (81), Expect = 0.024 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 1/48 (2%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXG-XGXGGXGGGXGXXXXXXGGXRXXXXXGGGG 842 G G GG GGG G G G GG GG G GG GGG Sbjct: 123 GGFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGG 170 Score = 36.3 bits (80), Expect = 0.031 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 2/53 (3%) Frame = -1 Query: 982 GXGGXGG-XGGGXXGXXGXGXGGXG-GGXGXXXXXXGGXRXXXXXGGGGGXXG 830 G GG GG GGG G G GG G GG G GG GG G G Sbjct: 159 GAGGYGGNSGGGYGGNAAGGYGGSGAGGYGGDATGHGGAGGGYGSSGGFGSSG 211 Score = 35.9 bits (79), Expect = 0.041 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = -1 Query: 955 GGXXGXXGXGXGGXG-GGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 GG G G G GG G GG G GG GGG G GG Sbjct: 122 GGGFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGG 165 Score = 35.5 bits (78), Expect = 0.054 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXG-GXRXXXXXGGGGGXXGG 827 G G GG GG G G G GG GGG G G G G GG GG Sbjct: 122 GGGFGGGGYGGGGGGYG-GSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGG 173 Score = 34.7 bits (76), Expect = 0.095 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG G G G G G G GG GG GG G GG Sbjct: 154 GGYGGGAGGYGGNSGGGYGGNAAGGYGGSGAGGYGGDATGHGGAGGGYGSSGG 206 Score = 31.5 bits (68), Expect = 0.88 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -1 Query: 934 GXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRVSXAXG 788 G G GG GGG G G GG GG GG G G Sbjct: 124 GFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYG 172 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 GG G GG G GG GG G G G G G G G Sbjct: 180 GGSGAGGYGGDATGHGGAGGGYG--SSGGFGSSGNTYGEGSSASAGAVG 226 Score = 29.9 bits (64), Expect = 2.7 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG GG G G G G G G G G GG GG G G Sbjct: 129 GYGGGGGG-YGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYG 180 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 49.6 bits (113), Expect = 3e-06 Identities = 24/51 (47%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = +1 Query: 829 PPXPP-PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PP P PP A PP P PP PP PP PPPPP PP Sbjct: 6 PPYPPLPQPPSQNSLAPPPP---PPSLPPPVPPPPPSHQPYSYPPPPPPPP 53 Score = 46.4 bits (105), Expect = 3e-05 Identities = 26/68 (38%), Positives = 26/68 (38%), Gaps = 10/68 (14%) Frame = +1 Query: 805 LXQXPXXXPPXPPPPPP-XPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXP--------- 954 L Q P PPPPPP P P PP P PP PP P P Sbjct: 11 LPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPPPPHAYYQQGPHYPQFNQLQ 70 Query: 955 PPPPPXPP 978 PPPP PP Sbjct: 71 APPPPPPP 78 Score = 41.9 bits (94), Expect = 6e-04 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PP P P PP PPP P PP P P P PP PP P Sbjct: 6 PPYPPLPQPPSQNSLAPPPPP----PSLPPPVPPPPPSHQPYSYPPPPPPPP 53 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 PP P P P PP P P P PP PPP PP Sbjct: 6 PPYPPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPPP 52 Score = 35.9 bits (79), Expect = 0.041 Identities = 24/62 (38%), Positives = 24/62 (38%), Gaps = 8/62 (12%) Frame = +1 Query: 817 PXXXPPXPP-------PPPPXPXPXAXPPXG-XXPXPXPPXXPPXPPLXXXXXPPPPPPX 972 P PP PP PPPP P P A G P PP PP PPP P Sbjct: 30 PPPVPPPPPSHQPYSYPPPPPPPPHAYYQQGPHYPQFNQLQAPPPPP--PPSAPPPLVPD 87 Query: 973 PP 978 PP Sbjct: 88 PP 89 Score = 35.9 bits (79), Expect = 0.041 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = +3 Query: 831 PXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PPPPP + P PP PP P PPP P PP Sbjct: 46 PPPPPPPPHAYYQQGPHYPQFNQLQAPPPPP-----PPSAPPPLVPDPP 89 Score = 35.1 bits (77), Expect = 0.072 Identities = 19/54 (35%), Positives = 21/54 (38%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 +S PPP P PPP P PPP P PP P P + P P Sbjct: 18 NSLAPPPPPPSLPPPVP-------PPPPSHQPYSYPPPPPPPPHAYYQQGPHYP 64 Score = 34.7 bits (76), Expect = 0.095 Identities = 19/47 (40%), Positives = 22/47 (46%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 PP PP P P + P P PP PP P+ PPPPP P+ Sbjct: 6 PPYPPLPQPPSQ--NSLAPPPPPPSLPP--PV-----PPPPPSHQPY 43 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 48.8 bits (111), Expect = 5e-06 Identities = 28/71 (39%), Positives = 30/71 (42%), Gaps = 10/71 (14%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPP---PPXPXPXAXPPXGXXP----XPXPPXXPPXPPLXXXXXP 954 ++S P PP PPPP PP P PP P P PP P PP P Sbjct: 547 VHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPP 606 Query: 955 PP---PPPXPP 978 PP PPP PP Sbjct: 607 PPVHSPPPPPP 617 Score = 48.4 bits (110), Expect = 7e-06 Identities = 24/59 (40%), Positives = 26/59 (44%), Gaps = 4/59 (6%) Frame = +1 Query: 817 PXXXPPXP--PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP--PPPXPPF 981 P PP P PPPP P + PP P P P PP PP PPP PP P + Sbjct: 522 PVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVY 580 Score = 47.6 bits (108), Expect = 1e-05 Identities = 21/47 (44%), Positives = 22/47 (46%), Gaps = 3/47 (6%) Frame = +1 Query: 847 PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP---PPPPXPP 978 PPP P PP P P PP P PP+ PP PPPP PP Sbjct: 518 PPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPP 564 Score = 46.8 bits (106), Expect = 2e-05 Identities = 26/64 (40%), Positives = 27/64 (42%), Gaps = 10/64 (15%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAX----PPXGXXPXPXPPXXPPXPPLXXXXXP---PPPP--- 966 P PP PPPP P P PP P P PP P PP+ P PPPP Sbjct: 529 PVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHS 588 Query: 967 PXPP 978 P PP Sbjct: 589 PPPP 592 Score = 45.6 bits (103), Expect = 5e-05 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP---PXPP 978 PP P PP P PP P PP P PP PPPPP P PP Sbjct: 519 PPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPP 571 Score = 45.2 bits (102), Expect = 7e-05 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 5/59 (8%) Frame = +1 Query: 817 PXXXPPXPPP-----PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PP PPP P P PP P PP P PP PPPP PP Sbjct: 518 PPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPP 576 Score = 44.8 bits (101), Expect = 9e-05 Identities = 24/58 (41%), Positives = 25/58 (43%), Gaps = 5/58 (8%) Frame = +1 Query: 817 PXXXPPXPPP---PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXP--PPPPPXP 975 P P PPP PPP P P PP P PP P PP+ P PPPP P Sbjct: 545 PPVHSPPPPPVYSPPPPPPPVHSPPPPVF-SPPPPVYSPPPPVHSPPPPVHSPPPPAP 601 Score = 44.8 bits (101), Expect = 9e-05 Identities = 25/63 (39%), Positives = 27/63 (42%), Gaps = 8/63 (12%) Frame = +1 Query: 817 PXXXPPXP---PPPP---PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP--PPPX 972 P PP P PPPP P P + PP P P P P PP+ PPP PP Sbjct: 564 PVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPP 623 Query: 973 PPF 981 P F Sbjct: 624 PVF 626 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PPPP PP P P PP P P PPP PP Sbjct: 522 PVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPP 577 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/55 (40%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXP-XAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P PP P P + PP P P PP P PP+ PPP PP Sbjct: 585 PVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPV----FSPPPSQSPP 635 Score = 41.9 bits (94), Expect = 6e-04 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P PP P PP P P PP PP PPPP PP Sbjct: 578 PVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPP--PVYSPPPPVFSPP 629 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/67 (32%), Positives = 23/67 (34%), Gaps = 4/67 (5%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPP----PPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPP 956 P A + P P PPP PP PP P PPP P P PP Sbjct: 519 PPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPP 578 Query: 957 PXPPXPP 977 P PP Sbjct: 579 VYSPPPP 585 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PPPP PP P P PP P P PP P PP Sbjct: 571 PVFSPPPPVYSPPPPVHSPP--PPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPP 624 Score = 39.1 bits (87), Expect = 0.004 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 2/57 (3%) Frame = +3 Query: 810 PTXXXXPPXX--PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P PP PPPPP PP P P PP P P PP PP P Sbjct: 546 PVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPP-PPAP 601 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PPPP PP P PP P P P PPP PP Sbjct: 578 PVYSPPPPVHSPPPPVHSP---PPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPP 630 Score = 38.7 bits (86), Expect = 0.006 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 6/62 (9%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPP---PXPPXPXPXXPXXPPPXP---PX 971 P PP PPP PP P PP P PP P P PP P P Sbjct: 538 PPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPP 597 Query: 972 PP 977 PP Sbjct: 598 PP 599 Score = 38.3 bits (85), Expect = 0.008 Identities = 23/61 (37%), Positives = 23/61 (37%), Gaps = 6/61 (9%) Frame = +3 Query: 813 TXXXXPPXXP---PPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXP---PXP 974 T PP P PPPP PP P PP P P P PPP P P P Sbjct: 513 TKRRSPPPAPVNSPPPPVYSPP--PPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPP 570 Query: 975 P 977 P Sbjct: 571 P 571 Score = 38.3 bits (85), Expect = 0.008 Identities = 24/66 (36%), Positives = 25/66 (37%), Gaps = 13/66 (19%) Frame = +1 Query: 817 PXXXPPXPPP----PPP--XPXPXAXPPXGXXPXPXPP-------XXPPXPPLXXXXXPP 957 P PP PPP PPP P P PP P P PP PP P+ PP Sbjct: 608 PVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPPKINSPPVQSPPPAPVEKKETPP 667 Query: 958 PPPPXP 975 P P Sbjct: 668 AHAPAP 673 Score = 37.9 bits (84), Expect = 0.010 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PPP PPPP PP P P P P P PP P P Sbjct: 544 PPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSP 596 Score = 37.9 bits (84), Expect = 0.010 Identities = 23/60 (38%), Positives = 23/60 (38%), Gaps = 7/60 (11%) Frame = +1 Query: 817 PXXXPPXP---PPPPP----XPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PP P PPPPP P P PP P P PP PP PPP P Sbjct: 601 PVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSP-PVVYSPPPRPPKINSPPVQSPPPAP 659 Score = 36.7 bits (81), Expect = 0.024 Identities = 21/58 (36%), Positives = 22/58 (37%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 +S PPP PPPP PPP P PP P P P PP P P Sbjct: 531 YSPPPPPPPVHSPPPP----VHSPPPPPVYSP--PPPPPPVHSPPPPVFSPPPPVYSP 582 Score = 36.3 bits (80), Expect = 0.031 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PPP PP PPP PP P P PP PP Sbjct: 584 PPVHSPPPPVHSPPPPAPVHSPPPPVH----SPPPPPPVYSPPPPVFSPPPSQSPP 635 Score = 36.3 bits (80), Expect = 0.031 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 8/61 (13%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXP-----PP---XPPXPXPXXPXXPPPXP 965 P PP PPPP PP P P PP PP P PPP P Sbjct: 585 PVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRP 644 Query: 966 P 968 P Sbjct: 645 P 645 Score = 35.5 bits (78), Expect = 0.054 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P P P P PP PP PP PPP PP Sbjct: 592 PVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPP 645 Score = 35.1 bits (77), Expect = 0.072 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PPP PPP PP PP P P P PP P P Sbjct: 576 PPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSP 628 Score = 34.7 bits (76), Expect = 0.095 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP--PPPXPP 978 P P P + PP P P PP PP PPP PP PP Sbjct: 503 PDDPYDQSPVTKRRSPPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPP 554 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 3/59 (5%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 P P P R PP P PP P P P PPP PP PP Sbjct: 496 PPKESPQPDDPYDQSPVTKRRSPPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPP 554 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 4/54 (7%) Frame = +2 Query: 818 PPPXPXXPPP----PPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PPP PPP PP PPP P PP P P PP Sbjct: 582 PPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPP 635 Score = 34.3 bits (75), Expect = 0.13 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PPP P PPPP PPP P PP P PS PP P Sbjct: 597 PPPAPVHSPPPPVHSPP--PPPPVYSP---PPPVFSPPPSQSPPVVYSPPPRP 644 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PPPP PP PP P P P P PP Sbjct: 601 PVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPPKINSPPVQSPP 656 Score = 31.9 bits (69), Expect = 0.67 Identities = 19/62 (30%), Positives = 20/62 (32%), Gaps = 3/62 (4%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPP---PPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP 959 P A + P P PPP PP P PPP PP PPP Sbjct: 598 PPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPPKINSPPVQSPPP 657 Query: 960 XP 965 P Sbjct: 658 AP 659 Score = 31.1 bits (67), Expect = 1.2 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 4/59 (6%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPP---XXXXXXRPPPXXXXP-XXXPPXXPXPXPSXPXXXPPXPP 967 HS P P PPPPP PPP P PP P S P PP P Sbjct: 603 HSPPPPVHSP--PPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPPKINSPPVQSPPPAP 659 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P P P P P P P P P L P P P P Sbjct: 443 PTTPVQKPSPVPTT-PVQKPSPVPTTPVHEPSPVLATPVDKPSPVPSRP 490 Score = 28.7 bits (61), Expect = 6.2 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 2/56 (3%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP--PPXPP 978 P P P PP P P P PP P PPPP P PP Sbjct: 485 PVPSRPVQKPQPPKESPQPDDPYDQSPVTKRRSPPPAP----VNSPPPPVYSPPPP 536 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 48.4 bits (110), Expect = 7e-06 Identities = 21/56 (37%), Positives = 22/56 (39%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 Q P PP P PP P PP P P PP P+ PP PP PP Sbjct: 153 QPPTYKPPTSPVKPPTTTPPVKPPTTTPPVQPPTYNPPTTPVKPPTAPPVKPPTPP 208 Score = 39.1 bits (87), Expect = 0.004 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP PP P P PP P PP PP PP PP Sbjct: 96 PIKLPPVQPPTYKPPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPP 146 Score = 37.9 bits (84), Expect = 0.010 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 2/58 (3%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP--XPPLXXXXXPPPPPPXPP 978 Q P PP PP P P P PP PP PP P PP PP Sbjct: 148 QSPPVQPPTYKPPTSPVKPPTTTPPVKPPTTTPPVQPPTYNPPTTPVKPPTAPPVKPP 205 Score = 35.5 bits (78), Expect = 0.054 Identities = 20/60 (33%), Positives = 21/60 (35%), Gaps = 4/60 (6%) Frame = +1 Query: 802 SLXQXPXXXPPXPPP--PPPXPXPXAXPPXGXXPXPXPPXXPP--XPPLXXXXXPPPPPP 969 +L P P PP PP P PP P PP PP PP P PP Sbjct: 63 TLPTTPIKPPTTKPPVKPPTIPVTPVKPPVSTPPIKLPPVQPPTYKPPTPTVKPPSVQPP 122 Score = 35.1 bits (77), Expect = 0.072 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P P P PP P P PP P P PP P Sbjct: 34 PTPTLPSPSPATKPPSPALKPPTPSYKPPTLPTTPIKPPTTKPPVKP 80 Score = 35.1 bits (77), Expect = 0.072 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 2/58 (3%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP--XPPLXXXXXPPPPPPXPP 978 Q P PP P PP P P P PP PP PP P PP P Sbjct: 120 QPPTYKPPTPTVKPPTTSPVKPPT--TPPVQSPPVQPPTYKPPTSPVKPPTTTPPVKP 175 Score = 35.1 bits (77), Expect = 0.072 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXPP 978 P PP P P P P P PP P PP PP PP PP Sbjct: 129 PTVKPPTTSPVKPPTTPPVQSPPVQPPTYKPPTSPVKPPTTTPPVKPPTTTPPVQPP 185 Score = 34.7 bits (76), Expect = 0.095 Identities = 18/59 (30%), Positives = 19/59 (32%) Frame = +1 Query: 802 SLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 +L P P P P P P PP P P P PP PP P P Sbjct: 29 ALVSLPTPTLPSPSPATKPPSPALKPPTPSYKPPTLPTTPIKPPTTKPPVKPPTIPVTP 87 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP--PPPXP 975 P PP P P P P + PP P P PP P + PP PP P Sbjct: 76 PPVKPPTIPVTPVKP-PVSTPPIKLPPVQPPTYKPPTPTVKPPSVQPPTYKPPTP 129 Score = 33.1 bits (72), Expect = 0.29 Identities = 18/58 (31%), Positives = 19/58 (32%), Gaps = 3/58 (5%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXP---PXXPXPXPSXPXXXPPXPPXXPXS 982 PP P P PP +PP P P P P P PP P P S Sbjct: 61 PPTLPTTPIKPPTTKPPVKPPTIPVTPVKPPVSTPPIKLPPVQPPTYKPPTPTVKPPS 118 Score = 33.1 bits (72), Expect = 0.29 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 6/56 (10%) Frame = +1 Query: 829 PPXPPP--PPPXPXPXAXPPXG--XXPXPXPPXXPP--XPPLXXXXXPPPPPPXPP 978 PP PP PP P PP P PP PP PP+ PP P P Sbjct: 141 PPTTPPVQSPPVQPPTYKPPTSPVKPPTTTPPVKPPTTTPPVQPPTYNPPTTPVKP 196 Score = 32.7 bits (71), Expect = 0.38 Identities = 21/69 (30%), Positives = 22/69 (31%), Gaps = 6/69 (8%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPP---PPXXXXXRXPPXXXXXXPXPPPX---PPXPXPXXPXX 950 P T+P PP PP PP PP P P PP P P Sbjct: 77 PVKPPTIPVTPVKPPVSTPPIKLPPVQPPTYKPPTPTVKPPSVQPPTYKPPTPTVKPPTT 136 Query: 951 PPPXPPXPP 977 P PP P Sbjct: 137 SPVKPPTTP 145 Score = 32.7 bits (71), Expect = 0.38 Identities = 20/57 (35%), Positives = 22/57 (38%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP-XPPLXXXXXPP--PPPPXPP 978 P PP PP P P + P P P P PP P+ PP PP PP Sbjct: 100 PPVQPPTYKPPTPTVKPPSVQPPTYKP-PTPTVKPPTTSPVKPPTTPPVQSPPVQPP 155 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 4/57 (7%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP--XPPLXXXXXPPP--PPPXP 975 P PP P P P P PP P P PP PP+ PP PP P Sbjct: 57 PSYKPPTLPTTPIKP-PTTKPPVKPPTIPVTPVKPPVSTPPIKLPPVQPPTYKPPTP 112 Score = 31.5 bits (68), Expect = 0.88 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PP P PP P P P PP P P P P P Sbjct: 47 PPSPALKPPTPSYKPPTLPTTPIKPPTTKPPVKPPTIPVTPVKPPVSTP 95 Score = 31.5 bits (68), Expect = 0.88 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 5/59 (8%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXP---XPPXXPPXPPLXXXXXPPP--PPPXPP 978 P P PP P P PP P P P P PP PP PP P Sbjct: 101 PVQPPTYKPPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQPPTYKP 159 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/58 (29%), Positives = 18/58 (31%), Gaps = 2/58 (3%) Frame = +3 Query: 810 PTXXXXPPXXPPPP--PXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PT PP PP P + P P PP P PP P PP Sbjct: 110 PTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQPPTYKPPTSPVKPP 167 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/54 (33%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPX--PXAXPPXGXXPXPX-PPXXPPXPPLXXXXXPPPPPP 969 P PP P PP P P P P PP PP P+ P PP Sbjct: 43 PATKPPSPALKPPTPSYKPPTLPTTPIKPPTTKPPVKPPTIPVTPVKPPVSTPP 96 Score = 29.1 bits (62), Expect = 4.7 Identities = 17/52 (32%), Positives = 18/52 (34%), Gaps = 3/52 (5%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPP-XGXXPXPXPPXXPP--XPPLXXXXXPPPPPPXPP 978 P P PP P PP P P PP PP+ PP P P Sbjct: 65 PTTPIKPPTTKPPVKPPTIPVTPVKPPVSTPPIKLPPVQPPTYKPPTPTVKP 116 Score = 29.1 bits (62), Expect = 4.7 Identities = 19/67 (28%), Positives = 19/67 (28%), Gaps = 3/67 (4%) Frame = +2 Query: 785 TTXXXTHSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXP---XPXPSXPXXXP 955 T T S PP P PP P P PP P P P P Sbjct: 130 TVKPPTTSPVKPPTTPPVQSPPVQPPTYKPPTSPVKPPTTTPPVKPPTTTPPVQPPTYNP 189 Query: 956 PXPPXXP 976 P P P Sbjct: 190 PTTPVKP 196 Score = 28.7 bits (61), Expect = 6.2 Identities = 19/59 (32%), Positives = 20/59 (33%), Gaps = 3/59 (5%) Frame = +3 Query: 810 PTXXXXPPXXPP-PPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP--XPPXPP 977 PT PP P PP + PP PP P P P PP PP P Sbjct: 127 PTPTVKPPTTSPVKPPTTPPVQSPPVQPPTYK-PPTSPVKPPTTTPPVKPPTTTPPVQP 184 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 48.4 bits (110), Expect = 7e-06 Identities = 26/61 (42%), Positives = 26/61 (42%), Gaps = 7/61 (11%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPX---PXAXPPXGXXPXPXPPXXPPX--PPLXXXXXPPPP--PPXP 975 P PP P PPPP P P A P P PP PP PP P PP PP P Sbjct: 91 PVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPP 150 Query: 976 P 978 P Sbjct: 151 P 151 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXPPPP---PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PPP PP P P PP P PP PP PP P P PP P Sbjct: 110 PPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNP 166 Score = 46.0 bits (104), Expect = 4e-05 Identities = 28/88 (31%), Positives = 29/88 (32%) Frame = +3 Query: 714 PPPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXX 893 PPP T+P S P A P P PPPPP P Sbjct: 85 PPPTTIPVSPPPEPSPPPPLPTEAPPPAN---PVSSPPPESSPPPPPPTEAPPTTPITSP 141 Query: 894 XXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PP P P PP P PP Sbjct: 142 SPPTNPPPPPESPPSLPAPDPPSNPLPP 169 Score = 45.6 bits (103), Expect = 5e-05 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPX---PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PPPPPP P P P PP P PP PP P PP Sbjct: 114 PVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPP 170 Score = 44.0 bits (99), Expect = 2e-04 Identities = 24/59 (40%), Positives = 25/59 (42%), Gaps = 5/59 (8%) Frame = +1 Query: 817 PXXXPPXPP--PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXPP 978 P PP P PPP P + PP P P P P PP PPP PPP PP Sbjct: 73 PEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAP--PPANPVSSPPPESSPPPPPP 129 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/56 (37%), Positives = 22/56 (39%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 + P PP P P PP P PP P PP P PPL PP P P Sbjct: 65 ETPLSSPP-PEPSPPSP-SLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSP 118 Score = 40.3 bits (90), Expect = 0.002 Identities = 25/74 (33%), Positives = 27/74 (36%), Gaps = 15/74 (20%) Frame = +1 Query: 802 SLXQXPXXXPPXPPPPPPXPXP-------------XAXPPXGXXPXPXPPXXPPXPPLXX 942 SL P P PPP P P P + PP P P P PP P+ Sbjct: 81 SLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTPITS 140 Query: 943 XXXP--PPPPPXPP 978 P PPPPP P Sbjct: 141 PSPPTNPPPPPESP 154 Score = 39.1 bits (87), Expect = 0.004 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 9/59 (15%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP--XPPLXXXXXP----PPPP---PXPP 978 P PPPPP P P P P P PP PP P PPPP P PP Sbjct: 144 PTNPPPPPESPPSLPAPDPPSNPLPPPKLVPPSHSPPRHLPSPPASEIPPPPRHLPSPP 202 Score = 37.5 bits (83), Expect = 0.013 Identities = 23/70 (32%), Positives = 24/70 (34%), Gaps = 4/70 (5%) Frame = +2 Query: 785 TTXXXTHSXNXPPPXPXXPPPPPXXXXXXRPP----PXXXXPXXXPPXXPXPXPSXPXXX 952 TT + PP P PP PP P P PP P PS P Sbjct: 88 TTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTPITSPS-PPTN 146 Query: 953 PPXPPXXPXS 982 PP PP P S Sbjct: 147 PPPPPESPPS 156 Score = 37.5 bits (83), Expect = 0.013 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 3/56 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAX---PPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PP PP P P A PP P P P PP PPPP P Sbjct: 170 PKLVPPSHSPPRHLPSPPASEIPPPPRHLPSPPASERPSTPPSDSEHPSPPPPGHP 225 Score = 37.1 bits (82), Expect = 0.018 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P P P P P PP P P P PP P PPPP P Sbjct: 57 PAQSSPPPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPP----PEPSPPPPLP 105 Score = 37.1 bits (82), Expect = 0.018 Identities = 20/65 (30%), Positives = 21/65 (32%), Gaps = 2/65 (3%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXP--PPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPX 962 P L+ P PP PPP PP P P PP P P Sbjct: 64 PETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESS 123 Query: 963 PPXPP 977 PP PP Sbjct: 124 PPPPP 128 Score = 36.7 bits (81), Expect = 0.024 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 6/55 (10%) Frame = +1 Query: 829 PPXP---PPPPPXPXPXAXPPXGXXPXPXPPXXPPX---PPLXXXXXPPPPPPXP 975 PP P P PP P P P P PP P PP P P PP P Sbjct: 192 PPPPRHLPSPPASERPSTPPSDSEHPSPPPPGHPKRREQPPPPGSKRPTPSPPSP 246 Score = 35.9 bits (79), Expect = 0.041 Identities = 20/58 (34%), Positives = 22/58 (37%), Gaps = 2/58 (3%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPP--LXXXXXPPPPPPXPP 978 + P P P PP P P P P P PP P PP + PP P PP Sbjct: 131 EAPPTTPITSPSPPTNPPPPPESPPS-LPAPDPPSNPLPPPKLVPPSHSPPRHLPSPP 187 Score = 34.7 bits (76), Expect = 0.095 Identities = 22/65 (33%), Positives = 23/65 (35%), Gaps = 11/65 (16%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXP------XPXPPXXPPXPPLXXXXXPPP-----P 963 P PP P PPP P + P P P PP P PP PP P Sbjct: 158 PAPDPPSNPLPPPKLVPPSHSPPRHLPSPPASEIPPPPRHLPSPPASERPSTPPSDSEHP 217 Query: 964 PPXPP 978 P PP Sbjct: 218 SPPPP 222 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +1 Query: 850 PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP P + PP P P P P P PP P P PP Sbjct: 62 PPPETPLSSPPPEPSP-PSPSLTGPPPTTIPVSPPPEPSPPPP 103 Score = 32.7 bits (71), Expect = 0.38 Identities = 20/65 (30%), Positives = 22/65 (33%), Gaps = 2/65 (3%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPP--XPPXPXPXXPXXPPPX 962 P +T P+ PP P PP P P PPP PP P PP Sbjct: 134 PTTPITSPSPPTNPPPPPESPP-----SLPAPDPPSNPLPPPKLVPPSHSPPRHLPSPPA 188 Query: 963 PPXPP 977 PP Sbjct: 189 SEIPP 193 Score = 32.7 bits (71), Expect = 0.38 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 11/69 (15%) Frame = +3 Query: 804 TLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPX-------PPX--PXPXXPXXPP 956 T P PP PPPPP P P PPP PP P P PP Sbjct: 135 TTPITSPSPPTNPPPPPESPPS-LPAPDPPSNPLPPPKLVPPSHSPPRHLPSPPASEIPP 193 Query: 957 PX--PPXPP 977 P P PP Sbjct: 194 PPRHLPSPP 202 Score = 32.3 bits (70), Expect = 0.51 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 4/60 (6%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXP---XPPPXP-PXPXPXXPXXPPPXPPXPP 977 P P PPP PP P PPP P P P PPP P P Sbjct: 50 PPETTNTPAQSSPPPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAP 109 Score = 32.3 bits (70), Expect = 0.51 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Frame = +2 Query: 812 NXPPPXPXXPP-PPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 N PPP P P P PPP P PP PS P P PP Sbjct: 146 NPPPPPESPPSLPAPDPPSNPLPPPKLVPPSHSPPRH---LPSPPASEIPPPP 195 Score = 32.3 bits (70), Expect = 0.51 Identities = 18/59 (30%), Positives = 19/59 (32%), Gaps = 1/59 (1%) Frame = +3 Query: 804 TLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXP-PPXPPXPP 977 T P+ P PP P PP P PP P P P PP PP Sbjct: 209 TPPSDSEHPSPPPPGHPKRREQPPPPGSKRPTPSPPSPSDSKRPVHPSPPSPPEETLPP 267 Score = 31.9 bits (69), Expect = 0.67 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXPXS 982 PP P P PP PP P PP P P P P S Sbjct: 192 PPPPRHLPSPPASERPSTPPSDSEHPSPPPPGHPKRREQPPPPGSKRPTPSPPS 245 Score = 31.5 bits (68), Expect = 0.88 Identities = 17/52 (32%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPP-----XPPLXXXXXPPPPPPXPP 978 PP P + PP P P PP PP PPP P PP Sbjct: 50 PPETTNTPAQSSPPPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPP 101 Score = 31.5 bits (68), Expect = 0.88 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 10/60 (16%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXX----------PPXPPLXXXXXPPPPPPXPP 978 P PPP P PP P P PP PP PP PPP P P Sbjct: 217 PSPPPPGHPKRREQPPPPGSKRPTPSPPSPSDSKRPVHPSPPSPP--EETLPPPKPSPDP 274 Score = 31.5 bits (68), Expect = 0.88 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 1/56 (1%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPX-PPPXPPXPXPXXPXXPPPXPPXP 974 P PP P P P PP PP PP P P P P P Sbjct: 260 PPEETLPPPKPSPDPLPSNSSSPPTLLPPSSVVSPPSPPRKSVSGPDNPSPNNPTP 315 Score = 31.1 bits (67), Expect = 1.2 Identities = 27/99 (27%), Positives = 29/99 (29%), Gaps = 12/99 (12%) Frame = +3 Query: 714 PPPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXX--PPP------PPXXXXX 869 PPP P S + L + P PP PPP PP Sbjct: 148 PPPPESPPSLPAPDPPSNPLPPPKLVPPSHSPPRHLPSPPASEIPPPPRHLPSPPASERP 207 Query: 870 RXPPXXXXXXPXPPPXPP----XPXPXXPXXPPPXPPXP 974 PP PPP P P P P P PP P Sbjct: 208 STPPSDSEHPSPPPPGHPKRREQPPPPGSKRPTPSPPSP 246 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 5/52 (9%) Frame = +1 Query: 838 PPPPPPXPX-----PXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PPP P P P P G P PP PPP P PP Sbjct: 27 PPPQPSFPGDNATSPTREPTNGNPPETTNTPAQSSPPPETPLSSPPPEPSPP 78 Score = 30.3 bits (65), Expect = 2.0 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 2/57 (3%) Frame = +2 Query: 818 PPPXPXXP--PPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXPXS 982 PPP P P PP PP P PP P P P P P P P S Sbjct: 124 PPPPP--PTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDP--PSNPLPPPKLVPPS 176 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP P P P P P PP PP P P P P Sbjct: 267 PPKPSPDPLPSNSSSPPTLLPPSSVVSPPSPPRKSVSGPDNPSPNNP 313 Score = 29.9 bits (64), Expect = 2.7 Identities = 21/71 (29%), Positives = 22/71 (30%), Gaps = 8/71 (11%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXP--------XXP 944 P T PT P PP + P PPP P P P P Sbjct: 34 PGDNATSPTRE--PTNGNPPETTNTPAQSSPPPETPLSSPPPEPSPPSPSLTGPPPTTIP 91 Query: 945 XXPPPXPPXPP 977 PPP P PP Sbjct: 92 VSPPPEPSPPP 102 Score = 29.9 bits (64), Expect = 2.7 Identities = 17/58 (29%), Positives = 18/58 (31%), Gaps = 2/58 (3%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP--XPPXPP 977 P+ PP P P PP P P P P PPP PP P Sbjct: 80 PSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTP 137 Score = 29.5 bits (63), Expect = 3.6 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 6/59 (10%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP------PPPXP 975 P P PP P P P PP P PP PPP PPP P Sbjct: 41 PTREPTNGNPPETTNTPAQSSPPPETPLSSPP-PEPSPPSPSLTGPPPTTIPVSPPPEP 98 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +1 Query: 844 PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PP P PP P P P P L PP P Sbjct: 255 PSPPSPPEETLPPPKPSPDPLPSNSSSPPTLLPPSSVVSPPSPP 298 Score = 29.1 bits (62), Expect = 4.7 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PP P PP PPP P P P P PP P Sbjct: 201 PPASERPSTPPSDSEHPSPPPPGHPKRREQP--PPPGSKRPTPSPPSP 246 Score = 29.1 bits (62), Expect = 4.7 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 4/54 (7%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPX----PPXXPPXPPLXXXXXPPP 960 Q P P P PP P P P P PP P PL PP Sbjct: 230 QPPPPGSKRPTPSPPSPSDSKRPVHPSPPSPPEETLPPPKPSPDPLPSNSSSPP 283 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/62 (25%), Positives = 16/62 (25%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P P PP P P P P P P P P P P P Sbjct: 50 PPETTNTPAQSSPPPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAP 109 Query: 969 XP 974 P Sbjct: 110 PP 111 Score = 28.7 bits (61), Expect = 6.2 Identities = 27/97 (27%), Positives = 30/97 (30%), Gaps = 10/97 (10%) Frame = +3 Query: 714 PPPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXXPPP---PPXXXXXRXPPX 884 PPP P + S P + +LP PPP PP R P Sbjct: 127 PPPTEAPPTTPITSPSPPTNPPP-PPESPPSLPAPDPPSNPLPPPKLVPPSHSPPRHLPS 185 Query: 885 XXXXXPXPPPX--PPXPXPXXPXXPP-----PXPPXP 974 PPP P P P PP P PP P Sbjct: 186 PPASEIPPPPRHLPSPPASERPSTPPSDSEHPSPPPP 222 Score = 28.3 bits (60), Expect = 8.2 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 PPPP PP P PP P P PP P P Sbjct: 231 PPPPGSKRPTPSPPSPSDSKRPVHPSPPSP-PEETLPPPKPSPDP 274 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 48.4 bits (110), Expect = 7e-06 Identities = 25/61 (40%), Positives = 25/61 (40%), Gaps = 5/61 (8%) Frame = +1 Query: 811 QXPXXXPPXPPPPP----PXPXPXAXPPXGXXPXPXPPXXPP-XPPLXXXXXPPPPPPXP 975 Q P PP PP P P P A PP P PP PP PP P PP P P Sbjct: 42 QPPATSPPSPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPSPPQPQP 101 Query: 976 P 978 P Sbjct: 102 P 102 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PP P P P + PP P P PP P P P P P Sbjct: 70 PNQPPNTTPPPTPPSSPPPSITPPPSPPQPQPPPQSTPTGDSPVVIPFP 118 Score = 35.9 bits (79), Expect = 0.041 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = +1 Query: 811 QXPXXXPPX---PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 Q P PP PP PP P P PP P P PP P P P PP Sbjct: 67 QPPPNQPPNTTPPPTPPSSPPPSITPPPS-PPQPQPPPQSTPTGDSPVVIPFPKPQLPP 124 Score = 34.7 bits (76), Expect = 0.095 Identities = 18/53 (33%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = +2 Query: 818 PPPXPXXPPP---PPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PP P PPP PP +PPP P P P P P PP Sbjct: 79 PPTPPSSPPPSITPPPSPPQPQPPPQSTPTGDSPVVIPFPKPQLPPPSLFPPP 131 Score = 34.3 bits (75), Expect = 0.13 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 2/60 (3%) Frame = +3 Query: 804 TLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXX--PXXPPPXPPXPP 977 T P P PPP PP PPP PP P P PP P PP Sbjct: 46 TSPPSPPSPDTQTSPPPATAAQ--PPPNQPPNTTPPPTPPSSPPPSITPPPSPPQPQPPP 103 Score = 34.3 bits (75), Expect = 0.13 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 7/60 (11%) Frame = +1 Query: 811 QXPXXXPPXPPP--PPPXPXPXAXPPXGXXPXPXPP--XXPPXPPLXXXXXPPP---PPP 969 Q P PP PP PPP P PP P P P P PPP PPP Sbjct: 72 QPPNTTPPPTPPSSPPPSITPPPSPPQPQPPPQSTPTGDSPVVIPFPKPQLPPPSLFPPP 131 Score = 33.5 bits (73), Expect = 0.22 Identities = 18/59 (30%), Positives = 19/59 (32%), Gaps = 2/59 (3%) Frame = +2 Query: 806 SXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP--XPPXXP 976 S PP P PP PP P P P P+ P PP PP P Sbjct: 38 SETTQPPATSPPSPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPSP 96 Score = 33.1 bits (72), Expect = 0.29 Identities = 23/68 (33%), Positives = 24/68 (35%), Gaps = 2/68 (2%) Frame = +2 Query: 785 TTXXXTHSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPX-PXPSX-PXXXPP 958 TT S PP PPP +PPP PP P P PS P PP Sbjct: 40 TTQPPATSPPSPPSPDTQTSPPPATAA--QPPPNQPPNTTPPPTPPSSPPPSITPPPSPP 97 Query: 959 XPPXXPXS 982 P P S Sbjct: 98 QPQPPPQS 105 Score = 32.7 bits (71), Expect = 0.38 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P PPP PP P PP P P P P PP P Sbjct: 62 PATAAQPPPNQPPNTTPPPTPPSSP-PPSITPPPSPPQPQPPPQSTP 107 Score = 31.5 bits (68), Expect = 0.88 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 2/45 (4%) Frame = +3 Query: 840 PPP--PPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 PPP PP PP PPP PP P P P P Sbjct: 68 PPPNQPPNTTPPPTPPSSPPPSITPPPSPPQPQPPPQSTPTGDSP 112 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 2/49 (4%) Frame = +2 Query: 818 PPPXPXXPPPP--PXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP 958 PPP PPP P PP P PP P P P P P Sbjct: 60 PPPATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPSP-PQPQPPPQSTP 107 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP---XPPLXXXXXPPPPP 966 P PP P PPP P P P P P PP PP P P P Sbjct: 92 PPPSPP-QPQPPPQSTPTGDSPV-VIPFPKPQLPPPSLFPPPSLVNQLPDPRP 142 Score = 29.9 bits (64), Expect = 2.7 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 1/55 (1%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXP-PXPPXXPXS 982 PP PP PP PP P PP P P P P P P S Sbjct: 73 PPNTTPPPTPPSSPPPSITPP-PSPPQPQPPPQSTPTGDSPVVIPFPKPQLPPPS 126 Score = 29.1 bits (62), Expect = 4.7 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Frame = +3 Query: 813 TXXXXPPXXPPP---PPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 T PP PPP PP PP P P P P P PP P P Sbjct: 77 TPPPTPPSSPPPSITPPPSPPQPQPPPQSTPTGDSPVVIPFPKPQLP--PPSLFPPP 131 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/52 (30%), Positives = 17/52 (32%), Gaps = 2/52 (3%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPP--PXPPXPXPXXPXXPPP 959 PT PP PPP + PP P P P P PPP Sbjct: 80 PTPPSSPPPSITPPPSPPQPQPPPQSTPTGDSPVVIPFPKPQLPPPSLFPPP 131 >At5g19090.1 68418.m02269 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 587 Score = 48.0 bits (109), Expect = 1e-05 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GGGG GG GG G G G G G GGGGGG GG Sbjct: 345 GGKGGGGHPLDGKMGGGGGGPNGNKGGGGVQMNGGPNGGKKGGGGGGGGG 394 Score = 46.4 bits (105), Expect = 3e-05 Identities = 23/50 (46%), Positives = 24/50 (48%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GGGGG +GG GG GG G G P G G G G G GG Sbjct: 324 GGPGGGGGNMGNQNQGG-GGKNGGKGGGGHPLDGKMGGGGGGPNGNKGGG 372 Score = 42.7 bits (96), Expect = 4e-04 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXP-XGGXAXGXGXGGGGGGXGG 828 G GGGG GG G GG G G P GG G GGGGG GG Sbjct: 367 GNKGGGGVQMNGGPNGGKKGGGGGGGGGGGPMSGGLPPGFRPMGGGGGGGG 417 Score = 41.5 bits (93), Expect = 8e-04 Identities = 26/56 (46%), Positives = 26/56 (46%), Gaps = 2/56 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGG--XGGXXXG 816 G GGGGGG G GG GG P GG G G GGGGGG GG G Sbjct: 356 GKMGGGGGG----PNGNKGG--GGVQMNGGPNGGKKGGGGGGGGGGGPMSGGLPPG 405 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -3 Query: 932 GGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GG GG G G G G GGGGGG GG Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGG 136 Score = 39.1 bits (87), Expect = 0.004 Identities = 22/52 (42%), Positives = 23/52 (44%), Gaps = 7/52 (13%) Frame = -3 Query: 965 GGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGG-------GGGGXG 831 GGGGG +GG GG G G GG G G GG GGGG G Sbjct: 313 GGGGGGPGGKKGGPGGGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGGGG 364 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGG 839 G GG GG G G G GG GGG G R GGGGG Sbjct: 370 GGGGVQMNGGPNGGKKGGGGGGGGGGGPMSGGLPPGFRPMGGGGGGGG 417 Score = 37.1 bits (82), Expect = 0.018 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 GG GG GGG G G GG GG G GG GGGGG G Sbjct: 324 GGPGG-GGGNMGNQNQGGGGKNGGKG-----GGGHPLDGKMGGGGGGPNG 367 Score = 36.7 bits (81), Expect = 0.024 Identities = 22/47 (46%), Positives = 22/47 (46%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGG 837 GG GGGGGG GG G G GG G G GGGGGG Sbjct: 102 GGKGGGGGG------GGPANNNKGQKIG---GGGGGGGGGGGGGGGG 139 Score = 36.7 bits (81), Expect = 0.024 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GG GG G GG GG G GG G GG G GG G Sbjct: 341 GGKNGGKGGGGHPLDGKMGGGGGGPN-GNKGGGGVQMNGGPNGGKKGGGGGGGG 393 Score = 35.5 bits (78), Expect = 0.054 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -3 Query: 923 GGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GG G G G GGGGGG GG G Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGG 137 Score = 34.3 bits (75), Expect = 0.13 Identities = 20/51 (39%), Positives = 21/51 (41%), Gaps = 5/51 (9%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGX-----GGGXGXXXXXXGGXRXXXXXGGGGG 839 GG GG G G G G GG GGG GG + GGGGG Sbjct: 345 GGKGGGGHPLDGKMGGGGGGPNGNKGGGGVQMNGGPNGGKKGGGGGGGGGG 395 Score = 33.1 bits (72), Expect = 0.29 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 973 GXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG GG G G GGG G GG G GG GG Sbjct: 339 GGGGKNGGKGGGGHPLDGKMGGGGGGPNGNKGGGGVQMNGGPNGGKKGG 387 Score = 33.1 bits (72), Expect = 0.29 Identities = 23/58 (39%), Positives = 23/58 (39%), Gaps = 6/58 (10%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGG------XGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G GG GGG G G G GGG G GG GGGGG GG Sbjct: 340 GGGKNGGKGGG--GHPLDGKMGGGGGGPNGNKGGGGVQMNGGPNGGKKGGGGGGGGGG 395 Score = 32.7 bits (71), Expect = 0.38 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G G G G G G GG G GGG GGGG G GGG Sbjct: 299 GKIEGKGMPFPVQMGGGGGGPGG-KKGGPGGGGGNMGNQNQGGGGKNGGKGGG 350 Score = 31.9 bits (69), Expect = 0.67 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGG 840 GG GGGGGG GG G P G G G GGGGG Sbjct: 386 GGGGGGGGG-------------GGPMSGGLPPGFRPMGGGGGGGGG 418 Score = 31.5 bits (68), Expect = 0.88 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGX--XGXGGG 817 G G GG G G GG GGG GGGGG GGG Sbjct: 318 GPGGKKGGPGGGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGGGGPNGNKGGG 372 Score = 31.5 bits (68), Expect = 0.88 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGG--XRXXXXXGGGGGXXGG 827 G GG G G G G GGG G G GGGGG GG Sbjct: 367 GNKGGGGVQMNGGPNGGKKGGGGGGGGGGGPMSGGLPPGFRPMGGGGGGGGG 418 Score = 31.1 bits (67), Expect = 1.2 Identities = 26/75 (34%), Positives = 28/75 (37%), Gaps = 14/75 (18%) Frame = -3 Query: 977 GGXGGGGGGXXXXXR---GGXGGXXGG---XGXGXXP--------XGGXAXGXGXGGGGG 840 GG GGGGGG G GG G G G P G A G G GGGGG Sbjct: 410 GGGGGGGGGPQSMSMPMGGAMGGPMGSLPQMGGGPGPMSNNMQAVQGLPAMGPGGGGGGG 469 Query: 839 GXGGXXXGXWXSEXS 795 G + + S Sbjct: 470 PSAEAPPGYFQGQVS 484 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -1 Query: 958 GGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 GGG G G G GGG GG GGGG G Sbjct: 313 GGGGGGPGGKKGGPGGGGGNMGNQNQGGGGKNGGKGGGGHPLDG 356 Score = 29.9 bits (64), Expect = 2.7 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = -1 Query: 982 GXGGXGGXGGG-XXGXXGXGXGGXGGGXGXXXXXXGG 875 G G GG GGG G GG GGG G GG Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGG 138 Score = 29.5 bits (63), Expect = 3.6 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 6/35 (17%) Frame = -3 Query: 902 GXGXXPXGGXAXGXGX------GGGGGGXGGXXXG 816 G G P GG G G GGGGGG GG G Sbjct: 291 GGGPGPAGGKIEGKGMPFPVQMGGGGGGPGGKKGG 325 Score = 29.1 bits (62), Expect = 4.7 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGG 820 G G G G G G GG GGG GGGG GG Sbjct: 328 GGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGGGGPNGNKGGGGVQMNGG 379 Score = 28.3 bits (60), Expect = 8.2 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG GG +G G GG GGG GG G GGG Sbjct: 342 GKNGGKGGGGHPLDGKMGGGGGGPNGNKG--GGGVQMNGGPNGGKKGGGGGGG 392 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 48.0 bits (109), Expect = 1e-05 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXP-PLXXXXXPPPPPPXPP 978 P PP P P P P P P P P PP PP P P PP P PP Sbjct: 149 PPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTPP 203 Score = 47.6 bits (108), Expect = 1e-05 Identities = 24/57 (42%), Positives = 25/57 (43%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPP-XPPPPPPXP-XPXAXPPXG-XXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PPPP P P P PP P P P P PP+ P PPPP P Sbjct: 127 PSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSP 183 Score = 45.2 bits (102), Expect = 7e-05 Identities = 22/54 (40%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXG-XXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PP PPPP P PP P P P P PP+ PPPP P P Sbjct: 75 PAPVPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPV----SPPPPTPTP 124 Score = 45.2 bits (102), Expect = 7e-05 Identities = 23/58 (39%), Positives = 23/58 (39%), Gaps = 4/58 (6%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXX----PXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P P P P P PP P P PP PP PP P P PP P Sbjct: 79 PPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPP-PPTPTPSVPSPTPPVSP 135 Score = 45.2 bits (102), Expect = 7e-05 Identities = 26/88 (29%), Positives = 27/88 (30%) Frame = +3 Query: 714 PPPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXX 893 PPP T S + S P P PP P P PP Sbjct: 99 PPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTP 158 Query: 894 XXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P P PP P P PPP P PP Sbjct: 159 TPSVPSPTPPVPTDPMPSPPPPVSPPPP 186 Score = 44.8 bits (101), Expect = 9e-05 Identities = 21/53 (39%), Positives = 22/53 (41%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P PP PP P P P P P P P PP+ PPPP P P Sbjct: 142 PSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVS----PPPPTPTP 190 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Frame = +1 Query: 817 PXXXPPXPP--PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P PP PPPP P P P P P P P PPPP P P Sbjct: 88 PSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTP 142 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P PPPP P PP P PP P PP PP P PP Sbjct: 168 PVPTDPMPSPPPPVSPP---PPTPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPP 218 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/64 (39%), Positives = 25/64 (39%), Gaps = 10/64 (15%) Frame = +1 Query: 817 PXXXPPXP-PPPPPXPXPXAXPPXGXXP------XPXPPXXPPXPPLXXXXXPP---PPP 966 P PP P PPPP P P P P P PP P PP PP P P Sbjct: 173 PMPSPPPPVSPPPPTPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPSVPSPPDVTPTP 232 Query: 967 PXPP 978 P PP Sbjct: 233 PTPP 236 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 4/53 (7%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXP----PXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PP P P P P P P P P P PP PP PP P P PP P Sbjct: 119 PPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPP-PPTPTPSVPSPTPPVP 170 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 4/54 (7%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXX----PXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP P P P P P PP P P PP PP PP P P PP P Sbjct: 101 PPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPP-PPTPTPSVPSPTPPVSP 153 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/55 (34%), Positives = 20/55 (36%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P+ P PPPP P P P P P P P P PPP P P Sbjct: 88 PSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTP 142 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/56 (42%), Positives = 25/56 (44%), Gaps = 3/56 (5%) Frame = +1 Query: 817 PXXXPPX-PPPPPPXP-XPXAXPPXG-XXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PP PPPP P P P PP P P P P PP+ PPPP P P Sbjct: 109 PSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPV----SPPPPTPTP 160 Score = 42.3 bits (95), Expect = 5e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +1 Query: 844 PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP P P PP P P PP PP PP P P PP P Sbjct: 74 PPAPVPPVSPPPPTPSVPSPTPPVSPP-PPTPTPSVPSPTPPVSP 117 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXP-PXPPLXXXXXPPPPPPXPP 978 P P PP PP P P P P PP P P P PPPP P Sbjct: 106 PSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTP 160 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PT P PP P PP P P P P P P P P P PP Sbjct: 156 PTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTPPTPSVPSPP 211 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/54 (35%), Positives = 20/54 (37%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P PP P + PP P P P P PP P P P PP Sbjct: 158 PTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTPPTPSVPSPP 211 Score = 39.1 bits (87), Expect = 0.004 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 843 PPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP P PP P PP PP P P P P P PP P Sbjct: 74 PPAPVPPVSPPPPTPSVPSPTPPVSPPPPTP-TPSVPSPTPPVSP 117 Score = 39.1 bits (87), Expect = 0.004 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 1/59 (1%) Frame = +3 Query: 804 TLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPP-PXPPXPXPXXPXXPPPXPPXPP 977 T P PP PPPP PP P PP P P P P P P P PP Sbjct: 171 TDPMPSPPPPVSPPPPTPTPSVPSPPDV---TPTPPTPSVPSPPDVTPTPPTPSVPSPP 226 Score = 38.7 bits (86), Expect = 0.006 Identities = 29/91 (31%), Positives = 30/91 (32%), Gaps = 3/91 (3%) Frame = +3 Query: 714 PPPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXX 893 PPP PS S P + PT PP PP P PP Sbjct: 118 PPPTPTPS---VPSPTPPVSPPPPTPTPSVPSPTPPVSPP--PPTPTPSVPSPTPPVPTD 172 Query: 894 XXPXPPP--XPPXPXPXXP-XXPPPXPPXPP 977 P PPP PP P P PP P PP Sbjct: 173 PMPSPPPPVSPPPPTPTPSVPSPPDVTPTPP 203 Score = 38.3 bits (85), Expect = 0.008 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 7/57 (12%) Frame = +3 Query: 828 PPXXPPPP------PXXXXXRXPPXXXXXXPXP-PPXPPXPXPXXPXXPPPXPPXPP 977 PP PPPP P PP P P PP P P P P P PP P Sbjct: 79 PPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSP 135 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 T S P P PPP P PP P PP P P P P PP Sbjct: 141 TPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPP 196 Score = 37.5 bits (83), Expect = 0.013 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 T + PPP P P P P P P PP P P P P PP Sbjct: 148 TPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTPP 203 Score = 36.7 bits (81), Expect = 0.024 Identities = 29/101 (28%), Positives = 31/101 (30%), Gaps = 4/101 (3%) Frame = +3 Query: 684 ESCRSDHVRCPPPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXP-PXXPPPPPXX 860 +SC + C P PS D S P P P P P P Sbjct: 38 DSCHVECASCKPICGPPSPGDDGGGDDSGGDDGGYTPPAPVPPVSPPPPTPSVPSPTPPV 97 Query: 861 XXXRXPPXXXXXXPXPP--PXPPXPXPXXPXXPPP-XPPXP 974 P P PP P PP P P P PP PP P Sbjct: 98 SPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPP 138 Score = 36.7 bits (81), Expect = 0.024 Identities = 18/63 (28%), Positives = 21/63 (33%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P ++P+ P P P P PP P PP P P PP P Sbjct: 156 PTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTPPTPSVPSPPDVTP 215 Query: 969 XPP 977 PP Sbjct: 216 TPP 218 Score = 36.3 bits (80), Expect = 0.031 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = +3 Query: 828 PPXXPPPP-PXXXXXRXPPXXXXXXPXPPPXPPXPXPXX-PXXPPPXPPXP 974 PP PPPP P P P P P P P P P P P P P Sbjct: 95 PPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVP 145 Score = 35.5 bits (78), Expect = 0.054 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = +2 Query: 821 PPXPXXP--PPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PP P P PPPP PP P P P P P P PP P Sbjct: 74 PPAPVPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTP--PVSPPPPTP 122 Score = 35.5 bits (78), Expect = 0.054 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +1 Query: 817 PXXXPPXPPPP---PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P P PP P P P P P P P P P + PP P P Sbjct: 186 PTPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPPSVPTP 241 Score = 34.7 bits (76), Expect = 0.095 Identities = 22/71 (30%), Positives = 23/71 (32%), Gaps = 8/71 (11%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPP--PXXXXXRXPPXXXXXXPXPPPXP------PXPXPXXP 944 P + PT PP P P P PP P P P P P P P Sbjct: 86 PTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVP 145 Query: 945 XXPPPXPPXPP 977 PP P PP Sbjct: 146 SPTPPVSPPPP 156 Score = 34.7 bits (76), Expect = 0.095 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 T S P P PPP P PP P P P P P P PP P Sbjct: 87 TPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTP--PVSPPPPTP 140 Score = 34.7 bits (76), Expect = 0.095 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 3/55 (5%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPP---PXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PP P P P PP P P PP P P P P PP P Sbjct: 99 PPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSP 153 Score = 34.3 bits (75), Expect = 0.13 Identities = 20/61 (32%), Positives = 21/61 (34%), Gaps = 2/61 (3%) Frame = +1 Query: 802 SLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP--PPPPXP 975 S+ P P P P P P P P P PP P PP P PP P Sbjct: 191 SVPSPPDVTPTPPTPSVPSP-PDVTPTPPTPSVPSPPDVTPTPPTPPSVPTPSGSPPYVP 249 Query: 976 P 978 P Sbjct: 250 P 250 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP 959 P T PT P P P PP P PP P P P PPP Sbjct: 196 PDVTPTPPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPPSV-PTPSGSPPYVPPP 251 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P P P PP PP PP P PP PP Sbjct: 49 PICGPPSPGDDGGGDDSGGDDGGYTPPAPVPPVSPP-PPTPSVPSPTPPVSPPP 101 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 3/47 (6%) Frame = +1 Query: 829 PPXPPPP---PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP 960 P P PP P P P P P P P P P PPP Sbjct: 205 PSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPPSVPTPSGSPPYVPPP 251 Score = 28.7 bits (61), Expect = 6.2 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPP-PXPPXPXPXXPXXPPPXPPXP 974 PP P PP PP P P P PP P P PP P P Sbjct: 195 PPDVTPTPPTPSVPS-PPDVTPTPPTPSVPSPPDVTPTPP--TPPSVPTP 241 Score = 28.3 bits (60), Expect = 8.2 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXP 897 P P PP PP P P PP P Sbjct: 225 PPDVTPTPPTPPSVPTPSGSPPYVPPP 251 >At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/52 (46%), Positives = 24/52 (46%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG GG GGG G G G G GG G GG GGGGG GG Sbjct: 22 GYGGGGGYGGGDAGYGGRGASG-GGSYGGRGGYGGGGGRGNRGGGGGGYQGG 72 Score = 44.8 bits (101), Expect = 9e-05 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG G GGGG G GG G GG G G G GGG GG G Sbjct: 19 GGDGYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGGGYQGG 72 Score = 41.9 bits (94), Expect = 6e-04 Identities = 23/54 (42%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Frame = -3 Query: 974 GXGGGGG-GXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GGGGG G GG G GG G GG GGGGGG G G Sbjct: 22 GYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRG 75 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG G GGG RG GG G G GG G GGGGG GG G Sbjct: 25 GGGGYGGGDAGYGGRGASGG--GSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGG 76 Score = 38.3 bits (85), Expect = 0.008 Identities = 24/52 (46%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGX--GXGGGGGGXGG 828 GG G GGG RGG GG GG G GG G G G GGGG G Sbjct: 37 GGRGASGGGSYGG-RGGYGGG-GGRGNRGGGGGGYQGGDRGGRGSGGGGRDG 86 Score = 36.7 bits (81), Expect = 0.024 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = -3 Query: 962 GGGGXXXXXRGGXG-GXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GGGG GG G G GG G G GG G GG GG GG G Sbjct: 9 GGGGAPIPSYGGDGYGGGGGYGGGDAGYGGR--GASGGGSYGGRGGYGGG 56 Score = 30.3 bits (65), Expect = 2.0 Identities = 19/65 (29%), Positives = 21/65 (32%) Frame = -1 Query: 958 GGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRVSXAXGSQX 779 GGG G G GGG G G GG G GG GR + G Sbjct: 9 GGGGAPIPSYGGDGYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGGG 68 Query: 778 FXQXD 764 + D Sbjct: 69 YQGGD 73 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = -2 Query: 966 GGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGG-GGGXXGXGG 820 GG G G G G GG G GGG GG G G G G Sbjct: 37 GGRGASGGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGGGGRDG 86 >At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/52 (46%), Positives = 24/52 (46%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG GG GGG G G G G GG G GG GGGGG GG Sbjct: 22 GYGGGGGYGGGDAGYGGRGASG-GGSYGGRGGYGGGGGRGNRGGGGGGYQGG 72 Score = 44.8 bits (101), Expect = 9e-05 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG G GGGG G GG G GG G G G GGG GG G Sbjct: 19 GGDGYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGGGYQGG 72 Score = 41.9 bits (94), Expect = 6e-04 Identities = 23/54 (42%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Frame = -3 Query: 974 GXGGGGG-GXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GGGGG G GG G GG G GG GGGGGG G G Sbjct: 22 GYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRG 75 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG G GGG RG GG G G GG G GGGGG GG G Sbjct: 25 GGGGYGGGDAGYGGRGASGG--GSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGG 76 Score = 38.3 bits (85), Expect = 0.008 Identities = 24/52 (46%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGX--GXGGGGGGXGG 828 GG G GGG RGG GG GG G GG G G G GGGG G Sbjct: 37 GGRGASGGGSYGG-RGGYGGG-GGRGNRGGGGGGYQGGDRGGRGSGGGGRDG 86 Score = 36.7 bits (81), Expect = 0.024 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = -3 Query: 962 GGGGXXXXXRGGXG-GXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GGGG GG G G GG G G GG G GG GG GG G Sbjct: 9 GGGGAPIPSYGGDGYGGGGGYGGGDAGYGGR--GASGGGSYGGRGGYGGG 56 Score = 30.3 bits (65), Expect = 2.0 Identities = 19/65 (29%), Positives = 21/65 (32%) Frame = -1 Query: 958 GGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRVSXAXGSQX 779 GGG G G GGG G G GG G GG GR + G Sbjct: 9 GGGGAPIPSYGGDGYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGGG 68 Query: 778 FXQXD 764 + D Sbjct: 69 YQGGD 73 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = -2 Query: 966 GGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGG-GGGXXGXGG 820 GG G G G G GG G GGG GG G G G G Sbjct: 37 GGRGASGGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGGGGRDG 86 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 47.2 bits (107), Expect = 2e-05 Identities = 21/56 (37%), Positives = 22/56 (39%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 Q P P PPPP P P P P PP P PP+ PP P PP Sbjct: 640 QSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPP 695 Score = 46.8 bits (106), Expect = 2e-05 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Frame = +1 Query: 829 PPXPPPPPPX---PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PPPP P P PP P PP P PP PPPP PP Sbjct: 708 PPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPP 760 Score = 46.0 bits (104), Expect = 4e-05 Identities = 25/57 (43%), Positives = 26/57 (45%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXPP---PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP PPPP P PP P P P PP PP+ PPPP PP Sbjct: 730 PVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPP-PVHSPPPPPVHS---PPPPVHSPP 782 Score = 45.2 bits (102), Expect = 7e-05 Identities = 23/59 (38%), Positives = 24/59 (40%), Gaps = 5/59 (8%) Frame = +1 Query: 817 PXXXPPXPP---PPPPX--PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP PPPP P P P P PP P PP+ P PP PP Sbjct: 680 PVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPP 738 Score = 45.2 bits (102), Expect = 7e-05 Identities = 26/69 (37%), Positives = 28/69 (40%), Gaps = 7/69 (10%) Frame = +1 Query: 796 LYSLXQXPXXXPPXP---PPPPPX--PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP 960 +YS P PP P PPPPP P P P P PP P PP+ P P Sbjct: 748 IYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSP 807 Query: 961 --PPPXPPF 981 PP P F Sbjct: 808 IYSPPPPVF 816 Score = 45.2 bits (102), Expect = 7e-05 Identities = 25/61 (40%), Positives = 25/61 (40%), Gaps = 8/61 (13%) Frame = +1 Query: 817 PXXXPPXPP---PPPPX--PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPX 972 P PP PP PPPP P P P P PP P PP PPP PPP Sbjct: 762 PVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPPPK 821 Query: 973 P 975 P Sbjct: 822 P 822 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/67 (37%), Positives = 28/67 (41%), Gaps = 7/67 (10%) Frame = +1 Query: 796 LYSLXQXPXXXPPXP--PPPPPX--PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP-- 957 ++S P PP P PPPP P P P P PP P PP+ PP Sbjct: 681 VHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVF 740 Query: 958 -PPPPXP 975 PPPP P Sbjct: 741 SPPPPAP 747 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP---PPXPP 978 P PP P PP P PP P P P P PP PPPP PP PP Sbjct: 716 PVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPP--PVHSPPPPVHSPPPPP 770 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/57 (40%), Positives = 24/57 (42%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXP---PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P PPPPP P PP P PP P PP+ PP P PP Sbjct: 723 PVHSPPPPVQSPPPPPVFSPP--PPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPP 777 Score = 44.4 bits (100), Expect = 1e-04 Identities = 26/67 (38%), Positives = 27/67 (40%), Gaps = 11/67 (16%) Frame = +1 Query: 811 QXPXXXPPXPPPPP-----PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXP---PPPP 966 Q P P PPPP P P P PP P PP P PP+ P PPPP Sbjct: 732 QSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPP 791 Query: 967 ---PXPP 978 P PP Sbjct: 792 VHSPPPP 798 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P T T PP PPPP PP P P PP P P PP PP Sbjct: 629 PSTEETKTTSPQSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPP 688 Score = 43.2 bits (97), Expect = 3e-04 Identities = 24/61 (39%), Positives = 25/61 (40%), Gaps = 8/61 (13%) Frame = +1 Query: 817 PXXXPPXPP---PPPP---XPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXP--PPPPPX 972 P PP PP PPPP P P P P PP P PP+ P PPPP Sbjct: 747 PIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPS 806 Query: 973 P 975 P Sbjct: 807 P 807 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/59 (40%), Positives = 25/59 (42%), Gaps = 5/59 (8%) Frame = +1 Query: 817 PXXXPPXP---PPPP--PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P PPPP P P PP P PP P PP+ PPPP PP Sbjct: 652 PVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPV---HSPPPPVHSPP 707 Score = 41.5 bits (93), Expect = 8e-04 Identities = 26/69 (37%), Positives = 30/69 (43%), Gaps = 8/69 (11%) Frame = +1 Query: 796 LYSLXQXPXXXPPXP---PPPP---PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP 957 ++S P PP P PPPP P P + PP P P P P PP+ PP Sbjct: 763 VHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPPV---FSPP 819 Query: 958 PPP--PXPP 978 P P P PP Sbjct: 820 PKPVTPLPP 828 Score = 41.1 bits (92), Expect = 0.001 Identities = 25/60 (41%), Positives = 26/60 (43%), Gaps = 6/60 (10%) Frame = +1 Query: 817 PXXXPPXP---PPPP---PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P PPPP P P P PP P PP P PP+ PPPP PP Sbjct: 666 PMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPP-PPVHSPPPPVHS---PPPPVHSPP 721 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PPP PP P PP P P P PP P PP Sbjct: 722 PPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPP 777 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PPP PPPPP PPP P PP P P P PP PP Sbjct: 727 PPPPVQSPPPPPV----FSPPP--PAPIYSPPPPPVHSPPPPVHSPPPPP 770 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXPPPPP---PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PPPP P P P PP P PP P PP PP P PP Sbjct: 728 PPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPP 784 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Frame = +1 Query: 829 PPXPPPPPP---XPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PPPP P P P P PP P PP+ PPPP PP Sbjct: 679 PPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPV---HSPPPPVHSPP 728 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PPPP PP P PP P P P PP P PP Sbjct: 737 PPVFSPPPPAPIYS--PPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPP 784 Score = 39.5 bits (88), Expect = 0.003 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PPPP PP P P PP P P PPP PP Sbjct: 709 PVHSPPPPVHSPPPPVHSP---PPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPP 761 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXP---PXPP 977 P PP PPPP PP P P PP P P PP P P PP Sbjct: 673 PVYSPPPPVHSPPPPPVHSP-PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 730 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP--XPPXPP 977 P PP PPPP PP P P PP P P P P PP PP Sbjct: 702 PVHSPPPPVHSPPPPV----HSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPP 755 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 3/53 (5%) Frame = +2 Query: 818 PPPXPXXPPPP---PXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PPP PPPP P PPP P PP P P P PP PP Sbjct: 706 PPPPVHSPPPPVHSPPPPVHSPPPPVQSPP---PPPVFSPPPPAPIYSPPPPP 755 Score = 38.3 bits (85), Expect = 0.008 Identities = 25/74 (33%), Positives = 27/74 (36%), Gaps = 7/74 (9%) Frame = +2 Query: 776 EXLTTXXXTHSXNXPPPXPX--XPPPP---PXXXXXXRPPP--XXXXPXXXPPXXPXPXP 934 E TT + + PPP P PPPP P PPP P PP P P Sbjct: 633 ETKTTSPQSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSP 692 Query: 935 SXPXXXPPXPPXXP 976 P PP P P Sbjct: 693 PPPVHSPPPPVHSP 706 Score = 38.3 bits (85), Expect = 0.008 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 6/62 (9%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPP---PXPPXPXPXXPXXPPPXP---PX 971 P PP PPPP PP P PP P PP P P PP P P Sbjct: 659 PVFSPPPPMHSPPPPVYS----PPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP 714 Query: 972 PP 977 PP Sbjct: 715 PP 716 Score = 38.3 bits (85), Expect = 0.008 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXP---PXPP 977 P PP PPPP PP P P PP P P PP P P PP Sbjct: 666 PMHSPPPPVYSPPPPVHSPP-PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 723 Score = 38.3 bits (85), Expect = 0.008 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP--XPPXPP 977 P PP PPPP PP P P P P P PPP PP PP Sbjct: 716 PVHSPPPPVHSPPPPVQSP---PPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPP 770 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 3/59 (5%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXP---PXPP 977 P PP PPP PP P P PP P P PP P P PP Sbjct: 747 PIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 805 Score = 37.5 bits (83), Expect = 0.013 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PPP PPP P P P PP P P P PP P P Sbjct: 736 PPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSP 788 Score = 37.1 bits (82), Expect = 0.018 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXP---PXPP 977 PP PPPP PP P P PP P P PP P P PP Sbjct: 687 PPVHSPPPPVHSPP--PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPP 737 Score = 37.1 bits (82), Expect = 0.018 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P PP PPP PP P P PP P P P PP P Sbjct: 730 PVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPP 784 Score = 36.3 bits (80), Expect = 0.031 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXP 965 P PP PPPP PP P PP P P P P P P Sbjct: 784 PVHSPPPPVHSPPPPVHSP---PPPSPIYSPPPPVFSPPPKPVTPLPPATSP 832 Score = 35.5 bits (78), Expect = 0.054 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPP--XXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PPP PPPPP PPP P P P P P PP P P Sbjct: 677 PPPPVHSPPPPPV----HSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSP 727 Score = 35.1 bits (77), Expect = 0.072 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PP P P PP P P P P P P PP Sbjct: 523 PKPEPPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPP 571 Score = 35.1 bits (77), Expect = 0.072 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 2/51 (3%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXP--PXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P P P P P PP P PP+ PPPP PP Sbjct: 624 PQPPSPSTEETKTTSPQSPPVHSPPPPPPVHSPPPPV---FSPPPPMHSPP 671 Score = 35.1 bits (77), Expect = 0.072 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PPPP PP P P PP P P P P PP Sbjct: 769 PPVHSPPPPV----HSPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPP 814 Score = 34.3 bits (75), Expect = 0.13 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 5/58 (8%) Frame = +2 Query: 818 PPPXPXXPPPP---PXXXXXXRPPPXXX--XPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PPP PPPP P PPP P P P P P PP P P Sbjct: 656 PPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSP 713 Score = 33.5 bits (73), Expect = 0.22 Identities = 16/56 (28%), Positives = 17/56 (30%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 + P PP P P P PP P P P P P P PP Sbjct: 532 ESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPP 587 Score = 33.5 bits (73), Expect = 0.22 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PPPP PP P P P P P P P P PP Sbjct: 777 PVHSPPPPVHSPPPPVHSP---PPPVHSPPPPSPIYSP-PPPVFSPPPKPVTPLPP 828 Score = 33.5 bits (73), Expect = 0.22 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PP P PP P PP P P PP P+ P PP P Sbjct: 784 PVHSPPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPPPKPV----TPLPPATSP 832 Score = 33.5 bits (73), Expect = 0.22 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 P PP P PP P P PP P P P P P P Sbjct: 791 PVHSPPPPVHSPPPPSPIYSPPPPVFSPPPKPVTPLPPATSPMANAPTP 839 Score = 31.9 bits (69), Expect = 0.67 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 3/48 (6%) Frame = +3 Query: 843 PPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXP---PXPP 977 PP P + PPP PP P P PP P P PP Sbjct: 626 PPSPSTEETKTTSPQSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPP 673 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 3/54 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP---PPPP 969 P P P P P P P PP PP PP PPPP Sbjct: 613 PYDASPIKKRRPQPPSPSTEETKTTSPQSPPVHSPPPPPPVHSPPPPVFSPPPP 666 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +3 Query: 831 PXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P P P P P PPP P P PPP PP Sbjct: 624 PQPPSPSTEETKTTSPQSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPP 672 Score = 29.9 bits (64), Expect = 2.7 Identities = 17/57 (29%), Positives = 17/57 (29%), Gaps = 1/57 (1%) Frame = +1 Query: 811 QXPXXXPPXPPP-PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 Q P P P P P P P P P PP P PP PP Sbjct: 537 QPPKQETPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPPKQEQPP 593 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/56 (26%), Positives = 15/56 (26%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P P PP P PP P P P P P P PP Sbjct: 516 PPKPEESPKPEPPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPP 571 Score = 29.1 bits (62), Expect = 4.7 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Frame = +1 Query: 811 QXPXXXPPXPPP-PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 + P PP P P P P P P P PP P P P PP Sbjct: 521 ESPKPEPPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKP---EESPKPQPP 571 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPP----PXXXXPXXXP-PXXPXPXPSXPXXXPPXP 964 P P P P P PP P P P P P P P P P P Sbjct: 407 PSPKPTPTPKAPEPKKEINPPNLEEPSKPKPEESPKPQQPSPKPETPSHEPSNP 460 >At2g05440.2 68415.m00575 glycine-rich protein Length = 154 Score = 47.2 bits (107), Expect = 2e-05 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 GG GG GG G G G G GGG G GG GGGGG GG Sbjct: 83 GGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGG 132 Score = 46.4 bits (105), Expect = 3e-05 Identities = 24/54 (44%), Positives = 24/54 (44%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGGGG G GG G G G GG G GGG GG GG G Sbjct: 86 GGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGG 139 Score = 45.6 bits (103), Expect = 5e-05 Identities = 24/50 (48%), Positives = 24/50 (48%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GGGGG G GG GG G G GG G G GGG G GG Sbjct: 93 GGHYGGGGGHYGGGGGHYGGGGGGHGGGGH-YGGGGGGYGGGGGHHGGGG 141 Score = 45.2 bits (102), Expect = 7e-05 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGGGG GG G G G G GG G GGG G GG G Sbjct: 51 GGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYG 104 Score = 44.8 bits (101), Expect = 9e-05 Identities = 24/52 (46%), Positives = 24/52 (46%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG G GGG G G GG GGG G GG GGGGG GG Sbjct: 91 GGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGG---GGGYGGGGGHHGG 139 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -3 Query: 965 GGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GGGGG G GG G G G GG G GGGG G GG G Sbjct: 76 GGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGG 125 Score = 43.6 bits (98), Expect = 2e-04 Identities = 24/58 (41%), Positives = 24/58 (41%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 G GG G GG G G G GG GG G GG GGGGG GG G Sbjct: 42 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGG--GGGHYGGGGGHYGGGGGHYG 97 Score = 43.6 bits (98), Expect = 2e-04 Identities = 26/57 (45%), Positives = 26/57 (45%), Gaps = 4/57 (7%) Frame = -3 Query: 974 GXGG--GGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGX--GGGGGGXGGXXXG 816 G GG GGGG GG GG GG G GG G G GGGGG GG G Sbjct: 60 GHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGG 116 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/58 (39%), Positives = 23/58 (39%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 G GG GG GG G G G G GGG G G GGGG GG G Sbjct: 74 GYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYG 131 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/54 (44%), Positives = 24/54 (44%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GG GGG G GG GG G G GG G GGG G GG G Sbjct: 48 GGHGGHGGGGGH----GHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYG 97 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/52 (46%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGX--GGGGGGXGG 828 GG G G G GG GG GG G GG G G GGGGGG GG Sbjct: 68 GGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGG 119 Score = 42.7 bits (96), Expect = 4e-04 Identities = 26/56 (46%), Positives = 26/56 (46%), Gaps = 2/56 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGG--XGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG G GGG GG GG GG G G GG G G GGGGG GG G Sbjct: 91 GGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGG---GGGYGGGGGHHGGGGHG 143 Score = 42.3 bits (95), Expect = 5e-04 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG G GGG G G GG GG G GG GGG G GG Sbjct: 84 GGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGG 135 Score = 41.9 bits (94), Expect = 6e-04 Identities = 22/55 (40%), Positives = 23/55 (41%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXW 810 G GGG GG GG G G G G G G G GGGGG G G + Sbjct: 42 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHY 96 Score = 40.3 bits (90), Expect = 0.002 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Frame = -1 Query: 982 GXGGXGGXG-GGXXGXXGXGXGGXGGGXGXXXXXXG--GXRXXXXXGGGGGXXGG 827 G GG GG G GG G G G G GGG G G G GGGG GG Sbjct: 52 GHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGG 106 Score = 40.3 bits (90), Expect = 0.002 Identities = 26/55 (47%), Positives = 26/55 (47%), Gaps = 2/55 (3%) Frame = -3 Query: 974 GXGGGGG--GXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GGGGG G GG GG GG G G GG G GGGGG GG G Sbjct: 74 GYGGGGGHYGGGGGHYGGGGGHYGGGG-GHYGGGGGHYG---GGGGGHGGGGHYG 124 Score = 36.7 bits (81), Expect = 0.024 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGG-XRXXXXXGGGGGXXGG 827 G GG G GG G G G GGG G G GGGGG GG Sbjct: 60 GHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGG 112 Score = 33.5 bits (73), Expect = 0.22 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 3/56 (5%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGG---GGGXXGXGGG 817 G GG GG G G GG G GGG GG GGG GGG Sbjct: 45 GGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGG 100 Score = 32.7 bits (71), Expect = 0.38 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 4/57 (7%) Frame = -2 Query: 975 GXXGGXGGXXXGXE--GXGXGXXGGXXXGXXXXGGGRXXXXXXG--GGGGXXGXGGG 817 G GG GG G G G G G G GGG G GGGG GGG Sbjct: 51 GGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGG 107 Score = 32.7 bits (71), Expect = 0.38 Identities = 23/53 (43%), Positives = 23/53 (43%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG G G G G G GG G GGG GGGGG G GGG Sbjct: 76 GGGGGHYGGGGGHYGGGGGHYGGGG-GHYGGGGGHY-----GGGGG--GHGGG 120 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXG 899 G GG G GGG G G G GGG G Sbjct: 116 GHGGGGHYGGGGGGYGGGGGHHGGGGHG 143 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 47.2 bits (107), Expect = 2e-05 Identities = 23/54 (42%), Positives = 23/54 (42%), Gaps = 7/54 (12%) Frame = +1 Query: 829 PPXPP-------PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PP PP PPPP P A PP P P PP PP PPPPP Sbjct: 372 PPAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPP 425 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PPPPP P PP P P PP PP PPPPPP Sbjct: 384 PPPPPPPSAAAPPPPPPPKKGPAAPP---PPPPPGKKGAGPPPPPP 426 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 7/56 (12%) Frame = +1 Query: 829 PPXPPPP----PPXPXPXAXPPXGXXPXPXP---PXXPPXPPLXXXXXPPPPPPXP 975 PP PPPP PP P P P P P P PP PP PP PP P Sbjct: 384 PPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPPGNP 439 Score = 41.9 bits (94), Expect = 6e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PP PP P PP P P PP PP PPPPP P Sbjct: 372 PPAPPGPANQTSPPP--PPPPSAAAPPPPPPPKKGPAAPPPPPPP 414 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 4/60 (6%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP----XPPXPP 977 P PP PPPP PP PPP PP P PPP PP PP Sbjct: 378 PANQTSPP-PPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPP 436 Score = 37.5 bits (83), Expect = 0.013 Identities = 24/67 (35%), Positives = 25/67 (37%), Gaps = 5/67 (7%) Frame = +2 Query: 782 LTTXXXTHSXNXP-PPXPXX----PPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPX 946 LT T + P PP P PPPPP PPP PP P P P Sbjct: 361 LTPGQFTTANAPPAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPP--PPPPPGKKG 418 Query: 947 XXPPXPP 967 PP PP Sbjct: 419 AGPPPPP 425 Score = 34.7 bits (76), Expect = 0.095 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P P PPPP PP PP PP P PP P P Sbjct: 388 PPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPPGNPKGP 442 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +1 Query: 844 PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P P A P PP PP PPPPPP Sbjct: 360 PLTPGQFTTANAPPAPPGPANQTSPPPPPPPSAAAPPPPPPP 401 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 47.2 bits (107), Expect = 2e-05 Identities = 26/52 (50%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXG-GXGXGXXPXGGXAXGX-GXGGGGGGXGG 828 GG G GGGG GG GG G G G G GG G G G GGGG GG Sbjct: 117 GGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGG 168 Score = 46.0 bits (104), Expect = 4e-05 Identities = 23/53 (43%), Positives = 23/53 (43%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G G GGG GG G G G G GG G GGGGGG GG G Sbjct: 139 GYGSGGGLGWDGGNGGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGGCGGSCSG 191 Score = 45.2 bits (102), Expect = 7e-05 Identities = 26/65 (40%), Positives = 29/65 (44%), Gaps = 2/65 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXG-GXXGGXGXGXX-PXGGXAXGXGXGGGGGGXGGXXXGXWXS 804 G GG GGG GG G G GG G G GG G GGGGG GG G + Sbjct: 147 GWDGGNGGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGGCGGSCSGGGGGGGGYGHGGVST 206 Query: 803 EXSXR 789 + S + Sbjct: 207 KGSGK 211 Score = 41.9 bits (94), Expect = 6e-04 Identities = 25/57 (43%), Positives = 25/57 (43%), Gaps = 3/57 (5%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGG---XGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG G GGGG GG GG GG G G GG G GGGG G G G Sbjct: 110 GGPGYGGGGYGPGGGGGGVVIGGGFGG-GAGYGSGGGLGWDGGNGGGGPGYGSGGGG 165 Score = 41.5 bits (93), Expect = 8e-04 Identities = 25/55 (45%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGG-GXGGXXXG 816 GG GGGG G GG G GG G G GG G G G GGG G G G Sbjct: 105 GGYGGGGPGY-----GGGGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGG 154 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/54 (42%), Positives = 23/54 (42%), Gaps = 2/54 (3%) Frame = -1 Query: 982 GXGGXGGXGGG--XXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G GG GGG G G G GG GG G GG GGGG GG Sbjct: 145 GLGWDGGNGGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGGCGGSCSGGGGGGGG 198 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGG 837 GGG GG GG G GG G G G G G GGG GG Sbjct: 131 GGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGGGGGIGG 174 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXG-GGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G G GGG G G GG G G G GG GGGGG GG Sbjct: 135 GGGAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGGCGG 187 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -1 Query: 967 GGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 GG GGG G G G G GGG G G GGG G GG Sbjct: 105 GGYGGGGPGYGGGGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGG 151 Score = 38.7 bits (86), Expect = 0.006 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Frame = -1 Query: 982 GXGGXGGXGGG--XXGXXGXGXG-GXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G GG GGG G G G G G GGG G GG GGG G GG Sbjct: 117 GGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGGGGG 171 Score = 38.3 bits (85), Expect = 0.008 Identities = 24/62 (38%), Positives = 25/62 (40%), Gaps = 4/62 (6%) Frame = -1 Query: 982 GXGGXG-GXGGGXXGXXGXGXG---GXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXX 815 G GG G G GGG G G G G G G G G GG GGGG G Sbjct: 106 GYGGGGPGYGGGGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGGG 165 Query: 814 VG 809 +G Sbjct: 166 IG 167 Score = 36.3 bits (80), Expect = 0.031 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 4/56 (7%) Frame = -1 Query: 982 GXGGXGGX---GGGXXGXXGXG-XGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG GG GGG G G G GG G G G GGGGG GG Sbjct: 120 GPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGGGGGIGGG 175 Score = 34.3 bits (75), Expect = 0.13 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Frame = -1 Query: 982 GXGGXG-GXGGGXXGXXGXGXGGXGGG--XGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG G G GGG G G GG GGG G GG GGGG GG Sbjct: 153 GGGGPGYGSGGGGIG----GGGGIGGGVIIGGGGGGCGGSCSGGGGGGGGYGHGG 203 Score = 33.5 bits (73), Expect = 0.22 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 3/51 (5%) Frame = -2 Query: 963 GXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXX--GGGGGX-XGXGG 820 G GG G G G G GG G GGG GGGGG G GG Sbjct: 153 GGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGGCGGSCSGGGGGGGGYGHGG 203 Score = 31.5 bits (68), Expect = 0.88 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G G GG G G G G GG G GGG GGG G GGG Sbjct: 144 GGLGWDGGNGGGGPGYGSG--GGGIGGGGGIGGG-VIIGGGGGGCGGSCSGGG 193 >At5g33390.1 68418.m03985 glycine-rich protein similar to nuclear antigen EBNA-1 (GI:3342234) {Cercopithecine herpesvirus 15} Length = 118 Score = 46.8 bits (106), Expect = 2e-05 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 G G G GG G G GG G G GG A G G GG G G GG Sbjct: 9 GSSGSGSGGSVSGGSGSGGSGSGGSGSGGSGSGGRANGRGNGGRGSGRGG 58 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 GG G GG G GG G G G GG G G G G GG G Sbjct: 26 GGSGSGGSGSGGSGSGGRANGRGNGGRGSGRGGGRGDGRGDGRGIGGGG 74 Score = 39.1 bits (87), Expect = 0.004 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRG-GXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 GG G GG G G G GG G G G G G G GGGG G G Sbjct: 31 GGSGSGGSGSGGRANGRGNGGRGSGRGGGRGD--GRGDGRGIGGGGRGRG 78 Score = 36.7 bits (81), Expect = 0.024 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 2/55 (3%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXG-GXAXGXGXGGGGG-GXGGXXXG 816 G GG G G G GG G G G G G G G G G G G GG G Sbjct: 24 GSGGSGSGGSGSGGSGSGGRANGRGNGGRGSGRGGGRGDGRGDGRGIGGGGRGRG 78 Score = 35.9 bits (79), Expect = 0.041 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GG G GG G G G G G G GGG G G G Sbjct: 16 GGSVSGGSGSGGSGSGGSGSGGSGSGGRANGRGNGGRGSGRGGGRGDGRGDGRG 69 Score = 35.5 bits (78), Expect = 0.054 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXG-GGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G G G G G G GG G GG G GG GG G GG Sbjct: 6 GGSGSSGSGSGGSVSGGSGSGGSGSGGSGSGGSGSGGRANGRGNGGRGSGRGG 58 Score = 33.5 bits (73), Expect = 0.22 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 3/51 (5%) Frame = -3 Query: 959 GGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGG---GGGXGGXXXG 816 GGG G G GG G G GG G GG G G GG G Sbjct: 5 GGGSGSSGSGSGGSVSGGSGSGGSGSGGSGSGGSGSGGRANGRGNGGRGSG 55 Score = 33.5 bits (73), Expect = 0.22 Identities = 18/58 (31%), Positives = 19/58 (32%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 G GG G G G G G G G G G GGG G G +G Sbjct: 14 GSGGSVSGGSGSGGSGSGGSGSGGSGSGGRANGRGNGGRGSGRGGGRGDGRGDGRGIG 71 Score = 33.5 bits (73), Expect = 0.22 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXG 830 G G GG G G G G G GG G G G GGG G Sbjct: 26 GGSGSGGSGSGGSGSGGRANGRGNGGRGSGRGGGRGDGRGDGRGIGGGGRG 76 Score = 33.1 bits (72), Expect = 0.29 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXG-GGGGGXGGXXXG 816 GG G GG G GG G G G GG G G G G G G G G Sbjct: 21 GGSGSGGSGSGGSGSGGSGSGGRANGRGN---GGRGSGRGGGRGDGRGDGRGIGG 72 Score = 31.9 bits (69), Expect = 0.67 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXG-GGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G G GG G G G GG G GG G G G GGG G Sbjct: 12 GSGSGGSVSGG-SGSGGSGSGGSGSGGSGSGGRANGRGNGGRGSGRGGGRGDG 63 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -1 Query: 982 GXGGXG-GXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXG 830 G G G G GG G G G G G G G GGGG G Sbjct: 27 GSGSGGSGSGGSGSGGRANGRGNGGRGSGRGGGRGDGRGDGRGIGGGGRGRG 78 Score = 29.1 bits (62), Expect = 4.7 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = -2 Query: 963 GXGGXXXGXEGXGXGXXGGXXXGXXXXG--GGRXXXXXXGGGGGXXGXGGG 817 G GG G G G GG G G GR G G G G GGG Sbjct: 24 GSGGSGSGGSGSGGSGSGGRANGRGNGGRGSGRGGGRGDGRGDGR-GIGGG 73 Score = 28.3 bits (60), Expect = 8.2 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G G G G G GG G GG G G G G G G Sbjct: 5 GGGSGSSGSGSGGSVSGGSGSGGSGSGGSGSGGSGSGGRANGRGNGGRGSGRG 57 >At2g05440.1 68415.m00574 glycine-rich protein Length = 127 Score = 46.8 bits (106), Expect = 2e-05 Identities = 25/56 (44%), Positives = 25/56 (44%), Gaps = 2/56 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGG--GGGXGGXXXG 816 GG GGGGG GG G G G G GG G GGG GGG GG G Sbjct: 51 GGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGGYGGG 106 Score = 44.4 bits (100), Expect = 1e-04 Identities = 26/55 (47%), Positives = 26/55 (47%), Gaps = 2/55 (3%) Frame = -3 Query: 974 GXGG--GGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GG GGGG GG GG GG G G GG G G GG GGG G G Sbjct: 60 GHGGHNGGGGHGLDGYGGGGGHYGG-GGGHYGGGGGHYGGGGGGYGGGGGHHGGG 113 Score = 43.6 bits (98), Expect = 2e-04 Identities = 24/58 (41%), Positives = 24/58 (41%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 G GG G GG G G G GG GG G GG GGGGG GG G Sbjct: 42 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGG--GGGHYGGGGGHYGGGGGHYG 97 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/55 (45%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Frame = -1 Query: 982 GXGGXGGXG-GGXXGXXGXGXGGXGGGXGXXXXXXG--GXRXXXXXGGGGGXXGG 827 G GG GG G GG G G G G GGG G G G GGGGG GG Sbjct: 52 GHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGGYGGG 106 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/54 (44%), Positives = 24/54 (44%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GG GGG G GG GG G G GG G GGG G GG G Sbjct: 48 GGHGGHGGGGGH----GHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYG 97 Score = 41.9 bits (94), Expect = 6e-04 Identities = 22/55 (40%), Positives = 23/55 (41%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXW 810 G GGG GG GG G G G G G G G GGGGG G G + Sbjct: 42 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHY 96 Score = 37.9 bits (84), Expect = 0.010 Identities = 25/54 (46%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Frame = -1 Query: 982 GXGGXG--GXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG G G GGG G G G G GGG G GG GGGGG GG Sbjct: 66 GGGGHGLDGYGGG-GGHYGGGGGHYGGGGGHYGGGGGG------YGGGGGHHGG 112 Score = 37.5 bits (83), Expect = 0.013 Identities = 22/49 (44%), Positives = 22/49 (44%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 G G GGGG GG GG GG G GG G G GGGG G Sbjct: 71 GLDGYGGGGGHY---GGGGGHYGGGGGHYGGGGGGYGGGGGHHGGGGHG 116 Score = 33.5 bits (73), Expect = 0.22 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 3/56 (5%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGG---GGGXXGXGGG 817 G GG GG G G GG G GGG GG GGG GGG Sbjct: 45 GGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGG 100 Score = 32.7 bits (71), Expect = 0.38 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 4/57 (7%) Frame = -2 Query: 975 GXXGGXGGXXXGXE--GXGXGXXGGXXXGXXXXGGGRXXXXXXG--GGGGXXGXGGG 817 G GG GG G G G G G G GGG G GGGG GGG Sbjct: 51 GGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGGYGGGG 107 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 46.8 bits (106), Expect = 2e-05 Identities = 24/51 (47%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = -3 Query: 977 GGXG-GGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG G GG GG GG G GG G G GG + G GGGGG GG Sbjct: 117 GGRGFGGPGGGYGASDGGYGAPAGGYGGGAGGYGGNSSYSGNAGGGGGYGG 167 Score = 40.7 bits (91), Expect = 0.001 Identities = 23/69 (33%), Positives = 25/69 (36%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRV 803 G G GG GGG G G G GG G GG GGGG GG G Sbjct: 117 GGRGFGGPGGGYGASDG-GYGAPAGGYGGGAGGYGGNSSYSGNAGGGGGYGGNSSYGGNA 175 Query: 802 SXAXGSQXF 776 G+ + Sbjct: 176 GGYGGNPPY 184 Score = 35.5 bits (78), Expect = 0.054 Identities = 25/63 (39%), Positives = 25/63 (39%), Gaps = 9/63 (14%) Frame = -3 Query: 977 GGXGGGGGGXXXXXR-GGXGGXXGGXGXGXXPXGGXAXGXGXG--------GGGGGXGGX 825 GG GGG GG G G GG G G GG A G G GGGGG G Sbjct: 140 GGYGGGAGGYGGNSSYSGNAGGGGGYG-GNSSYGGNAGGYGGNPPYSGNAVGGGGGYGSN 198 Query: 824 XXG 816 G Sbjct: 199 FGG 201 Score = 35.5 bits (78), Expect = 0.054 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG G GG GG GG G GG G GGG G GG Sbjct: 161 GGGGYGGNSSYGGNAGGYGGNPPYSGNAVGGGGGYGSNFGGGGGYGVAGG 210 Score = 34.7 bits (76), Expect = 0.095 Identities = 24/54 (44%), Positives = 24/54 (44%), Gaps = 5/54 (9%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXG-----GGGGGXG 831 GG GG GG GG GG G G P G A G G G GGGGG G Sbjct: 160 GGGGGYGG------NSSYGGNAGGYG-GNPPYSGNAVGGGGGYGSNFGGGGGYG 206 Score = 33.5 bits (73), Expect = 0.22 Identities = 27/82 (32%), Positives = 29/82 (35%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRVSX 797 GG GG GG G GG GG GG GGGG G G + Sbjct: 160 GGGGGYGGN--SSYGGNAGGYGGNPPYSGNAVGGGGGYGSNFGGGGGYGVAGGVGGSENF 217 Query: 796 AXGSQXFXQXD*SNDXNRQELG 731 A GS D + N Q LG Sbjct: 218 AQGSSTNAGFDDKFESN-QPLG 238 Score = 31.5 bits (68), Expect = 0.88 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -1 Query: 943 GXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRVSXAXG 788 G G G GG GGG G G GGG G GG G G Sbjct: 115 GFGGRGFGGPGGGYGASDGGYGA--PAGGYGGGAGGYGGNSSYSGNAGGGGG 164 Score = 31.1 bits (67), Expect = 1.2 Identities = 23/73 (31%), Positives = 25/73 (34%) Frame = -1 Query: 973 GXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRVSXA 794 G G GGG G GG GG G G GGG G G G Sbjct: 157 GNAGGGGGYGG--NSSYGGNAGGYGGNPPYSGN---AVGGGGGYGSNFGGGGGYGVAGGV 211 Query: 793 XGSQXFXQXD*SN 755 GS+ F Q +N Sbjct: 212 GGSENFAQGSSTN 224 Score = 28.3 bits (60), Expect = 8.2 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGG 842 G GG GG G GGG G GG G GG Sbjct: 167 GNSSYGGNAGGYGGNPPYSGNAVGGGGGYGSNFGGGGGYGVAGGVGG 213 >At1g29380.1 68414.m03592 hypothetical protein Length = 228 Score = 46.8 bits (106), Expect = 2e-05 Identities = 27/58 (46%), Positives = 27/58 (46%), Gaps = 2/58 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGG--GGXGGXXXGXW 810 GG GGGGG G GG GG G G G A G G GGGG G GG G W Sbjct: 97 GGDVGGGGG------GYGGGTPGGGGGGGGDTGAGAGGGGYGGGGDTGAGGGVGSGQW 148 Score = 38.3 bits (85), Expect = 0.008 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G GG GGG G G GG GGG GG G GGG G Sbjct: 96 GGGDVGGGGGGYGGGT-PGGGGGGGGDTGAGAGGGGYGGGGDTGAGGGVGSG 146 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 896 GXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G P GG G G GG GGG G G Sbjct: 91 GTTPPGGGDVGGGGGGYGGGTPGGGGG 117 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 942 GXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXG 823 G G G G GG G GGG GGGG G G Sbjct: 98 GDVGGGGGGYGGGTPGGGGGGGG--DTGAGAGGGGYGGGG 135 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 46.8 bits (106), Expect = 2e-05 Identities = 26/70 (37%), Positives = 28/70 (40%), Gaps = 8/70 (11%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP---XXPPXPPLXXXXXPPPP- 963 +YS P PPPPP PP P P PP PP PP PPPP Sbjct: 136 VYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPY 195 Query: 964 ----PPXPPF 981 PP PP+ Sbjct: 196 VYKSPPPPPY 205 Score = 44.0 bits (99), Expect = 2e-04 Identities = 25/70 (35%), Positives = 27/70 (38%), Gaps = 8/70 (11%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP---XXPPXPPLXXXXXPPPP- 963 +YS P PPPPP PP P PP PP PP PPPP Sbjct: 66 IYSSPPPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPY 125 Query: 964 ----PPXPPF 981 PP PP+ Sbjct: 126 VYKSPPPPPY 135 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/70 (35%), Positives = 27/70 (38%), Gaps = 8/70 (11%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP---XXPPXPPLXXXXXPPPP- 963 +YS P PPPPP PP P PP PP PP PPPP Sbjct: 96 VYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPY 155 Query: 964 ----PPXPPF 981 PP PP+ Sbjct: 156 VYKSPPPPPY 165 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/70 (35%), Positives = 27/70 (38%), Gaps = 8/70 (11%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP---XXPPXPPLXXXXXPPPP- 963 +YS P PPPPP PP P PP PP PP PPPP Sbjct: 186 VYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPY 245 Query: 964 ----PPXPPF 981 PP PP+ Sbjct: 246 VYSSPPPPPY 255 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/70 (35%), Positives = 27/70 (38%), Gaps = 8/70 (11%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP---XXPPXPPLXXXXXPPPP- 963 +YS P PPPPP PP P PP PP PP PPPP Sbjct: 206 VYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPY 265 Query: 964 ----PPXPPF 981 PP PP+ Sbjct: 266 VYSSPPPPPY 275 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/70 (35%), Positives = 27/70 (38%), Gaps = 8/70 (11%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP---XXPPXPPLXXXXXPPPP- 963 +YS P PPPPP PP P PP PP PP PPPP Sbjct: 226 VYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPY 285 Query: 964 ----PPXPPF 981 PP PP+ Sbjct: 286 VYSSPPPPPY 295 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/70 (35%), Positives = 27/70 (38%), Gaps = 8/70 (11%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP---XXPPXPPLXXXXXPPPP- 963 +YS P PPPPP PP P PP PP PP PPPP Sbjct: 246 VYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPY 305 Query: 964 ----PPXPPF 981 PP PP+ Sbjct: 306 VYSSPPPPPY 315 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/70 (35%), Positives = 27/70 (38%), Gaps = 8/70 (11%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP---XXPPXPPLXXXXXPPPP- 963 +YS P PPPPP PP P PP PP PP PPPP Sbjct: 266 VYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPY 325 Query: 964 ----PPXPPF 981 PP PP+ Sbjct: 326 VYTSPPPPPY 335 Score = 43.2 bits (97), Expect = 3e-04 Identities = 25/70 (35%), Positives = 27/70 (38%), Gaps = 8/70 (11%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP---XXPPXPPLXXXXXPPPP- 963 +YS P PPPPP PP P PP PP PP PPPP Sbjct: 166 VYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPY 225 Query: 964 ----PPXPPF 981 PP PP+ Sbjct: 226 VYSSPPPPPY 235 Score = 42.3 bits (95), Expect = 5e-04 Identities = 24/70 (34%), Positives = 27/70 (38%), Gaps = 8/70 (11%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP---XXPPXPPLXXXXXPPPP- 963 +Y+ P PPPPP PP P PP PP PP PPPP Sbjct: 86 VYNSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPY 145 Query: 964 ----PPXPPF 981 PP PP+ Sbjct: 146 VYSSPPPPPY 155 Score = 41.9 bits (94), Expect = 6e-04 Identities = 24/70 (34%), Positives = 26/70 (37%), Gaps = 8/70 (11%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP---XXPPXPPLXXXXXPPPP- 963 +Y P PPPPP PP P PP PP PP PPPP Sbjct: 126 VYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPY 185 Query: 964 ----PPXPPF 981 PP PP+ Sbjct: 186 VYSSPPPPPY 195 Score = 41.9 bits (94), Expect = 6e-04 Identities = 24/70 (34%), Positives = 26/70 (37%), Gaps = 8/70 (11%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP---XXPPXPPLXXXXXPPPP- 963 +Y P PPPPP PP P PP PP PP PPPP Sbjct: 156 VYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPY 215 Query: 964 ----PPXPPF 981 PP PP+ Sbjct: 216 VYKSPPPPPY 225 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 9/55 (16%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPP-----XPPXPXPXXPXXPPP----XPPXPP 977 PPPPP PP P PPP PP P P PPP PP PP Sbjct: 130 PPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPP 184 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/61 (37%), Positives = 24/61 (39%), Gaps = 3/61 (4%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXX---PPXPPLXXXXXPPPPP 966 +YS P PPPPP PP P PP PP PP PPPPP Sbjct: 116 VYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYS--PPPPP 173 Query: 967 P 969 P Sbjct: 174 P 174 Score = 39.9 bits (89), Expect = 0.003 Identities = 24/63 (38%), Positives = 25/63 (39%), Gaps = 13/63 (20%) Frame = +1 Query: 832 PXPPP----PPPXPXPXAXPPXGXXPXPXPPXX----PPXPPLXXXXXPPPP-----PPX 972 P PPP PPP PP P PP PP PP PPPP PP Sbjct: 53 PSPPPYVYKPPPYIYSSPPPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPP 112 Query: 973 PPF 981 PP+ Sbjct: 113 PPY 115 Score = 39.5 bits (88), Expect = 0.003 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 5/55 (9%) Frame = +2 Query: 818 PPPXPX---XPPPPPXXXXXXRPPPXXXXPXXXPP--XXPXPXPSXPXXXPPXPP 967 PPP P PPPPP PPP PP P P P PP PP Sbjct: 130 PPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPP 184 Score = 39.5 bits (88), Expect = 0.003 Identities = 24/71 (33%), Positives = 26/71 (36%), Gaps = 9/71 (12%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP---XXPPXPPLXXXXXPPPP- 963 +YS P PPPPP PP P PP PP PP PPPP Sbjct: 286 VYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYTSPPPPPYVYKSPPPPPY 345 Query: 964 -----PPXPPF 981 PP P+ Sbjct: 346 VDSYSPPPAPY 356 Score = 39.1 bits (87), Expect = 0.004 Identities = 23/65 (35%), Positives = 25/65 (38%), Gaps = 10/65 (15%) Frame = +1 Query: 817 PXXXPPXPP-----PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP-----P 966 P P PP PPP + PP P P PP PP PPPP P Sbjct: 31 PTPYSPLPPYVYNSPPPYVYNSPSPPPYVYKPPPYIYSSPPPPPYVYSSPPPPPYVYNSP 90 Query: 967 PXPPF 981 P PP+ Sbjct: 91 PPPPY 95 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PPP PPPPP PPP PP P P PP P Sbjct: 162 PPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 214 Score = 38.3 bits (85), Expect = 0.008 Identities = 23/68 (33%), Positives = 24/68 (35%), Gaps = 7/68 (10%) Frame = +1 Query: 799 YSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXP--PXXPPXPPLXXXXXPPPP--- 963 Y P PPPP P P P P P PP PP PPPP Sbjct: 58 YVYKPPPYIYSSPPPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPPPPYVY 117 Query: 964 --PPXPPF 981 PP PP+ Sbjct: 118 SSPPPPPY 125 Score = 37.9 bits (84), Expect = 0.010 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = +2 Query: 818 PPPXPX---XPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PPP P PPPPP PPP PP P P P PP Sbjct: 120 PPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPP 172 Score = 36.3 bits (80), Expect = 0.031 Identities = 18/58 (31%), Positives = 19/58 (32%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 +S PPP PPPP PPP PP P P PP P Sbjct: 167 YSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 224 Score = 35.9 bits (79), Expect = 0.041 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 8/58 (13%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPP---XPPXPXPXXPXXPPPXP-----PXPP 977 PP PPP PP P PPP P P P PPP P P PP Sbjct: 56 PPYVYKPPPYIYSSPPPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPPP 113 Score = 35.9 bits (79), Expect = 0.041 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 2/57 (3%) Frame = +2 Query: 812 NXPPPXPX--XPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 N PPP P PPPP PPP PP P P PP P Sbjct: 88 NSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 144 Score = 34.7 bits (76), Expect = 0.095 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PPP PPPP PPP PP P P PP P Sbjct: 62 PPPYIYSSPPPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPPPP 114 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Frame = +2 Query: 812 NXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPP--XXPXPXPSXPXXXPPXPP 967 N P P P PPP PPP PP P P PP PP Sbjct: 51 NSPSPPPYVYKPPPYIYSSPPPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPPPP 104 Score = 33.5 bits (73), Expect = 0.22 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 12/55 (21%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPX-------PP-----XPXPXXPXXPPPXPP 968 PPPPP PP P PPP PP P P PPP PP Sbjct: 120 PPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPP 174 Score = 33.5 bits (73), Expect = 0.22 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 5/51 (9%) Frame = +1 Query: 829 PPXP-----PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 PP P PPPPP + PP P PP PP PPP P Sbjct: 331 PPPPYVYKSPPPPPYVDSYSPPPAPYVYKP-PPYVYKPPPYVYNYSPPPAP 380 Score = 32.7 bits (71), Expect = 0.38 Identities = 24/72 (33%), Positives = 26/72 (36%), Gaps = 8/72 (11%) Frame = +1 Query: 790 LXLYSLXQXPXXX-PPXPPPPPPXPX-PXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 L LYS+ P P P P P PP P PP PP PPPP Sbjct: 14 LALYSMVAYTSAQYSPTPTPYSPLPPYVYNSPPPYVYNSPSPPPYVYKPPPYIYSSPPPP 73 Query: 964 ------PPXPPF 981 PP PP+ Sbjct: 74 PYVYSSPPPPPY 85 Score = 31.5 bits (68), Expect = 0.88 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 5/52 (9%) Frame = +2 Query: 818 PPPXPX---XPPPPPXXXXXXRPPPXXXXPXXXPPXXP--XPXPSXPXXXPP 958 PPP P PPPPP PPP PP P P+ PP Sbjct: 310 PPPPPYVYKSPPPPPYVYTSPPPPPYVYKSPPPPPYVDSYSPPPAPYVYKPP 361 Score = 31.5 bits (68), Expect = 0.88 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPP PPP PP P P P P Sbjct: 321 PPPPYVYTSPPPPPYVYKSPPPPPYVDSYSPPPAPYVYKPPPYVYKPPP 369 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/56 (30%), Positives = 18/56 (32%), Gaps = 2/56 (3%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPP--XXPXPXPSXPXXXPPXP 964 +S PPP PPPP PPP PP P P P P Sbjct: 307 YSSPPPPPYVYKSPPPPPYVYTSPPPPPYVYKSPPPPPYVDSYSPPPAPYVYKPPP 362 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 4/48 (8%) Frame = +3 Query: 846 PPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXP----PXPP 977 PPP + PP P P P P P P P P P PP Sbjct: 394 PPPAPYVYKPPPYVYSYSPPPAPYVYKPPPYVYSSPSPPPYYSSPSPP 441 Score = 29.9 bits (64), Expect = 2.7 Identities = 24/74 (32%), Positives = 26/74 (35%), Gaps = 14/74 (18%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPP------PXPXPXA--XPPXGXXPXPXPPXXPPXPPLXXXXX 951 +Y+ P PPPPP P P P PP P P P PP Sbjct: 326 VYTSPPPPPYVYKSPPPPPYVDSYSPPPAPYVYKPPPYVYKPPPYVYNYSP-PPAPYVYK 384 Query: 952 PPP------PPPXP 975 PPP PPP P Sbjct: 385 PPPYVYSYSPPPAP 398 Score = 29.5 bits (63), Expect = 3.6 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +1 Query: 847 PPPXPXPXAXPP--XGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 PPP P PP P P P P PP PPP P Sbjct: 376 PPPAPYVYKPPPYVYSYSPPPAPYVYKP-PPYVYSYSPPPAP 416 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 7/53 (13%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPX-------PPXPXPXXPXXPPPXPPXPP 977 PPPPP PP P PPP PP P P PP Sbjct: 310 PPPPPYVYKSPPPPPYVYTSPPPPPYVYKSPPPPPYVDSYSPPPAPYVYKPPP 362 Score = 28.7 bits (61), Expect = 6.2 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 4/54 (7%) Frame = +1 Query: 829 PPXPPP----PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PP PPP P PP P P P PP PPP PP Sbjct: 320 PPPPPYVYTSPPPPPYVYKSPP----PPPYVDSYSP-PPAPYVYKPPPYVYKPP 368 Score = 28.7 bits (61), Expect = 6.2 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 6/52 (11%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPXP------PXPXPXXPXXPPPXPPXPP 977 PPPPP PP PPP P P P P PPP PP Sbjct: 320 PPPPPY--VYTSPPPPPYVYKSPPPPPYVDSYSPPPAPYV-YKPPPYVYKPP 368 Score = 28.7 bits (61), Expect = 6.2 Identities = 14/41 (34%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +3 Query: 846 PPPXXXXXRXPPXXXXXXPXPPPXPPXPXP-XXPXXPPPXP 965 PPP + PP P P P P P PPP P Sbjct: 376 PPPAPYVYKPPPYVYSYSPPPAPYVYKPPPYVYSYSPPPAP 416 Score = 28.7 bits (61), Expect = 6.2 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 7/54 (12%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPP------PPPXPXPXAXPPXGXX-PXPXPPXXPPXPPL 936 +YS P PPP PPP P PP P P P P PPL Sbjct: 389 VYSYSPPPAPYVYKPPPYVYSYSPPPAPYVYKPPPYVYSSPSPPPYYSSPSPPL 442 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 46.4 bits (105), Expect = 3e-05 Identities = 24/58 (41%), Positives = 24/58 (41%), Gaps = 8/58 (13%) Frame = +1 Query: 829 PPXP----PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPP 978 PP P PPPPP PP P P P P PP PPPP PP PP Sbjct: 54 PPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPP 111 Score = 46.4 bits (105), Expect = 3e-05 Identities = 24/58 (41%), Positives = 24/58 (41%), Gaps = 8/58 (13%) Frame = +1 Query: 829 PPXP----PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPP 978 PP P PPPPP PP P P P P PP PPPP PP PP Sbjct: 63 PPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPP 120 Score = 46.4 bits (105), Expect = 3e-05 Identities = 24/58 (41%), Positives = 24/58 (41%), Gaps = 8/58 (13%) Frame = +1 Query: 829 PPXP----PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPP 978 PP P PPPPP PP P P P P PP PPPP PP PP Sbjct: 90 PPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPP 147 Score = 46.0 bits (104), Expect = 4e-05 Identities = 24/58 (41%), Positives = 24/58 (41%), Gaps = 8/58 (13%) Frame = +1 Query: 829 PPXP----PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPP 978 PP P PPPPP PP P P P P PP PPPP PP PP Sbjct: 81 PPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPP 138 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 4/50 (8%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPP 978 PPPPP PP P P P P PP PPPP PP PP Sbjct: 44 PPPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPP 93 Score = 43.6 bits (98), Expect = 2e-04 Identities = 24/59 (40%), Positives = 25/59 (42%), Gaps = 9/59 (15%) Frame = +1 Query: 829 PPXPP-----PPPPXPXPXAXPPXGXXPXPXPPXX-PPXPPLXXXXXPPP---PPPXPP 978 PP PP PPPP PP P P P PP PP+ PPP PP PP Sbjct: 44 PPPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPP 102 Score = 43.6 bits (98), Expect = 2e-04 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 7/57 (12%) Frame = +1 Query: 829 PPXP----PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP---PPXPP 978 PP P PPPPP PP P P P P PP PPP PP PP Sbjct: 117 PPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSPPPPTVTRPPPPP 173 Score = 41.9 bits (94), Expect = 6e-04 Identities = 28/72 (38%), Positives = 30/72 (41%), Gaps = 11/72 (15%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPP----PPPXPXPXAXPPXGXXPXPXPP---XXPPXPPLXXXXXP 954 L S P P PPP PPP P + PP P PP PP PP+ P Sbjct: 95 LLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPV--LLSP 152 Query: 955 PPPP----PXPP 978 PPPP P PP Sbjct: 153 PPPPVLFSPPPP 164 Score = 41.5 bits (93), Expect = 8e-04 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 4/51 (7%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPP 978 PPPPP P PP P P P P PP PPPP PP PP Sbjct: 80 PPPPPVNLSP-PPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPP 129 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/63 (38%), Positives = 25/63 (39%), Gaps = 6/63 (9%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPP----PPPXPXPXAXPPXGXXPXPXPPXX--PPXPPLXXXXXPP 957 L S P P PPP PPP P + PP P PP PP PP PP Sbjct: 122 LLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSPPPPTVTRPPPPPTITRSPPP 181 Query: 958 PPP 966 P P Sbjct: 182 PRP 184 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PPP P PPP PPP PP P P PP PP Sbjct: 62 PPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPP 111 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PPP P PPP PPP PP P P PP PP Sbjct: 71 PPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPP 120 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PPP P PPP PPP PP P P PP PP Sbjct: 80 PPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPP 129 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PPP P PPP PPP PP P P PP PP Sbjct: 89 PPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPP 138 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PPP P PPP PPP PP P P PP PP Sbjct: 98 PPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPP 147 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PPP P PPP PPP PP P P PP PP Sbjct: 107 PPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPP 156 Score = 39.5 bits (88), Expect = 0.003 Identities = 22/64 (34%), Positives = 23/64 (35%), Gaps = 4/64 (6%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPP----PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 L S P P PP PPPP + PP PP PP PPP Sbjct: 149 LLSPPPPPVLFSPPPPTVTRPPPPPTITRSPPPPRPQAAAYYKKTPPPPPYKYGRVYPPP 208 Query: 964 PPXP 975 PP P Sbjct: 209 PPPP 212 Score = 39.1 bits (87), Expect = 0.004 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PPP PPPP PPP P PP P P PP PP Sbjct: 54 PPPPVNLSPPPPPVNLSPPPPPVNLSP-PPPPVNLSPPPPPVLLSPPPPP 102 Score = 38.3 bits (85), Expect = 0.008 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 6/56 (10%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPP---XPPXPXPXXPXXPPP---XPPXPP 977 PP PPP PP P PPP PP P PPP PP PP Sbjct: 56 PPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPP 111 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 6/52 (11%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP------PPPPXP 975 PPPPP P PP P P P P PP PP PPPP P Sbjct: 134 PPPPPVNLSP-PPPPVLLSPPPPPVLFSPPPPTVTRPPPPPTITRSPPPPRP 184 Score = 36.3 bits (80), Expect = 0.031 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP PPP P PP P P PP P Sbjct: 117 PPPPVLLSPPPPPVLLSPPPPPVNLSP-PPPPVLLSPPPPPVLFSPPPP 164 Score = 34.7 bits (76), Expect = 0.095 Identities = 25/72 (34%), Positives = 26/72 (36%), Gaps = 11/72 (15%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPP-----PPPPXPXPXAXPPXGXXPXPX------PPXXPPXPPLXX 942 L+S PP PP PPPP P A P P PP PP PP Sbjct: 158 LFSPPPPTVTRPPPPPTITRSPPPPRPQAAAYYKKTPPPPPYKYGRVYPP--PPPPPQAA 215 Query: 943 XXXPPPPPPXPP 978 PPP PP Sbjct: 216 RSYKRSPPPPPP 227 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPP---XPPXPXPXXPXXPPPXPPXPP 977 PP PPP PP P PP PP P P PP PP Sbjct: 146 PPVLLSPPPPPVLFSPPPPTVTRPPPPPTITRSPPPPRPQAAAYYKKTPPPPP 198 Score = 33.9 bits (74), Expect = 0.17 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 13/59 (22%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXP-----PPXP----PXPXPXXPXXPPP----XPPXPP 977 PPPPP PP P P PP P P P P PPP PP PP Sbjct: 62 PPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPP 120 Score = 33.9 bits (74), Expect = 0.17 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 13/59 (22%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXP-----PPXP----PXPXPXXPXXPPP----XPPXPP 977 PPPPP PP P P PP P P P P PPP PP PP Sbjct: 71 PPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPP 129 Score = 33.9 bits (74), Expect = 0.17 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 13/59 (22%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXP-----PPXP----PXPXPXXPXXPPP----XPPXPP 977 PPPPP PP P P PP P P P P PPP PP PP Sbjct: 89 PPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPP 147 Score = 33.9 bits (74), Expect = 0.17 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 13/59 (22%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXP-----PPXP----PXPXPXXPXXPPP----XPPXPP 977 PPPPP PP P P PP P P P P PPP PP PP Sbjct: 98 PPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPP 156 Score = 33.5 bits (73), Expect = 0.22 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = +2 Query: 818 PPPXPXX---PPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 P P P PPPPP PPP PP P P PP PP Sbjct: 34 PEPAPLVDLSPPPPP--VNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPP 84 Score = 33.5 bits (73), Expect = 0.22 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 PP PPP PP P PPP P P P PP P Sbjct: 137 PPVNLSPPPPPVLLSPPPPPVLFSP-PPPTVTRPPPPPTITRSPPPPRP 184 Score = 31.5 bits (68), Expect = 0.88 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 5/48 (10%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXP-----PPXPPXPXPXXPXXPPPXPP 968 PPPPP PP P P PP P P P P PP Sbjct: 125 PPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSPPPPTVTRPPPP 172 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/55 (29%), Positives = 16/55 (29%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 PT PP P PP PP PP P P PP P Sbjct: 173 PTITRSPPPPRPQAAAYYKKTPPPPPYKYGRVYPPPPPPPQAARSYKRSPPPPPP 227 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 3/46 (6%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXX---PPXPPLXXXXXPPPPPP 969 PPPPP PP P PP PP PPPP Sbjct: 194 PPPPPYKYGRVYPPPPPPPQAARSYKRSPPPPPPSKYGRVYSPPPP 239 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXX---PXPPPXPPXPXPXXPXXPPPXPP 968 PPPPP PP PPP P P PPP PP Sbjct: 169 PPPPPTITRSPPPPRPQAAAYYKKTPPPPPYKYGRVYP--PPPPPP 212 Score = 28.3 bits (60), Expect = 8.2 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 5/60 (8%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXPXS 982 PPP PPPP PPP PP P P P PP P S Sbjct: 171 PPPTITRSPPPPRPQAAAYYKKTPPPPPYKYGRVYPP--PPPPPQAARSYKRSPPPPPPS 228 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 46.4 bits (105), Expect = 3e-05 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = +1 Query: 832 PXPPPPPPXPXPXAX-PPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PPPPPP A PP P PP PP PPPPP PP Sbjct: 14 PLPPPPPPLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPP 63 Score = 39.5 bits (88), Expect = 0.003 Identities = 26/67 (38%), Positives = 26/67 (38%), Gaps = 3/67 (4%) Frame = +1 Query: 784 DYLXLYSLXQXPXXXPPXP---PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXP 954 D YSL P PP P PP P P PP PP PPL P Sbjct: 5 DISGAYSLVPLPPPPPPLMRRRAPLPPPPPPPLMRRRA------PP--PPPPPLMRRRAP 56 Query: 955 PPPPPXP 975 PPPPP P Sbjct: 57 PPPPPPP 63 Score = 37.5 bits (83), Expect = 0.013 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 3/52 (5%) Frame = +3 Query: 831 PXXPPPPPXXXXXRX---PPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PPPPP PP PP PP P PPP PP P Sbjct: 14 PLPPPPPPLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLP 65 Score = 37.5 bits (83), Expect = 0.013 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 3/52 (5%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPX---PPPXPPXPXPXXPXXPP 956 P P PPPPP R PP PPP PP P P PP Sbjct: 21 PLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLPRPCSRPP 72 Score = 35.1 bits (77), Expect = 0.072 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 824 PXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP 958 P P PPPP PPP PP P P P PP Sbjct: 28 PLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLPRPCSRPP 72 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 46.4 bits (105), Expect = 3e-05 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXP---PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P PP PP P PP P P P PP P PPPP PP Sbjct: 53 PRLPPPFPALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPP 109 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP PP P P P PP PP PPPPPP P Sbjct: 60 PALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEP 113 Score = 44.8 bits (101), Expect = 9e-05 Identities = 21/59 (35%), Positives = 21/59 (35%) Frame = +3 Query: 801 LTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 L P PP PPP P PP P PP P P PPP P PP Sbjct: 32 LVFPLLPLSPPPSPPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPPPPLPRLPP 90 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/50 (44%), Positives = 23/50 (46%), Gaps = 2/50 (4%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP--PPXP 975 P PPP P P P + P P P P PP PPL PPP PP P Sbjct: 38 PLSPPPSPPPSPSSPP---RLPPPFPALFPPEPPLPPRFELPPPLFPPPP 84 Score = 41.9 bits (94), Expect = 6e-04 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PPP P P PP P PP PP L PPPP P P Sbjct: 41 PPPSPPPSPSSPPRLPPPFPALFPPEPP-LPPRFELPPPLFPPPPLPRLP 89 Score = 41.5 bits (93), Expect = 8e-04 Identities = 23/58 (39%), Positives = 23/58 (39%), Gaps = 4/58 (6%) Frame = +1 Query: 817 PXXXPPXPPPPP--PXPXPXAXPPXGXXPX--PXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P PP P P P PP P PP P PPL P PPP P Sbjct: 42 PPSPPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEP 99 Score = 41.5 bits (93), Expect = 8e-04 Identities = 25/57 (43%), Positives = 25/57 (43%), Gaps = 7/57 (12%) Frame = +1 Query: 829 PPXPP-----PP--PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PP PP PP P P PP P PP PP PP PPP P PP Sbjct: 67 PPLPPRFELPPPLFPPPPLPRLPPPL-LPPPEEPPREPPPPP------PPPEEPPPP 116 Score = 39.5 bits (88), Expect = 0.003 Identities = 30/92 (32%), Positives = 30/92 (32%), Gaps = 3/92 (3%) Frame = +3 Query: 711 CPPPETMP--SSCRFXSXDQSXCXXX*LPXAXLTL-PTXXXXPPXXPPPPPXXXXXRXPP 881 CPPP P S S LP L P PP PPP PP Sbjct: 28 CPPPLVFPLLPLSPPPSPPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPL-----FPP 82 Query: 882 XXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P P PP P P PPP P PP Sbjct: 83 PPLPRLPPPLLPPPEEPPREPPPPPPPPEEPP 114 Score = 37.5 bits (83), Expect = 0.013 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 6/52 (11%) Frame = +2 Query: 821 PPXPXXPP----PPPXXXXXXRP--PPXXXXPXXXPPXXPXPXPSXPXXXPP 958 PP P PP PPP P PP P PP P P P P PP Sbjct: 64 PPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPP 115 Score = 36.7 bits (81), Expect = 0.024 Identities = 24/63 (38%), Positives = 24/63 (38%), Gaps = 8/63 (12%) Frame = +2 Query: 818 PPPXPXX-PPPPPXXXXXXRPPPXXXXPXXX---PPXXPXPX--PSXPXXXPPXP--PXX 973 PPP P PP PP PPP P PP P P P P PP P P Sbjct: 56 PPPFPALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPP 115 Query: 974 PXS 982 P S Sbjct: 116 PAS 118 Score = 35.9 bits (79), Expect = 0.041 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +3 Query: 810 PTXXXXPPXXPPPP-PXXXXXRXPPXXXXXXPXPPPXPPXPXPXXP 944 P PP PPPP P PP PPP PP P P Sbjct: 71 PRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPPP 116 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 PPP P PP P P P P PP PP PP P F Sbjct: 29 PPPLVFPLLPLSPPPSPPPSPSSP--PRLPPPFPALFPPEPPLPPRF 73 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/54 (33%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Frame = +2 Query: 812 NXPP--PXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 N PP PPP PPP PP P P P+ PP PP Sbjct: 18 NLPPGTTGTCCPPPLVFPLLPLSPPPSPPPSPSSPPRLPPPFPALFPPEPPLPP 71 Score = 33.5 bits (73), Expect = 0.22 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +3 Query: 807 LPTXXXXPPXXPP-PPPXXXXXRXPPXXXXXXPXPPPXPPXP 929 LP PP P PPP PP P PP PP P Sbjct: 75 LPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPPP 116 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXPXPXA 873 + P PP PPPPP P P A Sbjct: 97 EEPPREPPPPPPPPEEPPPPA 117 >At2g05510.1 68415.m00583 glycine-rich protein Length = 127 Score = 46.4 bits (105), Expect = 3e-05 Identities = 27/57 (47%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRG-GXGGXXGGXGXGXXPXGGXAXGXGXGGGG--GGXGGXXXG 816 GG GG GGG G G GG GG G G GG G GGGG GG GG G Sbjct: 45 GGHGGHGGGGHYGGGGHGHGGHNGGGGHGLDGYGGGHGGHYGGGGGHYGGGGGHGGG 101 Score = 46.4 bits (105), Expect = 3e-05 Identities = 25/54 (46%), Positives = 25/54 (46%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGGG GG GG GG G G GG G G GGGG GG G Sbjct: 64 GGHNGGGGHGLDGYGGGHGGHYGG-GGGHYGGGGGHGGGGHYGGGGHHGGGGHG 116 Score = 41.9 bits (94), Expect = 6e-04 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Frame = -1 Query: 982 GXGGXGGXG-GGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G GG G GG G G G G GGG G GG GGGG GG Sbjct: 54 GHYGGGGHGHGGHNGGGGHGLDGYGGGHGGHYGGGGGHYGGGGGHGGGGHYGG 106 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGGG GG G G G G G G GGGG G GG G Sbjct: 53 GGHYGGGGHGHGGHNGGGGHGLDGYGGGHGGHYGGGGGHYGGGGGHGGGGHYGG 106 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/52 (44%), Positives = 23/52 (44%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG GG G G G G G GG GG G GG GGGG GG Sbjct: 46 GHGGHGG-G-GHYGGGGHGHGGHNGGGGHGLDGYGGGHGGHYGGGGGHYGGG 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXG--GGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G G GGG G G G G G GG G GG GGGG GG Sbjct: 60 GHGHGGHNGGGGHGLDGYGGGHGGHYGGGGGHYGGGGGHGGGGHYGGGGHHGGG 113 Score = 36.7 bits (81), Expect = 0.024 Identities = 22/58 (37%), Positives = 23/58 (39%), Gaps = 1/58 (1%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXG-GGGGXXGXGGGXLXE 805 G G GG G +G G G G G GGG GGGG G GG L E Sbjct: 62 GHGGHNGGGGHGLDGYGGGHGGHYGGGGGHYGGGGGHGGGGHYGGGGHHGGGGHGLNE 119 Score = 36.3 bits (80), Expect = 0.031 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -2 Query: 963 GXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G G G G G GG G GGG GG GG G GGG Sbjct: 42 GYHGGHGGHGGGGHYGGGGHGHGGHNGGGGHGLDGYGGGHGGHYGGGGG 90 Score = 35.9 bits (79), Expect = 0.041 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = -2 Query: 966 GGXG-GXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGG 820 GG G G G G G GG G GGG GGGG G GG Sbjct: 59 GGHGHGGHNGGGGHGLDGYGGGHGGHYGGGGGHYGGGGGHGGGGHYGGGG 108 Score = 35.5 bits (78), Expect = 0.054 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 2/50 (4%) Frame = -1 Query: 982 GXGGXG--GXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGG 839 G GG G G GGG G G G G GGG G GG GGGG Sbjct: 68 GGGGHGLDGYGGGHGGHYGGGGGHYGGGGG---HGGGGHYGGGGHHGGGG 114 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 46.4 bits (105), Expect = 3e-05 Identities = 24/65 (36%), Positives = 25/65 (38%), Gaps = 4/65 (6%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPP----PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 +YS P P PP PPP P P PP P PP P PP PPP Sbjct: 563 VYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPS 622 Query: 964 PPXPP 978 PP Sbjct: 623 HSPPP 627 Score = 45.2 bits (102), Expect = 7e-05 Identities = 23/54 (42%), Positives = 23/54 (42%), Gaps = 4/54 (7%) Frame = +1 Query: 829 PPXPPPP-PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP---PPPPXPP 978 PP PP P P P P PP P P P PP PP PPPP PP Sbjct: 535 PPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPP 588 Score = 44.4 bits (100), Expect = 1e-04 Identities = 27/65 (41%), Positives = 28/65 (43%), Gaps = 10/65 (15%) Frame = +1 Query: 817 PXXXPPXP---PPPPP----XPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP---PPP 966 P PP P PPPP P P A PP P P PP P PP PP PPP Sbjct: 555 PVHSPPPPVYSSPPPPHVYSPPPPVASPP---PPSPPPPVHSPPPPPVFSPPPPVFSPPP 611 Query: 967 PXPPF 981 P P + Sbjct: 612 PSPVY 616 Score = 43.6 bits (98), Expect = 2e-04 Identities = 23/58 (39%), Positives = 24/58 (41%), Gaps = 4/58 (6%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXP-PLXXXXXPPPPP---PXPP 978 P PP P PP P + PP P P PP P P PPPPP P PP Sbjct: 548 PIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPP 605 Score = 43.6 bits (98), Expect = 2e-04 Identities = 23/58 (39%), Positives = 24/58 (41%), Gaps = 3/58 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP---PPXPPF 981 P PP P PP P + PP P P P P PP PPPP PP P F Sbjct: 583 PPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPP---SHSPPPPVYSPPPPTF 637 Score = 43.2 bits (97), Expect = 3e-04 Identities = 21/54 (38%), Positives = 23/54 (42%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP P P + PP P PP P PP+ PPPP PP Sbjct: 590 PVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPV---YSPPPPTFSPP 640 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/58 (36%), Positives = 22/58 (37%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 H + PPP PPP P PPP P PP P P P PP P P Sbjct: 571 HVYSPPPPVASPPPPSPPPPVHSPPPPPVFSP---PPPVFSPPPPSPVYSPPPPSHSP 625 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P PP PPPP PP P P PP P P P PP PP Sbjct: 548 PIYSPPPPVHSPPPPVYSSP--PPPHVYSPPPPVASPPPPSPPPPVHSPPPPP 598 Score = 41.9 bits (94), Expect = 6e-04 Identities = 22/54 (40%), Positives = 23/54 (42%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P PP P PP P P P P PP+ PPPP P PP Sbjct: 541 PSPSPPSPIYSPPPPVHSPPPPVYSSP-PPPHVYSPPPPV---ASPPPPSPPPP 590 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 2/58 (3%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPP--XPPXPXPXXPXXPPPXPPXPP 977 P PP PPP PP P PPP P P P PP P PP Sbjct: 555 PVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPP 612 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PPP PPPP PPP P PP P P PP P P Sbjct: 559 PPPPVYSSPPPPHVYSP--PPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSP 609 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP PPP P PP P P P PP P Sbjct: 568 PPPHVYSPPPP----VASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPP 612 Score = 37.5 bits (83), Expect = 0.013 Identities = 20/65 (30%), Positives = 21/65 (32%), Gaps = 2/65 (3%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXP--PPXPPXPXPXXPXXPPPX 962 P + P PP PPP PP P P P PP P P PP Sbjct: 575 PPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPP 634 Query: 963 PPXPP 977 P P Sbjct: 635 PTFSP 639 Score = 37.1 bits (82), Expect = 0.018 Identities = 20/63 (31%), Positives = 21/63 (33%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P + P P P PPP PP P P PP P P PP P Sbjct: 568 PPPHVYSPPPPVASPPPPSPPP--PVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSP 625 Query: 969 XPP 977 PP Sbjct: 626 PPP 628 Score = 36.7 bits (81), Expect = 0.024 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PPPP PP P P PP PP PPP PP Sbjct: 523 PPPPKVEDTRVPPPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPP 568 Score = 36.7 bits (81), Expect = 0.024 Identities = 24/70 (34%), Positives = 27/70 (38%), Gaps = 6/70 (8%) Frame = +3 Query: 786 LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPX--PPXPX--PXXPXXP 953 +P +P+ P PPPP PP P PP PP P P P P Sbjct: 533 VPPPQPPMPSPSPPSPIYSPPPPV----HSPPPPVYSSPPPPHVYSPPPPVASPPPPSPP 588 Query: 954 PP--XPPXPP 977 PP PP PP Sbjct: 589 PPVHSPPPPP 598 Score = 36.3 bits (80), Expect = 0.031 Identities = 21/65 (32%), Positives = 23/65 (35%), Gaps = 5/65 (7%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP-----XPPLXXXXXPPP 960 ++S P PP P PP P P PP P P PP PP PP Sbjct: 591 VHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPPTFSPPPTHNTNQPPM 650 Query: 961 PPPXP 975 P P Sbjct: 651 GAPTP 655 Score = 34.7 bits (76), Expect = 0.095 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PPP PP P P P P PP P PP+ PPPP Sbjct: 534 PPPQPPMPSPS---PPSPIYSPPPPVHSPPPPVYS----SPPPP 570 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PPPP PP P PP P P P PPP PP Sbjct: 597 PPVFSPPPPVFSP---PPPSPVYSPPPPSHSPPPPVYSP--PPPTFSPPP 641 Score = 32.7 bits (71), Expect = 0.38 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = +1 Query: 844 PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP--PPPXPPF 981 PPPP PP P PP P PP PPP PP P + Sbjct: 523 PPPPKVEDTRVPP------PQPPMPSPSPPSPIYSPPPPVHSPPPPVY 564 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 4/60 (6%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPP-XPXPXXPXXPPPXP---PXPP 977 P PP PP PP PPP P P P PPP P P PP Sbjct: 562 PVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPP 621 Score = 31.9 bits (69), Expect = 0.67 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PPP P PPPP PPP P P + P P P P Sbjct: 610 PPPSPVYSPPPPSHSP---PPPVYSPPPPTFSPPPTHNTNQPPMGAPTPTQAP 659 Score = 30.3 bits (65), Expect = 2.0 Identities = 19/64 (29%), Positives = 21/64 (32%), Gaps = 2/64 (3%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPP--PPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPX 962 P ++ P P P P PP PPP PP P P P P Sbjct: 493 PTKPVSPPNEAQGPTPDDPYDASPVKNRRSPPPPKVEDTRVPPPQPPMPSPSPPS-PIYS 551 Query: 963 PPXP 974 PP P Sbjct: 552 PPPP 555 Score = 29.5 bits (63), Expect = 3.6 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 5/48 (10%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPP---XPPXP--XPXXPXXPPPXPP 968 PPPP PP P PP PP P P P P PP Sbjct: 523 PPPPKVEDTRVPPPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPP 570 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/56 (26%), Positives = 16/56 (28%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 + P P P PP P P P PP PPP P P Sbjct: 486 EQPQIPEPTKPVSPPNEAQGPTPDDPYDASPVKNRRSPPPPKVEDTRVPPPQPPMP 541 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 46.0 bits (104), Expect = 4e-05 Identities = 25/55 (45%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXG-XGGGGGGXGGXXXG 816 GG GG GGG G G GG G G GG G G GGGGG GG G Sbjct: 359 GGMGGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGGRGGYGGG 413 Score = 45.6 bits (103), Expect = 5e-05 Identities = 26/58 (44%), Positives = 28/58 (48%), Gaps = 2/58 (3%) Frame = -3 Query: 977 GGXGGGG--GGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXW 810 GG GGGG GG G GG GG G G GG + G GGG GG GG G + Sbjct: 362 GGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSF-YGGGGGRGGYGGGGSGRY 418 Score = 45.2 bits (102), Expect = 7e-05 Identities = 23/56 (41%), Positives = 24/56 (42%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXW 810 GG GG GGG G G GG G GG G GG GGG GG G + Sbjct: 314 GGGGGYGGGPGDMYGGSYGEPGGGYGGPSGSYGGGYGSSGIGGYGGGMGGAGGGGY 369 Score = 43.6 bits (98), Expect = 2e-04 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G G GGG GG GG GG G G GG G GGGG G G G Sbjct: 340 GPSGSYGGGYGSSGIGGYGGGMGGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGG 393 Score = 41.9 bits (94), Expect = 6e-04 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G G GGG G G GG GGG GG GGGG GG Sbjct: 358 GGGMGGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGGRGG 409 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G GG GG G G G GG GG G GG GGGG GG Sbjct: 350 GSSGIGGYGG---GMGGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGG 398 Score = 38.3 bits (85), Expect = 0.008 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 3/53 (5%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXX---GGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG G G GG GG GG GG G G G G G GGGG GG Sbjct: 230 GGYGDGYGGGHGGGYGGPGGPYKSGGGYGGGRSGGYGGYGGEFGGYGGGGYGG 282 Score = 37.5 bits (83), Expect = 0.013 Identities = 23/56 (41%), Positives = 25/56 (44%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXW 810 GG GGG G G G GG G G GG + G G GG GGG G G + Sbjct: 278 GGYGGGVGPYRGEPALGYSGRYGGGGGGYN-RGGYSMG-GGGGYGGGPGDMYGGSY 331 Score = 37.5 bits (83), Expect = 0.013 Identities = 25/59 (42%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXG-GXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXWXS 804 G GGGGGG RGG G GG G G G + G GGG GG G G + S Sbjct: 297 GRYGGGGGG---YNRGGYSMGGGGGYGGGPGDMYGGSYGE-PGGGYGGPSGSYGGGYGS 351 Score = 37.5 bits (83), Expect = 0.013 Identities = 24/58 (41%), Positives = 24/58 (41%), Gaps = 4/58 (6%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXG--GXGXGXXPXGGXAXGXGXGGGG--GGXGGXXXG 816 GG G GG GG GG G G G G GG G G GGG G GG G Sbjct: 321 GGPGDMYGGSYGEPGGGYGGPSGSYGGGYGSSGIGGYGGGMGGAGGGGYRGGGGYDMG 378 Score = 36.3 bits (80), Expect = 0.031 Identities = 22/57 (38%), Positives = 23/57 (40%), Gaps = 1/57 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGX-GXGXXPXGGXAXGXGXGGGGGGXGGXXXGXW 810 GG GGG G G GG GG G G P G G GGG GG G + Sbjct: 255 GGYGGGRSGGYGGYGGEFGGYGGGGYGGGVGPYRGEPALGYSGRYGGGGGGYNRGGY 311 Score = 35.9 bits (79), Expect = 0.041 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXG--XGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXG 830 G G GG GGG G G GG GGG GG GG GG G Sbjct: 233 GDGYGGGHGGGYGGPGGPYKSGGGYGGGRSGGYGGYGGEFGGYGGGGYGGGVG 285 Score = 35.9 bits (79), Expect = 0.041 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 2/56 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXG-GXAXGXGXGGGGG-GXGGXXXG 816 GG G GG G GG G G G G G A G G GGGG GG G Sbjct: 328 GGSYGEPGGGYGGPSGSYGGGYGSSGIGGYGGGMGGAGGGGYRGGGGYDMGGVGGG 383 Score = 35.5 bits (78), Expect = 0.054 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -2 Query: 966 GGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 GG G G G G G GG GGGR G GG G GGG Sbjct: 230 GGYGDGYGGGHGGGYGGPGGPYKSGGGYGGGR-SGGYGGYGGEFGGYGGG 278 Score = 35.5 bits (78), Expect = 0.054 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGX--GGXGGGXGXXXXXXGGXRXXXXXGGG-GGXXGG 827 G GG G GG G G G GG GG G GG GGG GG G Sbjct: 337 GYGGPSGSYGGGYGSSGIGGYGGGMGGAGGGGYRGGGGYDMGGVGGGGAGGYGAG 391 Score = 34.3 bits (75), Expect = 0.13 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 5/55 (9%) Frame = -3 Query: 977 GGXGGGG-GGXXXXXRG----GXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GGGG GG RG G G GG G G G GGGGG GG Sbjct: 273 GGYGGGGYGGGVGPYRGEPALGYSGRYGGGGGGYN-----RGGYSMGGGGGYGGG 322 Score = 34.3 bits (75), Expect = 0.13 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = -2 Query: 966 GGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGG-GGGXXGXGGG 817 GG GG G G G GG G GG GG GGG GGG Sbjct: 355 GGYGGGMGGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGG 405 Score = 33.9 bits (74), Expect = 0.17 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 5/54 (9%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXX-----PXGGXAXGXGXGGGGGGXGG 828 G GGGG GG GG GG G P GG G GGG G G Sbjct: 300 GGGGGGYNRGGYSMGGGGGYGGGPGDMYGGSYGEPGGGYGGPSGSYGGGYGSSG 353 Score = 33.5 bits (73), Expect = 0.22 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 4/56 (7%) Frame = -1 Query: 982 GXGGXGGXGGGXXG----XXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G GG GG G G G GG GGG G GGGGG G Sbjct: 254 GGGYGGGRSGGYGGYGGEFGGYGGGGYGGGVGPYRGEPALGYSGRYGGGGGGYNRG 309 Score = 33.1 bits (72), Expect = 0.29 Identities = 20/53 (37%), Positives = 21/53 (39%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXW 810 GGG G GG G GG GG G G GG GG GG G + Sbjct: 229 GGGYGDGYGGGHGGGYGGPGGPYKSGGGYGGGRSG-GYGGYGGEFGGYGGGGY 280 Score = 31.5 bits (68), Expect = 0.88 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -2 Query: 966 GGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 GG G G G G G GG G GGG GGG G G G G Sbjct: 347 GGYGSSGIGGYGGGMGGAGG---GGYRGGGGYDMGGVGGGGAG--GYGAG 391 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXG 879 G GG GGG GG GG GG P G Sbjct: 391 GGGGNGGGSFYGGGGGRGGYGGGGSGRYHPYG 422 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 46.0 bits (104), Expect = 4e-05 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP---PXPP 978 P PP PP P P P P P P PP PP PPPP P PP Sbjct: 78 PPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPP 134 Score = 46.0 bits (104), Expect = 4e-05 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PPPPP P P P PP P PPL PP P PP Sbjct: 96 PLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPP 149 Score = 45.6 bits (103), Expect = 5e-05 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP---XPPLXXXXXPPPPPPXPP 978 P P PPP P P A P P P PP P PP PPPPP P Sbjct: 64 PANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITP 120 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP---PXPP 978 PP PPP P + PP P PP P P PPPPP P PP Sbjct: 63 PPANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPPP 115 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/51 (43%), Positives = 23/51 (45%), Gaps = 7/51 (13%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPX----PPXXPPXP---PLXXXXXPPPPPP 969 PPPPP P + PP P P PP PP P PL PPPPP Sbjct: 112 PPPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPPPLSPPQTTPPPPP 162 Score = 44.0 bits (99), Expect = 2e-04 Identities = 19/54 (35%), Positives = 20/54 (37%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P P PP P P P PP PP+ PP P PP Sbjct: 42 PGPPPPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPP 95 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = +1 Query: 817 PXXXPPXPPPPP-PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P PPP P PP P P P PP P PPPP P Sbjct: 85 PPALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTP 139 Score = 43.6 bits (98), Expect = 2e-04 Identities = 24/56 (42%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Frame = +1 Query: 817 PXXXPPXPPPPPPX--PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PPPP P P A P P P PP P PP PPPPP P Sbjct: 116 PAITPPLSPPPPAITPPPPLATTPPALPPKPLPP--PLSPP---QTTPPPPPAITP 166 Score = 42.3 bits (95), Expect = 5e-04 Identities = 21/61 (34%), Positives = 22/61 (36%) Frame = +2 Query: 785 TTXXXTHSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 TT + PPP PP P PPP P PP P S P PP P Sbjct: 102 TTPPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPPPLSPPQTTPPPP 161 Query: 965 P 967 P Sbjct: 162 P 162 Score = 41.5 bits (93), Expect = 8e-04 Identities = 24/60 (40%), Positives = 24/60 (40%), Gaps = 9/60 (15%) Frame = +1 Query: 817 PXXXPPXPP---PPPPXPXPXAXPPXGXXPXP---XPPXXPP---XPPLXXXXXPPPPPP 969 P PP PP P PP PP P P PP PP PPL PPPPP Sbjct: 49 PDPQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPP 108 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/71 (32%), Positives = 25/71 (35%) Frame = +1 Query: 766 LXVXXTDYLXLYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXX 945 L + D +Y P P PPPP P P P P P PP PP Sbjct: 18 LTIVRADNHSVYCPPPPPCICICNPGPPPPQPDPQPPTPPTFQPAPPANDQPPPPP--QS 75 Query: 946 XXPPPPPPXPP 978 PPP PP Sbjct: 76 TSPPPVATTPP 86 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 4/62 (6%) Frame = +3 Query: 804 TLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPP-PXPPXPXPXXPXXPPP---XPPX 971 T PT PP PPP PP PP P PP P PPP PP Sbjct: 55 TPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPP 114 Query: 972 PP 977 PP Sbjct: 115 PP 116 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 1/58 (1%) Frame = +3 Query: 807 LPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPP-XPPXPXPXXPXXPPPXPPXPP 977 LP P PPPPP P P PP PP P P PP P PP Sbjct: 93 LPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPPP 150 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PPP P PPP PP P PP P P P PP PP Sbjct: 69 PPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPP--PAITPPPPP 116 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = +3 Query: 807 LPTXXXXPPXXPP---PPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 LP PP PP PPP PP PPP P P PP PP P Sbjct: 88 LPPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPKP 146 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Frame = +1 Query: 817 PXXXPPXP---PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP P PPPP P A PP P PP P PP PP PP Sbjct: 120 PPLSPPPPAITPPPPLATTPPALPPKPLPPPLSPPQTTPPPP--PAITPPLSPP 171 Score = 39.5 bits (88), Expect = 0.003 Identities = 29/94 (30%), Positives = 31/94 (32%), Gaps = 6/94 (6%) Frame = +3 Query: 714 PPPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXX-PPPPPXXXXXRXPPXXX 890 PPP +S + LP T PP PPPPP PP Sbjct: 69 PPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPA 128 Query: 891 XXXP-----XPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PP P P P PP P PP Sbjct: 129 ITPPPPLATTPPALPPKPLP-PPLSPPQTTPPPP 161 Score = 37.9 bits (84), Expect = 0.010 Identities = 20/58 (34%), Positives = 21/58 (36%), Gaps = 3/58 (5%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPP---XXPXPXPSXPXXXPPXPPXXPXS 982 PP P PPP PPP P PP P P + P PP P P S Sbjct: 95 PPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPPPLS 152 Score = 35.9 bits (79), Expect = 0.041 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 6/62 (9%) Frame = +3 Query: 810 PTXXXXPPXXP---PPPPXXXXXRXPPXXXXXXP---XPPPXPPXPXPXXPXXPPPXPPX 971 P PP P P PP PP P PP PP P P P PP P Sbjct: 47 PQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLP-PPLSPPQTTPP 105 Query: 972 PP 977 PP Sbjct: 106 PP 107 Score = 35.9 bits (79), Expect = 0.041 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 3/66 (4%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPP---PXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP 959 P A P PP PPPP P PP P PPP P P P P Sbjct: 107 PPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPK-PLPPPLSP-PQTTPPPPPAI 164 Query: 960 XPPXPP 977 PP P Sbjct: 165 TPPLSP 170 Score = 35.5 bits (78), Expect = 0.054 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 1/58 (1%) Frame = +2 Query: 812 NXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXP-PXXPXPXPSXPXXXPPXPPXXPXS 982 N PP P P PP PP P P P P + P PP P P S Sbjct: 41 NPGPPPPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLS 98 Score = 31.9 bits (69), Expect = 0.67 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 T + PPP PPPP PP P PP P P P PP P Sbjct: 119 TPPLSPPPPAI--TPPPPLATTPPALPPKPLPPPLSPPQTTPPPP--PAITPPLSP 170 Score = 31.9 bits (69), Expect = 0.67 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP-XPPL 936 P P PPP P P PP P P P PP PPL Sbjct: 254 PGPSPTISPPPLP-PQTLKPPPPQTTPPPPPAITPPLSPPL 293 Score = 31.5 bits (68), Expect = 0.88 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 3/52 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXX---PXXPPPXPPXP 974 PP P P P P P PPP P P P PP P P Sbjct: 45 PPPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPPP 96 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP 960 P P P P PP P P P PP PP PP Sbjct: 254 PGPSPTISPPPLPPQTLKPPP-PQTTPPPPPAITPPLSPP 292 Score = 29.1 bits (62), Expect = 4.7 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPL 936 P P PP P P P + PP P P P PPL Sbjct: 134 PLATTPPALPPKPLPPPLS-PPQTTPPPPPAITPPLSPPL 172 Score = 28.3 bits (60), Expect = 8.2 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 853 PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P PP P P PP P PPPPP P Sbjct: 254 PGPSPTISPP----PLPPQTLKPPPP----QTTPPPPPAITP 287 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 46.0 bits (104), Expect = 4e-05 Identities = 20/58 (34%), Positives = 22/58 (37%) Frame = +1 Query: 805 LXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 + + P PP P PP P P P P P P P P PP P P PP Sbjct: 116 IVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPP 173 Score = 46.0 bits (104), Expect = 4e-05 Identities = 22/56 (39%), Positives = 23/56 (41%) Frame = +1 Query: 802 SLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 S + P PP P PPP P P PP P P PP P P PP P P Sbjct: 149 STPKPPHHKPPPTPCPPPTPTP--TPPVVTPPTPTPPVITPPTPTPPVVTPPTPTP 202 Score = 43.6 bits (98), Expect = 2e-04 Identities = 24/60 (40%), Positives = 25/60 (41%), Gaps = 6/60 (10%) Frame = +1 Query: 817 PXXXPPX--PPPPPPXPXPXAXPPXGXXPXPXPPXXP---PXPPL-XXXXXPPPPPPXPP 978 P PP P P PP P PP P P PP P P PP+ PPP P PP Sbjct: 72 PHPKPPTVKPHPKPPTVKPHPKPPTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPP 131 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P PP P P PP P P PP P P PP P P P Sbjct: 193 PVVTPPTPTPPVITP-PTPTPPVITPPTPTPPVVTPPTPTPPVVTPPTPTPPTP 245 Score = 42.3 bits (95), Expect = 5e-04 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 2/56 (3%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXP-XPXPP-XXPPXPPLXXXXXPPPPPPXPP 978 P PP P P P P P PP P P PP PP P PPP P PP Sbjct: 100 PHPKPPTKPHPHPKP-PIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPP 154 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PPP P P PP P P PP P PPP P PP Sbjct: 114 PPIVKPPTKPPPSTPKPPTKPPPS-TPKPPTTKPPPSTPKPPHHKPPPTPCPPP 166 Score = 42.3 bits (95), Expect = 5e-04 Identities = 23/63 (36%), Positives = 25/63 (39%), Gaps = 4/63 (6%) Frame = +1 Query: 802 SLXQXPXXXPPXPPPPP---PXPXPXAXPPXGXXPXPXPPXXP-PXPPLXXXXXPPPPPP 969 S + P PP P PP P P P P P PP P P PP+ P PP Sbjct: 126 STPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVI 185 Query: 970 XPP 978 PP Sbjct: 186 TPP 188 Score = 41.9 bits (94), Expect = 6e-04 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P PP P P PP P PP P P P PP PP Sbjct: 94 PPTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPP 147 Score = 41.9 bits (94), Expect = 6e-04 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP P PP P P PP P P PP P P PP P P Sbjct: 173 PVVTPPTPTPPVITP-PTPTPPVVTPPTPTPPVITPPTPTPPVITPPTPTP 222 Score = 41.9 bits (94), Expect = 6e-04 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP P PP P P PP P P PP P P PP P P Sbjct: 183 PVITPPTPTPPVVTP-PTPTPPVITPPTPTPPVITPPTPTPPVVTPPTPTP 232 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/53 (39%), Positives = 22/53 (41%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PP PP P P P PP P PP P PP+ P PP P P Sbjct: 198 PTPTPPVITPPTPTP-PVITPPTPTPPVVTPP--TPTPPVVTPPTPTPPTPIP 247 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXP-PLXXXXXPPPPPPXPP 978 P P PP PP P P P P PP P P P P PP PP Sbjct: 46 PPKPPAVKPPKPPAVKPPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPP 100 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +1 Query: 802 SLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 S + P PP P PP P P P P PP P P PP P P Sbjct: 137 STPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTP 192 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAX-PPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PP P P PP P PP P P PP P P PP P P Sbjct: 165 PPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVITPPTPTP 212 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 3/53 (5%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAX-PPXGXXPXPXPPXXPP--XPPLXXXXXPPPPPPXPP 978 PP PPP P P PP P P P PP PP PP P PP Sbjct: 141 PPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPP 193 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P PP P P P P P PP P P P P PP P Sbjct: 58 PAVKPPTPKPPTVKPHPK---PPTVKPHPKPPTVKPHPKPPTVKPPHPKPPTKP 108 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP P P P P P PP PP PPP P PP Sbjct: 90 PHPKPPTVKPPHPKP-PTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPP 142 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PPP P P PP P PP P PP+ P PP PP Sbjct: 162 PCPPPTPTPTPPVVTPPTPTPPVITPP--TPTPPVVTPPTPTPPVITPP 208 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/54 (38%), Positives = 22/54 (40%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP P P P PP P PP P PP+ P PP PP Sbjct: 168 PTPTPPVVTPPTPTP-PVITPPTPTPPVVTPP--TPTPPVITPPTPTPPVITPP 218 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/55 (32%), Positives = 19/55 (34%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P+ P PPP PP P P P PP P P P PP P Sbjct: 136 PSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTP 190 Score = 39.5 bits (88), Expect = 0.003 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPP-PXPPXPXPXXPXXPPPXPPXP 974 PT P P PP PP P PP PP P P P P PP P Sbjct: 190 PTPPVVTPPTPTPPVITPPTPTPPVITPPTPTPPVVTPPTPTPPVVTPPTPTPPTP 245 Score = 39.1 bits (87), Expect = 0.004 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP--XXPPXPPLXXXXXPPPPPPXPP 978 P P P PP P P PP P P PP P PP P PPP P Sbjct: 85 PPTVKPHPKPPTVKP-PHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTP 139 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 P P P P P PP P PP P P P P PP P Sbjct: 74 PKPPTVKPHPKPPTVKPHPKPPTVKPPHPKPPTKPHPHPKPPIVKPPTKP 123 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRP-PPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 P P PPP P P PP P PP P P+ P PP P Sbjct: 151 PKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTP 200 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +1 Query: 844 PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PP P P P P P P PP PP P PP P Sbjct: 29 PPKPSPAPHKPPKHPVKPPKPPAVKPPKPPAVKPPTPKPPTVKP 72 Score = 37.1 bits (82), Expect = 0.018 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 PT PP PP P P P P PP P P P PP P Sbjct: 166 PTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVITPPTPTPPVITPPTP 220 Score = 37.1 bits (82), Expect = 0.018 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 PT P P PP PP P PP P P P P PP P P Sbjct: 170 PTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVITP-PTPTPPVITPPTPTPP 223 Score = 37.1 bits (82), Expect = 0.018 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPP-XPPXPXPXXPXXPPPXPP 968 PT P P PP PP P PP PP P P P P PP Sbjct: 180 PTPPVITPPTPTPPVVTPPTPTPPVITPPTPTPPVITPPTPTPPVVTPPTPTPP 233 Score = 36.7 bits (81), Expect = 0.024 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P P P PP PP PP PP P P PPP P PP Sbjct: 92 PKPPTVKPPHPKPPTKPHPHPKPPIV-----KPPTKPPPSTPKPPTKPPPSTPKPP 142 Score = 36.3 bits (80), Expect = 0.031 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 PP PP P + P P P P P P P PP P P Sbjct: 57 PPAVKPPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPPHPKPP 105 Score = 36.3 bits (80), Expect = 0.031 Identities = 21/61 (34%), Positives = 22/61 (36%), Gaps = 7/61 (11%) Frame = +1 Query: 817 PXXXPPXPPPP---PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXP----PPPPPXP 975 P P P PP PP P + P P P P P P P PPP P P Sbjct: 105 PTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCP 164 Query: 976 P 978 P Sbjct: 165 P 165 Score = 36.3 bits (80), Expect = 0.031 Identities = 20/60 (33%), Positives = 21/60 (35%), Gaps = 4/60 (6%) Frame = +3 Query: 810 PTXXXXPPXXPPPP-PXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPP---PXPPXPP 977 P PP PPP P + PP PP P P P PP P P PP Sbjct: 124 PPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPP 183 Score = 36.3 bits (80), Expect = 0.031 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRP-PPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 H P P P P P P PP P PP P P+ P PP P Sbjct: 156 HKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVITPPTP 210 Score = 36.3 bits (80), Expect = 0.031 Identities = 18/54 (33%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP-PXXP 976 PP P PP PP P PP P P+ P PP P P P Sbjct: 192 PPVVTPPTPTPPVITPPTPTPPVITPPTPTPPVVTPPTPTPPVVTPPTPTPPTP 245 Score = 35.9 bits (79), Expect = 0.041 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PP P PP PP P PP P P+ P PP P Sbjct: 182 PPVITPPTPTPPVVTPPTPTPPVITPPTPTPPVITPPTPTPPVVTPPTP 230 Score = 35.5 bits (78), Expect = 0.054 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 2/57 (3%) Frame = +3 Query: 804 TLPTXXXXPPXXPPPP--PXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 T P P PPP P + PP P PP P P P P P P PP Sbjct: 121 TKPPPSTPKPPTKPPPSTPKPPTTKPPP----STPKPPHHKPPPTPCPPPTPTPTPP 173 Score = 35.5 bits (78), Expect = 0.054 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRP-PPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PP P P P P PP P PP P P+ P PP P Sbjct: 172 PPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVITPPTPTPPVITPPTP 220 Score = 35.1 bits (77), Expect = 0.072 Identities = 21/64 (32%), Positives = 22/64 (34%), Gaps = 4/64 (6%) Frame = +1 Query: 799 YSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXP-PXPPLXXXXXPPP---PP 966 Y+ P P P PP P PP P P P P PP PP P Sbjct: 23 YACDCTPPKPSPAPHKPPKHPVKPPKPPAVKPPKPPAVKPPTPKPPTVKPHPKPPTVKPH 82 Query: 967 PXPP 978 P PP Sbjct: 83 PKPP 86 Score = 35.1 bits (77), Expect = 0.072 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P P PPP PP P P P P P P PP P PP Sbjct: 112 PKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKP--PHHKPPPTPCPP 165 Score = 35.1 bits (77), Expect = 0.072 Identities = 19/55 (34%), Positives = 20/55 (36%), Gaps = 5/55 (9%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPX-PPPXPPXP----XPXXPXXPPPXPPXPP 977 PP PPP + PP PPP P P P P PP P PP Sbjct: 119 PPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPP 173 Score = 34.7 bits (76), Expect = 0.095 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P P P PP + PP PPP P P PPP P PP Sbjct: 102 PKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKP---PTTKPPPSTPKPP 154 Score = 34.7 bits (76), Expect = 0.095 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 1/56 (1%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXP-PPXPPXPXPXXPXXPPPXPPXP 974 P+ P PPP P P P P PP P P P PP P P Sbjct: 148 PSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPP 203 Score = 34.7 bits (76), Expect = 0.095 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 1/56 (1%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXP-PPXPPXPXPXXPXXPPPXPPXP 974 P PP P P P P P P PP P P P PP P P Sbjct: 158 PPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVITPPTPTPP 213 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P PP PPP P P P P PP P P P PP P Sbjct: 147 PPSTPKPPHHKPPPTPCPPPTPTPTPPVVTP-PTPTPPVITPPTPTPPVVTPPTP 200 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 PP PP P P P P PP P P P PP P Sbjct: 182 PPVITPPTPTPPVVTPPTPTPPVITPPTPTPPVITPPTPTPPVVTPPTP 230 Score = 33.1 bits (72), Expect = 0.29 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 1/61 (1%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPX-PPXPXPXXPXXPPPXP 965 P P P P P P P P PP PP P P P P P Sbjct: 55 PKPPAVKPPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPPHPKPPTKPHPHPKP 114 Query: 966 P 968 P Sbjct: 115 P 115 Score = 32.7 bits (71), Expect = 0.38 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 P P PP P P P P PP P P P PP P Sbjct: 55 PKPPAVKPPTPKPPTVKPHPKPPTVKPHPKPPTVK-PHPKPPTVKPPHP 102 Score = 31.9 bits (69), Expect = 0.67 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 1/56 (1%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXP-PXPP 967 H P P PP PP P P P PP P P P P P PP Sbjct: 42 HPVKPPKPPAVKPPKPP-AVKPPTPKPPTVKPHPKPPTV-KPHPKPPTVKPHPKPP 95 Score = 31.5 bits (68), Expect = 0.88 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PT P P PP PP P P PP P P P P P P Sbjct: 200 PTPPVITPPTPTPPVITPPTPTPP----VVTPPTPTPPVVTPPTPTPPTPIPETCP 251 Score = 31.5 bits (68), Expect = 0.88 Identities = 15/50 (30%), Positives = 16/50 (32%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PP P PP PP P PP P P+ P P P Sbjct: 202 PPVITPPTPTPPVITPPTPTPPVVTPPTPTPPVVTPPTPTPPTPIPETCP 251 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/57 (29%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXP-PXPP 967 +++ + PP P P P P P P PP P P P P P PP Sbjct: 22 SYACDCTPPKPSPAPHKPPKHPVKPPKPPAVKP-PKPPAVKPPTPKPPTVKPHPKPP 77 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/52 (28%), Positives = 15/52 (28%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PP P P P PP P P P P P PP P Sbjct: 57 PPAVKPPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPPHPKPPTKP 108 Score = 28.7 bits (61), Expect = 6.2 Identities = 14/52 (26%), Positives = 15/52 (28%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PP PP P +PP P P P P P P P Sbjct: 39 PPKHPVKPPKPPAVKPPKPPAVKPPTPKPPTVKPHPKPPTVKPHPKPPTVKP 90 Score = 28.3 bits (60), Expect = 8.2 Identities = 19/61 (31%), Positives = 20/61 (32%), Gaps = 5/61 (8%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPX---PPPXPPXPXPXXPXXP-PPXP-PXP 974 P P P PP + P P P P PP P P P P P P P Sbjct: 55 PKPPAVKPPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPPHPKPPTKPHPHPKP 114 Query: 975 P 977 P Sbjct: 115 P 115 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 46.0 bits (104), Expect = 4e-05 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 2/56 (3%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXP--PXXPPXPPLXXXXXPPPPPPXPP 978 P PP P PP P P P P P P P PP PPPP P PP Sbjct: 502 PPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPP 557 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/47 (42%), Positives = 21/47 (44%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PPPPP P P + PP P PP P PP PPP PP Sbjct: 528 PPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPP-YIYSSPPPVVNCPP 573 Score = 43.2 bits (97), Expect = 3e-04 Identities = 24/63 (38%), Positives = 25/63 (39%), Gaps = 13/63 (20%) Frame = +1 Query: 829 PPXPPPP-------PPXPXPXAXPPXGXXPXPXPP------XXPPXPPLXXXXXPPPPPP 969 PP PPPP PP P P PP P P P PP PP+ PPP Sbjct: 618 PPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPPVYYSPVTQSPPP 677 Query: 970 XPP 978 PP Sbjct: 678 PPP 680 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/66 (31%), Positives = 23/66 (34%), Gaps = 4/66 (6%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXP----PXPPLXXXXXPPPP 963 +YS PP PPP P P P PP P PP PPP Sbjct: 561 IYSSPPPVVNCPPTTQSPPPPKYEQTPSPREYYPSPSPPYYQYTSSPPPPTYYATQSPPP 620 Query: 964 PPXPPF 981 PP P + Sbjct: 621 PPPPTY 626 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/59 (33%), Positives = 21/59 (35%) Frame = +1 Query: 802 SLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 S+ P P PPPP P P P P P PP PP P P PP Sbjct: 523 SVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPPVVNCPPTTQSPPPP 581 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PPPP P PP P PP PP+ PPP P Sbjct: 670 PVTQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVTQSPPPPSP 723 Score = 37.9 bits (84), Expect = 0.010 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PP PPPPP P P PP P P P PP P Sbjct: 698 PPVTQSPPPPPVYYLPVTQSPPPPSPVYYPPVAKSPPPPSPVYYPPVTQSPP 749 Score = 37.5 bits (83), Expect = 0.013 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PPPPP PP P PP P P PPP P PP Sbjct: 502 PPPPPPEYEPSPPPPSSEMSPSVRAYPPPP----PLSPPPPSPPPP 543 Score = 37.5 bits (83), Expect = 0.013 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 7/61 (11%) Frame = +1 Query: 817 PXXXPPX---PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP----PPPPXP 975 P PP PPPPP P P P PP PP PP PPPP Sbjct: 694 PVYYPPVTQSPPPPPVYYLPVTQSPPPPSPVYYPPVAKSPPPPSPVYYPPVTQSPPPPST 753 Query: 976 P 978 P Sbjct: 754 P 754 Score = 37.1 bits (82), Expect = 0.018 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 Q P P P PP + PP P PP P PPPPPP Sbjct: 585 QTPSPREYYPSPSPPYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSPPPPPP 637 Score = 37.1 bits (82), Expect = 0.018 Identities = 25/66 (37%), Positives = 26/66 (39%), Gaps = 15/66 (22%) Frame = +1 Query: 829 PPXPPP---PP----PXPXPXAXPPXGXXPXPXP----PXXPPXPPLXXXXXPP----PP 963 PP PPP PP P P P PP P P P P PP PP PP Sbjct: 675 PPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVTQSPPPPSPVYYPPVAKSPP 734 Query: 964 PPXPPF 981 PP P + Sbjct: 735 PPSPVY 740 Score = 37.1 bits (82), Expect = 0.018 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PPP P P PP P P PP PPP PP Sbjct: 723 PVYYPPVAKSPPP-PSPVYYPPVTQSPPPPSTPVEYHPPASPNQSPPPEYQSPP 775 Score = 35.9 bits (79), Expect = 0.041 Identities = 20/60 (33%), Positives = 23/60 (38%), Gaps = 5/60 (8%) Frame = +1 Query: 817 PXXXPPXP--PPPPPX---PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 P PP PPPPP P + PP P PP PP+ PPP P + Sbjct: 637 PVYYPPVTASPPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVY 696 Score = 35.5 bits (78), Expect = 0.054 Identities = 23/72 (31%), Positives = 25/72 (34%), Gaps = 10/72 (13%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPP----PXXXXXRXPPXXXXXXPXPP--PXPPXPXPXX--- 941 P + P+ PP PPP P P P PP P PP P P Sbjct: 488 PPSSKMSPSVKAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYS 547 Query: 942 -PXXPPPXPPXP 974 P P P PP P Sbjct: 548 SPPPPSPSPPPP 559 Score = 35.5 bits (78), Expect = 0.054 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PPPPPP + PP P PP PPL PPP P Sbjct: 501 PPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLS-------PPPPSP 540 Score = 35.5 bits (78), Expect = 0.054 Identities = 24/70 (34%), Positives = 25/70 (35%), Gaps = 15/70 (21%) Frame = +1 Query: 817 PXXXPPXPPP--------PPPXPXPXAXPPXGXXPXPXPPXXPP----XPPLXXXXXP-- 954 P P PPP PP P P PP P P P PP PP P Sbjct: 656 PVIQSPPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVT 715 Query: 955 -PPPPPXPPF 981 PPPP P + Sbjct: 716 QSPPPPSPVY 725 Score = 35.1 bits (77), Expect = 0.072 Identities = 21/68 (30%), Positives = 23/68 (33%), Gaps = 3/68 (4%) Frame = +1 Query: 787 YLXLYSLXQXPXXXPPXPPPPPPXPXPXA---XPPXGXXPXPXPPXXPPXPPLXXXXXPP 957 Y S P PPPPP P A PP P PP PP+ Sbjct: 600 YYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQ 659 Query: 958 PPPPXPPF 981 PPP P + Sbjct: 660 SPPPPPVY 667 Score = 34.7 bits (76), Expect = 0.095 Identities = 18/53 (33%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = +1 Query: 829 PPXPPP---PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP P P P PP P P PP P + PPP P PP Sbjct: 486 PPPPSSKMSPSVKAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPP 538 Score = 34.7 bits (76), Expect = 0.095 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +2 Query: 806 SXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 S P PPPPP PPP P P P P P PP Sbjct: 490 SSKMSPSVKAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPP 543 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 5/51 (9%) Frame = +3 Query: 840 PPPP-----PXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PPPP P PP P PPP P PPP P PP Sbjct: 486 PPPPSSKMSPSVKAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPP 536 Score = 33.1 bits (72), Expect = 0.29 Identities = 17/56 (30%), Positives = 18/56 (32%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PT PPPPP + PP P P P P PP PP Sbjct: 610 PTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPP 665 Score = 32.7 bits (71), Expect = 0.38 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +2 Query: 806 SXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP 958 S P PPPPP PPP PP P P PP Sbjct: 517 SSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPP 567 Score = 32.3 bits (70), Expect = 0.51 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 6/55 (10%) Frame = +2 Query: 818 PPPX--PXXPPP----PPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP P PPP P PPP P PP P P PP P Sbjct: 505 PPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPP 559 Score = 32.3 bits (70), Expect = 0.51 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 5/58 (8%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPP-----PXPPXPXPXXPXXPPPXPP 968 P PP PPP P P PP PP P PPP PP Sbjct: 566 PPVVNCPPTTQSPPPPKYEQTPSPREYYPSPSPPYYQYTSSPPPPTYYATQSPPPPPP 623 Score = 32.3 bits (70), Expect = 0.51 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 4/45 (8%) Frame = +3 Query: 843 PPPPXXXXXR----XPPXXXXXXPXPPPXPPXPXPXXPXXPPPXP 965 PPPP + PP PPP PP P PPP P Sbjct: 607 PPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPP 651 Score = 31.5 bits (68), Expect = 0.88 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 7/57 (12%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPP-------LXXXXXPPPPPPXPP 978 P PPP + P P PP P PP PPPPP PP Sbjct: 480 PSFRATPPPPSSKMSPSVKAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPP 536 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 3/46 (6%) Frame = +1 Query: 838 PPPPPPXPXPX---AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 PPPP P PP P PP PP PPPP Sbjct: 471 PPPPSSKMSPSFRATPPPPSSKMSPSVKAYPPPPPPPEYEPSPPPP 516 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +1 Query: 799 YSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 Y P P P PP PP PP PP PPPP PP Sbjct: 583 YEQTPSPREYYPSPSPPYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPP 642 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 4/57 (7%) Frame = +3 Query: 810 PTXXXXPPXXPPP----PPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 PT PPP PP PP PP PP PPP PP Sbjct: 624 PTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPP 680 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 4/53 (7%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXR----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PP PPP P PPP P P P P P P PP Sbjct: 684 PPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVTQSPPPPSPVYYPPVAKSPPPP 736 Score = 30.7 bits (66), Expect = 1.5 Identities = 22/69 (31%), Positives = 22/69 (31%), Gaps = 9/69 (13%) Frame = +2 Query: 788 TXXXTHSXNXPPPXPXX-----PPPPPXXXXXXR----PPPXXXXPXXXPPXXPXPXPSX 940 T T S PPP PPPPP PPP P P P S Sbjct: 611 TYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPPVYYSP 670 Query: 941 PXXXPPXPP 967 PP PP Sbjct: 671 VTQSPPPPP 679 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/62 (27%), Positives = 18/62 (29%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P + P PP P P PP P PP P P P PP Sbjct: 677 PPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVTQSPPPPSPVYYPPVAKSPPPP 736 Query: 969 XP 974 P Sbjct: 737 SP 738 Score = 29.9 bits (64), Expect = 2.7 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 3/48 (6%) Frame = +3 Query: 840 PPPPPXXXXX---RXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 PPPPP PP P PP P P P PP P Sbjct: 633 PPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPP 680 Score = 29.9 bits (64), Expect = 2.7 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 6/52 (11%) Frame = +3 Query: 840 PPPPPXXXXX--RXPPXXXXXXPX----PPPXPPXPXPXXPXXPPPXPPXPP 977 PPPPP + PP P PPP P P PPP P P Sbjct: 676 PPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVTQSPPPPSPVYYP 727 Score = 29.5 bits (63), Expect = 3.6 Identities = 16/52 (30%), Positives = 17/52 (32%), Gaps = 2/52 (3%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP--PPPXPPF 981 P PP P P P P P PP P P P P PP+ Sbjct: 549 PPPPSPSPPPPYIYSSPPPVVNCPPTTQSPPPPKYEQTPSPREYYPSPSPPY 600 Score = 29.5 bits (63), Expect = 3.6 Identities = 18/62 (29%), Positives = 18/62 (29%), Gaps = 8/62 (12%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXP--------PPPPPX 972 P PP PPP P P PP PP P P PP Sbjct: 738 PVYYPPVTQSPPPPSTPVEYHPPASPNQSPPPEYQSPPPKGCNDSPSNDHHYQTPTPPSL 797 Query: 973 PP 978 PP Sbjct: 798 PP 799 Score = 29.5 bits (63), Expect = 3.6 Identities = 17/58 (29%), Positives = 20/58 (34%), Gaps = 7/58 (12%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPX-------PPLXXXXXPPPPPPXPPF 981 PP PPP + P PP PP PP+ PPPP P+ Sbjct: 768 PPEYQSPPPKGCNDSPSNDHHYQTPTPPSLPPPYYEDTPLPPIRGVSYASPPPPSIPY 825 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 850 PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP---PXPP 978 PP P P P PP P + PPPPP P PP Sbjct: 471 PPPPSSKMSP--SFRATPPPPSSKMSPSVKAYPPPPPPPEYEPSPP 514 Score = 28.7 bits (61), Expect = 6.2 Identities = 25/82 (30%), Positives = 27/82 (32%) Frame = +3 Query: 714 PPPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXX 893 PPPE PS S + S P L+ P PP PP PP Sbjct: 505 PPPEYEPSPPP-PSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPP---Y 560 Query: 894 XXPXPPPXPPXPXPXXPXXPPP 959 PPP P P PPP Sbjct: 561 IYSSPPPVVNCP-PTTQSPPPP 581 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 1/49 (2%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXP-XPPXXPPXPPLXXXXXPPP 960 P P PP P P PP P PP P P PPP Sbjct: 728 PVAKSPPPPSPVYYPPVTQSPPPPSTPVEYHPPASPNQSPPPEYQSPPP 776 Score = 28.3 bits (60), Expect = 8.2 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = +2 Query: 806 SXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 S PP P P PPP P PP PS PP PP P Sbjct: 481 SFRATPPPPSSKMSPSVKAYPPPPPPPEYEPSPPPPSSEM-SPSV-RAYPPPPPLSP 535 >At5g08230.1 68418.m00965 PWWP domain-containing protein putative transcription factor (HUA2) - Arabidopsis thaliana, EMBL:AF116556 Length = 1445 Score = 45.6 bits (103), Expect = 5e-05 Identities = 22/58 (37%), Positives = 22/58 (37%) Frame = +1 Query: 805 LXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 L P PP P PP P P PP P PP P PP PPP P P Sbjct: 1118 LPSFPAGSPPLPHESPPSPPPQ--PPSSPPPPSSPPQLAPAPPPSDHCLPPPTAPLAP 1173 Score = 33.9 bits (74), Expect = 0.17 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Frame = +1 Query: 811 QXPXXXPPXPP--PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP 957 + P PP PP PPPP P P PP P P PP Sbjct: 1131 ESPPSPPPQPPSSPPPPSSPPQLAPAPPPSDHCLPPPTAPLAPAQSIALPP 1181 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/58 (29%), Positives = 18/58 (31%) Frame = +3 Query: 804 TLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 + P P PP P PP PP P P P PPP P P Sbjct: 1120 SFPAGSPPLPHESPPSPPP----QPPSSPPPPSSPPQLAPAPPPSDHCLPPPTAPLAP 1173 Score = 28.7 bits (61), Expect = 6.2 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 4/57 (7%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPX----PPXPXPXXPXXPPPXPP 968 P PP PP PP P P PPP PP P P PP Sbjct: 1127 PLPHESPPSPPPQPPSSPPP--PSSPPQLAPAPPPSDHCLPPPTAPLAPAQSIALPP 1181 >At2g25050.1 68415.m02996 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 1111 Score = 45.6 bits (103), Expect = 5e-05 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PPPPP P P P PP PP L PPPPPP Sbjct: 601 PPPPPPPPPLQSHRSALSSSPLPPPLPPKKLLATTNPPPPPPP 643 Score = 39.5 bits (88), Expect = 0.003 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 8/58 (13%) Frame = +1 Query: 829 PPXPPPPPP----XPXPXAXPPXGXXPXPXPPXXPPXPPL----XXXXXPPPPPPXPP 978 PP PPPPPP P PP PP PPL P PPP PP Sbjct: 571 PPPPPPPPPISSLRSTPSPSSTSNSIATQGPPPPPPPPPLQSHRSALSSSPLPPPLPP 628 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 844 PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P PP P PP PL PPPPPP PP Sbjct: 536 PQSPTPVHSNGPPSAEAAVTSSPL-PPLKPLRILSRPPPPPPPPP 579 Score = 37.5 bits (83), Expect = 0.013 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 PPPPP + P PPP PP PPP PP Sbjct: 601 PPPPPPPPPLQSHRSALSSSPLPPPLPPKKLLATTNPPPPPPP 643 Score = 34.3 bits (75), Expect = 0.13 Identities = 27/88 (30%), Positives = 27/88 (30%), Gaps = 1/88 (1%) Frame = +3 Query: 714 PPPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXX 893 PPP P S S LP L T PP PPPP P Sbjct: 602 PPPPPPPPLQSHRSALSSSPLPPPLPPKKLLATTN---PPPPPPPPLHSNSRMGAPTSSL 658 Query: 894 XXPXPP-PXPPXPXPXXPXXPPPXPPXP 974 PP P PP P P PP P Sbjct: 659 VLKSPPVPPPPAPAPLSRSHNGNIPPVP 686 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP---PPPPXPP 978 PP PPPPP P PP PP P PP P PP Sbjct: 637 PPPPPPPPLHSNSRMGAPTSSLVLKSPPVPPPPAPAPLSRSHNGNIPPVPGPP 689 Score = 31.5 bits (68), Expect = 0.88 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 7/57 (12%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXP-------PXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PPPPP P P PPP PP P PP P Sbjct: 571 PPPPPPPPPISSLRSTPSPSSTSNSIATQGPPPPPPPPPLQSHRSALSSSPLPPPLP 627 Score = 29.5 bits (63), Expect = 3.6 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 3/51 (5%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXP---XPPXXPPXPPLXXXXXPPPPPPXP 975 P PPP PP P P P P L P PPPP P Sbjct: 621 PLPPPLPPKKLLATTNPPPPPPPPLHSNSRMGAPTSSLVLKSPPVPPPPAP 671 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 45.6 bits (103), Expect = 5e-05 Identities = 23/47 (48%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXG-GXGXGXXPXGGXAXGXGXGGGGGGXG 831 G GGG RGG GG G G G G GG G G GG GGG G Sbjct: 88 GNSGGGGSSGGRGGFGGGGGRGGGRGGGSYGGGYGGRGSGGRGGGGG 134 Score = 39.5 bits (88), Expect = 0.003 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGG 839 G G GG GG G G G G G G G GG R GGGGG Sbjct: 88 GNSGGGGSSGGRGGFGGGGGRGGGRGGGSYGGGYGG-RGSGGRGGGGG 134 Score = 39.5 bits (88), Expect = 0.003 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXG--GXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GGGGG G G G G GG G GGGGGG GG Sbjct: 127 GGRGGGGGDNSCFKCGEPGHMARECSQGGGGYSGGGGGGRYGSGGGGGGGGG 178 Score = 36.7 bits (81), Expect = 0.024 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G G GGG G G GG GG G GGGG GG Sbjct: 110 GGRGGGSYGGGYGGRGSGGRGGGGGDNSCFKCGEPGHMARECSQGGGGYSGG 161 Score = 36.3 bits (80), Expect = 0.031 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GGG GG RGG GG G G GG GG GG G Sbjct: 115 GSYGGGYGGRGSGGRGGGGGDNSCFKCGEPGHMARECSQGGGGYSGGGGGGRYG 168 Score = 35.1 bits (77), Expect = 0.072 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXG 899 GG G GGG G G G GG GGG G Sbjct: 154 GGGGYSGGGGGGRYGSGGGGGGGGGG 179 Score = 33.5 bits (73), Expect = 0.22 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G G G G GG GGG G GG G G G GG Sbjct: 80 GPDGAPVQGNSGGGGSSGGRGGFGGGGGRGGGRGGGSYGGGYGGRGSGGRGG 131 Score = 31.5 bits (68), Expect = 0.88 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = -1 Query: 967 GGXGGGXXGXXGXGXGGXGG-GXGXXXXXXGGXRXXXXXGGGGGXXG 830 G GGG G GG GG G G GG GG GG G Sbjct: 88 GNSGGGGSSGGRGGFGGGGGRGGGRGGGSYGGGYGGRGSGGRGGGGG 134 Score = 31.5 bits (68), Expect = 0.88 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -2 Query: 963 GXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG G G G G G G GGG G G G G GGG Sbjct: 91 GGGGSSGGRGGFGGGGGRGGGRGGGSYGGG-----YGGRGSGGRGGGGG 134 >At2g28490.1 68415.m03462 cupin family protein similar to preproMP27-MP32 [Cucurbita cv. Kurokawa Amakuri] GI:691752, allergen Gly m Bd 28K [Glycine max] GI:12697782, vicilin [Matteuccia struthiopteris] GI:1019792; contains Pfam profile PF00190: Cupin Length = 511 Score = 45.2 bits (102), Expect = 7e-05 Identities = 23/53 (43%), Positives = 23/53 (43%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXW 810 GG GGG GG G GG G G GG G G GGGG GG W Sbjct: 35 GGAGGGEWGGAEGG--GAWGGGGGGGGAWGGEGEGGGEWGGGGEGGGGGRRGW 85 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXG 830 G GG GG G G GG GGG GG GGGGG G Sbjct: 36 GAGGGEWGGAEGGGAWGGGGGGGGAWGGEGEGGGEWGGGGEGGGGGRRG 84 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 929 GXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 G G G G GG G GGGGGG G Sbjct: 27 GYEGEEEWGGAGGGEWGGAEGGGAWGGGGGGGG 59 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 45.2 bits (102), Expect = 7e-05 Identities = 24/62 (38%), Positives = 25/62 (40%), Gaps = 8/62 (12%) Frame = +1 Query: 817 PXXXPPXPPPPPPX------PXPXAXPPXGXXPXPXPPXXPPXP--PLXXXXXPPPPPPX 972 P PP PP PP P P + PP P P P PP P P PPP P Sbjct: 93 PATPPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVS 152 Query: 973 PP 978 PP Sbjct: 153 PP 154 Score = 44.8 bits (101), Expect = 9e-05 Identities = 23/59 (38%), Positives = 24/59 (40%), Gaps = 5/59 (8%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXP---PXGXXPXPXPPXXPPXP--PLXXXXXPPPPPPXPP 978 P P PPP PP P + P P P P P PP P P PPP P PP Sbjct: 89 PVISPATPPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPP 147 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/55 (38%), Positives = 22/55 (40%), Gaps = 2/55 (3%) Frame = +1 Query: 817 PXXXPPXPPPPP--PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P PPP P P P P + PP P P P PP PP P P P Sbjct: 118 PPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPPVQAPSPISLPPAPAPAP 172 Score = 42.3 bits (95), Expect = 5e-04 Identities = 19/54 (35%), Positives = 20/54 (37%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P P P P P + PP P P P PP P P P PP Sbjct: 113 PPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPPVQAPSPISLPP 166 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPP--PPPXXXXXRXPPXXXXXXPX-PPPXPPXPXPXXPXXPPPXPPXPP 977 PP PP PP PP P PPP P P P P PPP P PP Sbjct: 96 PPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASP-PPAPASPPPAPASPP 147 Score = 39.1 bits (87), Expect = 0.004 Identities = 21/58 (36%), Positives = 22/58 (37%), Gaps = 3/58 (5%) Frame = +2 Query: 818 PPPXPXXPPP---PPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXPXS 982 PPP P PP P PPP P P P P P+ P P PP P S Sbjct: 96 PPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPP-PAPASPPPAPASPPPAPVS 152 Score = 37.5 bits (83), Expect = 0.013 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P PP P P PP PP PP P PPP P PP Sbjct: 85 PKVAPVISPATPP-PQPPQSPPASAPTVSPPPVSPPPAPTS----PPPTPASPP 133 Score = 36.7 bits (81), Expect = 0.024 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 5/60 (8%) Frame = +3 Query: 813 TXXXXPPXXPP---PPPXXXXXRXPPXXXXXXPXPPPXPPXP--XPXXPXXPPPXPPXPP 977 T PP PP P PP P P PP P P P PPP P PP Sbjct: 95 TPPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPP 154 Score = 36.3 bits (80), Expect = 0.031 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXP---PXXPPXPPLXXXXXPPPPPPXPP 978 PPP P A P P P P PP P + P PPP PP Sbjct: 52 PPPTTTTPPVSAAQPPASPVTPPPAVTPTSPPAPKVAPVISPATPPPQPP 101 Score = 35.9 bits (79), Expect = 0.041 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXPPP---PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PPP P P P P P PP P PP PPP PP Sbjct: 66 PPASPVTPPPAVTPTSPPAPKVAPVIS--PATPPPQPPQSPPASAPTVSPPPVSPPP 120 Score = 35.5 bits (78), Expect = 0.054 Identities = 23/74 (31%), Positives = 23/74 (31%), Gaps = 11/74 (14%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPP----XXXXXXPXPPPXPPXPXP------- 935 P T P PP P PP PP PPP PP P Sbjct: 53 PPTTTTPPVSAAQPPASPVTPPPAVTPTSPPAPKVAPVISPATPPPQPPQSPPASAPTVS 112 Query: 936 XXPXXPPPXPPXPP 977 P PPP P PP Sbjct: 113 PPPVSPPPAPTSPP 126 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 1/56 (1%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPX-PPPXPPXPXPXXPXXPPPXPPXP 974 P PP PPP P P PPP P P P P PP P Sbjct: 113 PPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPPVQAPSPISLPPAP 168 Score = 33.5 bits (73), Expect = 0.22 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 PT P PP P P P P P P P P P PP P P Sbjct: 109 PTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSP--PPVQAPSP 161 Score = 33.1 bits (72), Expect = 0.29 Identities = 19/62 (30%), Positives = 20/62 (32%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P + PT P PPP P PP P P PP P PP P Sbjct: 115 PVSPPPAPTSPPPTPASPPPAPASP----PPAPASPPPAPVSPPPVQAPSPISLPPAPAP 170 Query: 969 XP 974 P Sbjct: 171 AP 172 Score = 32.7 bits (71), Expect = 0.38 Identities = 17/62 (27%), Positives = 18/62 (29%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P T P P P P + PP PP PP P P PP Sbjct: 75 PAVTPTSPPAPKVAPVISPATPPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPP 134 Query: 969 XP 974 P Sbjct: 135 AP 136 Score = 30.7 bits (66), Expect = 1.5 Identities = 22/70 (31%), Positives = 22/70 (31%), Gaps = 4/70 (5%) Frame = +2 Query: 785 TTXXXTHSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXP--XPXPSXPXXXPP 958 TT S PP P PPP P PP P P S P PP Sbjct: 55 TTTTPPVSAAQPPASPVTPPPAVTPTSPPAPKVAPVISPATPPPQPPQSPPASAPTVSPP 114 Query: 959 --XPPXXPXS 982 PP P S Sbjct: 115 PVSPPPAPTS 124 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 4/51 (7%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXP----XPPXXPPXPPLXXXXXPPPPPPXPP 978 PPP P A PP P PP P PP PP P P Sbjct: 39 PPPTTAAPPTTAAPPPTTTTPPVSAAQPPASPVTPPPAVTPTSPPAPKVAP 89 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/56 (30%), Positives = 18/56 (32%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PT P P P + P P P P P P PPP P PP Sbjct: 79 PTSPPAPKVAPVISPATPPPQPPQSPPASAPTVSPPPVSPPPAP-TSPPPTPASPP 133 Score = 28.7 bits (61), Expect = 6.2 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 2/50 (4%) Frame = +2 Query: 824 PXPXXPP--PPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 P PP PPP PPP P P P P P+ P P PP Sbjct: 109 PTVSPPPVSPPP---APTSPPPTPASP-PPAPASPPPAPASPPPAPVSPP 154 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 45.2 bits (102), Expect = 7e-05 Identities = 24/66 (36%), Positives = 26/66 (39%), Gaps = 6/66 (9%) Frame = +1 Query: 802 SLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP---XXPPXPPLXXXXXPPP---P 963 S+ P PP P PPPP PP P PP PP PP PPP Sbjct: 452 SVRAYPPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPYVYS 511 Query: 964 PPXPPF 981 P PP+ Sbjct: 512 SPPPPY 517 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 7/57 (12%) Frame = +1 Query: 829 PPXP-----PPPPPXPXPXAXPPXGXXPXPXPPXX--PPXPPLXXXXXPPPPPPXPP 978 PP P PPPPP PP P PP P PP PPPPP PP Sbjct: 475 PPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPP 531 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 P P PPP P P P P PP P P P P PP P P Sbjct: 606 PQVTPSPPPPSPLYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPP 658 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Frame = +2 Query: 821 PPXPXXPPPP-PXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PP PPPP P P P P PP P P P P PP P P Sbjct: 591 PPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPPSPVYYPPVTPSPP 643 Score = 41.5 bits (93), Expect = 8e-04 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = +1 Query: 847 PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP----PPPXPPF 981 PPP P P P P PP P PP PPP PP PP+ Sbjct: 441 PPPPPYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPPY 489 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 PP P PPPP P PP PP P PPPP P + Sbjct: 524 PPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSPVY 574 Score = 40.7 bits (91), Expect = 0.001 Identities = 24/63 (38%), Positives = 25/63 (39%), Gaps = 8/63 (12%) Frame = +1 Query: 817 PXXXPPX---PPPPPPXPXPXAXP-PXGXXPXPXPPXXPPXPPLXXXXXPP----PPPPX 972 P PP PPPP P P P P P PP P PP PP PPPP Sbjct: 587 PVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPPSPVYYPPVTPSPPPPS 646 Query: 973 PPF 981 P + Sbjct: 647 PVY 649 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 5/54 (9%) Frame = +3 Query: 810 PTXXXXPPXXP-----PPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPP 956 P PP P PPPP PP P PPP PP P P PP Sbjct: 488 PYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPPP 541 Score = 40.3 bits (90), Expect = 0.002 Identities = 24/64 (37%), Positives = 25/64 (39%), Gaps = 9/64 (14%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXP-----XPPXXPPXPPLXXXXXPP----PPPP 969 P P P PPP P P PP P P PP P PP PP PPPP Sbjct: 602 PVYYPQVTPSPPP-PSPLYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPP 660 Query: 970 XPPF 981 P + Sbjct: 661 SPVY 664 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 5/55 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXP-----PXPP 967 PP P PPP P P P P PP P P P P P P PP Sbjct: 621 PPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPSETQSPPPP 675 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/58 (32%), Positives = 20/58 (34%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 +S PPP PPPP PPP P P P P PP P P Sbjct: 481 YSSPPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSP 538 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/54 (37%), Positives = 21/54 (38%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 +S PPP PPPP PP P PP P P P P PP P Sbjct: 491 YSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSP---PPPPPSPPPPCPESSPPPP 541 Score = 38.7 bits (86), Expect = 0.006 Identities = 23/59 (38%), Positives = 24/59 (40%), Gaps = 8/59 (13%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXX-PXPXPPXX--PPXPPLXXXXXPPPP-----PPXPPF 981 PP PP P A PP P P PP P PP PPPP PP PP+ Sbjct: 441 PPPPPYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPY 499 Score = 38.7 bits (86), Expect = 0.006 Identities = 22/55 (40%), Positives = 23/55 (41%), Gaps = 5/55 (9%) Frame = +1 Query: 829 PPXPP-----PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PP PPPP + PP P PP PP PPPP P PP Sbjct: 484 PPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPP------PPPPSPPPP 532 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/58 (32%), Positives = 20/58 (34%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 +S PP PPPPP PPP P P P PP PP P Sbjct: 472 YSSPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSP 529 Score = 37.9 bits (84), Expect = 0.010 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +1 Query: 847 PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PPP P P P PP P + PPPP P PP Sbjct: 424 PPPPPSSKMSPSVRAYSPPPPPYSKMSPSVRAYPPPPPPSPSPP 467 Score = 37.9 bits (84), Expect = 0.010 Identities = 20/51 (39%), Positives = 21/51 (41%), Gaps = 5/51 (9%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP-----XPPXPP 977 PPPPP + P P PPP P P P PPP PP PP Sbjct: 441 PPPPPYS---KMSPSVRAYPPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPP 488 Score = 37.9 bits (84), Expect = 0.010 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 4/54 (7%) Frame = +1 Query: 829 PPXP----PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP P PPPP PP P P P PP P + PPP P Sbjct: 504 PPPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSP 557 Score = 37.5 bits (83), Expect = 0.013 Identities = 25/72 (34%), Positives = 27/72 (37%), Gaps = 10/72 (13%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPP--PPPXPXPXAXPPXGXXPXPXPPXXPP----XPPLXXXXXPP 957 +YS P PP P P PP P P P P P PP PP PP Sbjct: 518 VYSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSPVYYPP 577 Query: 958 ----PPPPXPPF 981 PPPP P + Sbjct: 578 VTNSPPPPSPVY 589 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 PP PPPP PP P PP P P P PP P Sbjct: 524 PPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSP 572 Score = 37.5 bits (83), Expect = 0.013 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 9/62 (14%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXX---------PPXPPLXXXXXPPPPPP 969 P PP PPP P P PP P P P PP P P PPPP Sbjct: 557 PVYYPPVTQSPPP-PSPVYYPPVTNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPP 615 Query: 970 XP 975 P Sbjct: 616 SP 617 Score = 37.1 bits (82), Expect = 0.018 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PP P PPPP PP P P P P P P PP Sbjct: 522 PPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPP 570 Score = 37.1 bits (82), Expect = 0.018 Identities = 22/64 (34%), Positives = 23/64 (35%), Gaps = 9/64 (14%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXX---------PPXPPLXXXXXPPPPPP 969 P PP PPP P P PP P P P PP P P PPPP Sbjct: 572 PVYYPPVTNSPPP-PSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPP 630 Query: 970 XPPF 981 P + Sbjct: 631 SPVY 634 Score = 36.3 bits (80), Expect = 0.031 Identities = 20/55 (36%), Positives = 21/55 (38%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P+ PP P PPP PP P P PP P P P P PP P Sbjct: 615 PSPLYYPPVTPSPPPPSPVY-YPPVT------PSPPPPSPVYYPPVTPSPPPPSP 662 Score = 36.3 bits (80), Expect = 0.031 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 5/51 (9%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXP-PXGXXPXPXPPXXPPXPPLXXXXXP----PPPPP 969 P PPPP P P P P P PP P PP P PPPP Sbjct: 625 PSPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPSETQSPPPP 675 Score = 35.9 bits (79), Expect = 0.041 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 11/57 (19%) Frame = +1 Query: 829 PPXP-----PPPPPXPXPXAXPP--XGXXPXP----XPPXXPPXPPLXXXXXPPPPP 966 PP P PPPPP PP P P PP PP PP PPPP Sbjct: 485 PPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPPP 541 Score = 35.9 bits (79), Expect = 0.041 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = +2 Query: 821 PPXPXXPPPP-PXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PP PPPP P P P P P P P P PP P P Sbjct: 576 PPVTNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPP 628 Score = 35.9 bits (79), Expect = 0.041 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 1/56 (1%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXP-XPPPXPPXPXPXXPXXPPPXPPXP 974 P PP P P PP P P P PP P P P P PP P Sbjct: 592 PVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPPSPVYYPPVTPSPPPPSP 647 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/64 (29%), Positives = 21/64 (32%), Gaps = 2/64 (3%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPP--PPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPX 962 P + + P PP P PP P P P PP P P P P Sbjct: 569 PPSPVYYPPVTNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPP 628 Query: 963 PPXP 974 PP P Sbjct: 629 PPSP 632 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 4/52 (7%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP----PPPPXPPF 981 PPP P P P P PP PP PP PPPP P + Sbjct: 553 PPPSPVYYPPVTQSPPPPSPVYYPPVTNSPPPPSPVYYPPVTYSPPPPSPVY 604 Score = 33.1 bits (72), Expect = 0.29 Identities = 22/72 (30%), Positives = 25/72 (34%), Gaps = 9/72 (12%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXX--PPPPPXXXXXRXPPXXXXXXPXPPP---XPPXPXPXXPXXP 953 P + ++ PP P PPP PP P PPP P P P P Sbjct: 445 PYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYVYSSP 504 Query: 954 PP----XPPXPP 977 PP P PP Sbjct: 505 PPPYVYSSPPPP 516 Score = 32.7 bits (71), Expect = 0.38 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXP-SXPXXXPPXPP 967 PPP PPPP PPP P P P P P PP Sbjct: 505 PPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPP 555 Score = 32.7 bits (71), Expect = 0.38 Identities = 24/91 (26%), Positives = 28/91 (30%), Gaps = 3/91 (3%) Frame = +3 Query: 714 PPPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXX 893 PPP + P C S + + P+ PP PPP P Sbjct: 524 PPPPSPPPPCPESSPPPPVVYYAPVTQSPPP-PSPVYYPPVTQSPPPPSPVYYPPVTNSP 582 Query: 894 XXPXP---PPXPPXPXPXXPXXPPPXPPXPP 977 P P PP P P P P P PP Sbjct: 583 PPPSPVYYPPVTYSPPPPSPVYYPQVTPSPP 613 Score = 32.3 bits (70), Expect = 0.51 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 2/57 (3%) Frame = +1 Query: 805 LXQXPXXXPPXPPPPP--PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 L P P PP P P P PP P P PP P+ PPP Sbjct: 618 LYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPSETQSPPP 674 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/53 (28%), Positives = 15/53 (28%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PP P PPP P P P P P P P P P Sbjct: 636 PPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPSETQSPPPPTEYYYSPSQSPPP 688 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 3/49 (6%) Frame = +1 Query: 832 PXPPPPPP---XPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PPPP P P + PP P PP PP P PP Sbjct: 640 PSPPPPSPVYYPPVTPSPPPPSPVYYPSETQSPP-PPTEYYYSPSQSPP 687 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 3/46 (6%) Frame = +1 Query: 838 PPPPPPXPXPXAX---PPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 PPPP P PP P PP P PPPPP Sbjct: 383 PPPPTFKMSPEVRTLPPPIYVYSSPPPPPSSKMSPTVRAYSPPPPP 428 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +1 Query: 847 PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 PPP P P P PP P + PPPP Sbjct: 407 PPPPPSSKMSPTVRAYSPPPPPSSKMSPSVRAYSPPPPP 445 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 4/56 (7%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP----XPPXXP 976 P PPP P P P PP P P P PP PP P Sbjct: 547 PVTQSPPPPSPVYYPPVTQSPPPPSPVYYPPVTNSPPPPSPVYYPPVTYSPPPPSP 602 Score = 29.9 bits (64), Expect = 2.7 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 5/51 (9%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPP-----PXPPXPXPXXPXXPPPXPPXPP 977 PPPPP PP P PP P P P P PP PP Sbjct: 522 PPPPPPSP----PPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPP 568 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PP PP P P P P P P P PP Sbjct: 506 PPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPP 555 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PPP P P PPP P P P P PP PP Sbjct: 441 PPPPPYSKMSPSVRAYPPPPPPSPSPP--PPYVYSSPPPPYVYSSPPPPP 488 Score = 29.1 bits (62), Expect = 4.7 Identities = 18/64 (28%), Positives = 20/64 (31%), Gaps = 3/64 (4%) Frame = +1 Query: 799 YSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPX---PPLXXXXXPPPPPP 969 YS Q P PP P PP PP P PP+ PPP Sbjct: 680 YSPSQSPPPTKACKEGHPPQATPSYEPPPEYSYSSSPPPPSPTSYFPPMPSVSYDASPPP 739 Query: 970 XPPF 981 P + Sbjct: 740 PPSY 743 Score = 28.7 bits (61), Expect = 6.2 Identities = 20/67 (29%), Positives = 20/67 (29%), Gaps = 11/67 (16%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPP-------PXPPXPXPXXPXXP----P 956 PT P PPP PP PP P PP P P P Sbjct: 675 PTEYYYSPSQSPPPTKACKEGHPPQATPSYEPPPEYSYSSSPPPPSPTSYFPPMPSVSYD 734 Query: 957 PXPPXPP 977 PP PP Sbjct: 735 ASPPPPP 741 Score = 28.3 bits (60), Expect = 8.2 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 2/51 (3%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPP--XXPXPXPSXPXXXPPXPP 967 P PPPPP PPP PP P P PP PP Sbjct: 451 PSVRAYPPPPP---PSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPP 498 Score = 28.3 bits (60), Expect = 8.2 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 4/55 (7%) Frame = +1 Query: 829 PPXPPP----PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 PP P P P P G P P PP P PPPP P F Sbjct: 672 PPPPTEYYYSPSQSPPPTKACKEGHPPQATPSYEPP-PEYSYSSSPPPPSPTSYF 725 Score = 28.3 bits (60), Expect = 8.2 Identities = 17/58 (29%), Positives = 18/58 (31%), Gaps = 4/58 (6%) Frame = +2 Query: 806 SXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXP----XPXPSXPXXXPPXPP 967 S + PP PP PPP PP P P PS P PP Sbjct: 683 SQSPPPTKACKEGHPPQATPSYEPPPEYSYSSSPPPPSPTSYFPPMPSVSYDASPPPP 740 >At1g02710.1 68414.m00222 glycine-rich protein Length = 96 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 G GGG G GG G GG G G GG G GGGG G G Sbjct: 30 GGNGGGSGKGQWLHGGGGEGGGGEGGGGEGGGGQKISKGGGGGGSGGG 77 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGG-GXGG 828 GG G GGGG GG G G G GG G GGGGG G GG Sbjct: 44 GGGGEGGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGGGEGDGG 94 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 4/51 (7%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGX----GGXXGGXGXGXXPXGGXAXGXGXGGGGGG 837 GG GGGG G GG GG GG G G G G G G GGGG Sbjct: 46 GGEGGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGGGEGDGGGG 96 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/52 (42%), Positives = 23/52 (44%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG G G G G G GG GGG GG + GGGGG GG Sbjct: 31 GNGGGSGKGQWLHGGGGEGGGGEGGGG-----EGGGGQKISKGGGGGGSGGG 77 Score = 39.1 bits (87), Expect = 0.004 Identities = 24/54 (44%), Positives = 24/54 (44%), Gaps = 2/54 (3%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXG--XGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G GG GGG G G GG GGG G GG R GGGGG G Sbjct: 46 GGEGGGGEGGGGEGGGGQKISKGGGGGGSG------GGQRSSSGGGGGGGEGDG 93 Score = 32.3 bits (70), Expect = 0.51 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 958 GGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G G GG GGG G GG GGGG GG Sbjct: 18 GLGLFGTHSLQAGGNGGGSGKGQWLHGGGGEGGGGEGGGGEGGG 61 >At4g30460.1 68417.m04325 glycine-rich protein Length = 162 Score = 44.8 bits (101), Expect = 9e-05 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 965 GGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GGGGG G G G G G G G G GGG GG GG G Sbjct: 85 GGGGGDAGSEAGSYAGSHAGSGSGGRSGSGRGRGSGGGGGHGGGGGGGGG 134 Score = 44.8 bits (101), Expect = 9e-05 Identities = 24/54 (44%), Positives = 24/54 (44%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG G G G GG GG GG G G GG G G G GGG GG G Sbjct: 108 GGRSGSGRGRGSGGGGGHGGGGGGGG-GRGGGGGSGNGEGYGEGGGYGGGYGGG 160 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GG G G G G G G G G GGGGGG GG G Sbjct: 85 GGGGGDAGSEAGSYAGSHAGSGSGGRSGSGRGRGSGGGGGHGGGGGGGGGRGGG 138 Score = 41.9 bits (94), Expect = 6e-04 Identities = 22/54 (40%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGG-GXGGXXXGXW 810 G G GG RG G GG G G GG G G G G G G GG G + Sbjct: 104 GSGSGGRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGGGY 157 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG G G G G G GG GGG G GG G GGG GG Sbjct: 106 GSGGRSGSGRGRGSGGGGGHGG-GGGGGGGRGGGGGSGNGEGYGEGGGYGGG 156 Score = 36.7 bits (81), Expect = 0.024 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Frame = -1 Query: 982 GXGGXG-GXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G G G G G G G G GG GGG G G G GGG GG Sbjct: 109 GRSGSGRGRGSGGGGGHGGGGGG-GGGRGGGGGSGNGEGYGEGGGYGGGYGGG 160 Score = 35.1 bits (77), Expect = 0.072 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G G G G G G GG G GGG G G G GGG Sbjct: 100 GSHAGSGSGGRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGG 152 Score = 32.3 bits (70), Expect = 0.51 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXG 830 G G G GGG G G G G GG G GGGGG G Sbjct: 43 GIGIGIGIGGGGSGS-GAGAGSGSGGGGSSSSSSSSSSSSSSSGGGGGDAG 92 Score = 31.5 bits (68), Expect = 0.88 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 G GGGG G G G GG G + GGGGG G Sbjct: 49 GIGGGGSGSG----AGAGSGSGGGGSSSSSSSSSSSSSSSGGGGGDAG 92 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GGGG GG G G G G G GG G G Sbjct: 64 GSGGGGSSSSSSSSSSSSSSSGGGGGDAGSEAGSYAGSHAGSGSGGRSGSGRG 116 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -1 Query: 958 GGGXXGXXGXGXG-GXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G G G G G G GGG G GG GGGGG G Sbjct: 104 GSGSGGRSGSGRGRGSGGGGGHGGGGGGG----GGRGGGGGSGNG 144 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 44.8 bits (101), Expect = 9e-05 Identities = 21/50 (42%), Positives = 22/50 (44%), Gaps = 3/50 (6%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPP---XXPPXPPLXXXXXPPPPPP 969 PP PP P P P + PP P PP PP PP PPP PP Sbjct: 735 PPPPPTPIHSPPPQSHPPCIEYSPPPPPTVHYNPPPPPSPAHYSPPPSPP 784 Score = 43.6 bits (98), Expect = 2e-04 Identities = 23/57 (40%), Positives = 24/57 (42%), Gaps = 8/57 (14%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXX----PPXPPLXXXXXPPPPP----PXPP 978 P PPP P P PP P PP PP PP+ PPPPP P PP Sbjct: 768 PPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPPPIYEGPLPP 824 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/55 (34%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXP-PPPPPXPP 978 P P P P P P + PP P P P PP P P PP PP Sbjct: 547 PSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSPSPPLPP 601 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPX--PXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P PP P P P P P PP P PP PP P PP Sbjct: 552 PTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSPSPPLPPVIPSPP 607 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PPPP PP P PPP P P P PP PP Sbjct: 792 PPPPAVHYSPPPPPVIHHSQPPPPPIYEGPLPPIPGISYASPPPPP 837 Score = 37.9 bits (84), Expect = 0.010 Identities = 20/63 (31%), Positives = 22/63 (34%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P + T P+ PP P PP P PP P P P P PP P Sbjct: 507 PPSSPTTPSPGGSPPSPSISPSPPITVPSPPSTPTS-PGSPPSPSSPTPSSPIPSPPTPS 565 Query: 969 XPP 977 PP Sbjct: 566 TPP 568 Score = 37.5 bits (83), Expect = 0.013 Identities = 18/51 (35%), Positives = 20/51 (39%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 P P P P P + P P P P PP P+ PP P PPF Sbjct: 537 PSTPTSPGSPPSPSSPTPSSPIPSPPTPSTPP-TPISPGQNSPPIIPSPPF 586 Score = 37.1 bits (82), Expect = 0.018 Identities = 22/68 (32%), Positives = 23/68 (33%), Gaps = 5/68 (7%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXP--PPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP- 959 P + P PP PPPP PP PPP PP P PP Sbjct: 738 PPTPIHSPPPQSHPPCIEYSPPPPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPPAV 797 Query: 960 --XPPXPP 977 PP PP Sbjct: 798 HYSPPPPP 805 Score = 36.7 bits (81), Expect = 0.024 Identities = 20/50 (40%), Positives = 21/50 (42%), Gaps = 5/50 (10%) Frame = +1 Query: 844 PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP-----PXPP 978 PPPP PP P P PP PP+ PPPPP P PP Sbjct: 758 PPPPPTVHYNPPP---PPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPP 804 Score = 36.3 bits (80), Expect = 0.031 Identities = 28/82 (34%), Positives = 29/82 (35%), Gaps = 10/82 (12%) Frame = +1 Query: 754 HXINLXVXXTDYLXLYSLXQXPXXX-----PPXPP-----PPPPXPXPXAXPPXGXXPXP 903 H +NL YS Q P PP P PPPP P PP P P Sbjct: 695 HRLNLASPPPPAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPPPPT-PIHSPPPQSHP-P 752 Query: 904 XPPXXPPXPPLXXXXXPPPPPP 969 PP PP PPPP P Sbjct: 753 CIEYSPPPPPTVHYNPPPPPSP 774 Score = 35.9 bits (79), Expect = 0.041 Identities = 19/55 (34%), Positives = 20/55 (36%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 +S PPP P PPP PP P PP P P PP PP Sbjct: 710 YSSPQPPPPPHYSLPPPTPTYHYISPPPPPTPIHSPP--PQSHPPCIEYSPPPPP 762 Score = 35.9 bits (79), Expect = 0.041 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PT PP PP P PP P PPP P P PP PP Sbjct: 762 PTVHYNPPP-PPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPPP 816 Score = 35.5 bits (78), Expect = 0.054 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PP P PP P P P PP P P P PP Sbjct: 514 PSPGGSPPSPSISPSPPITVPSPPSTPTSPGSPPSPSSPTPSSPIPSPP 562 Score = 35.5 bits (78), Expect = 0.054 Identities = 19/57 (33%), Positives = 20/57 (35%), Gaps = 4/57 (7%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPP----XPPXPXPXXPXXPPPXPP 968 PT P PP P + P P PPP PP P PPP PP Sbjct: 728 PTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPPPTVHYNPPPPPSPAHYSPPPSPP 784 Score = 35.1 bits (77), Expect = 0.072 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXX--PPXPPLXXXXXPPPPPP 969 PPPPP PP P PP P PP+ PPPP Sbjct: 791 PPPPPAVHYSPPPPPVIHHSQPPPPPIYEGPLPPIPGISYASPPPP 836 Score = 34.7 bits (76), Expect = 0.095 Identities = 23/88 (26%), Positives = 23/88 (26%) Frame = +3 Query: 714 PPPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXX 893 P P P S S P T PT PP P P P Sbjct: 443 PSPGGSPPSPSIVPSPPSTTPSPGSPPTSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPT 502 Query: 894 XXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP P P P P P PP Sbjct: 503 PGGSPPSSPTTPSPGGSPPSPSISPSPP 530 Score = 34.7 bits (76), Expect = 0.095 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP P P P PP P PP P PP PP P P Sbjct: 507 PPSSPTTPSPGGSPPSPSIS-PSPPITVPSPPSTPTSPGSPPSPSSP 552 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P P PP P P PP P PP P PP PP P Sbjct: 407 PVVVPSPPTTPSPGGSPPSPSIS-PSPPITVPSPPTTPSPGGSPPSP 452 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = +2 Query: 812 NXPPPXPX--XPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 N PPP P PPPP +PPP P P P PP PP Sbjct: 789 NSPPPPPAVHYSPPPPPVIHHSQPPPPPIYEGPLP-----PIPGISYASPPPPP 837 Score = 33.9 bits (74), Expect = 0.17 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 4/50 (8%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP----XPPXPP 977 PPPPP P P PPP P P P PP PP PP Sbjct: 715 PPPPPHYSLPPPTPTYHYISPPPPPTPIHSPP--PQSHPPCIEYSPPPPP 762 Score = 33.5 bits (73), Expect = 0.22 Identities = 26/98 (26%), Positives = 31/98 (31%), Gaps = 2/98 (2%) Frame = +2 Query: 671 PMRSRKL*KRPRTLSTSRDDAEFLPXXXXXXXXLXEXLTTXXXTHSXNXPPPXPXX--PP 844 P R R L +R T+ + L LT + + PPP P P Sbjct: 654 PSRHRHLLRRKHTIHRNHLHHNPRNLQFTALPLLPLYLTCRHRLNLASPPPPAPYYYSSP 713 Query: 845 PPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP 958 PP PPP PP P P S P P Sbjct: 714 QPPPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHP 751 Score = 33.1 bits (72), Expect = 0.29 Identities = 25/89 (28%), Positives = 29/89 (32%), Gaps = 3/89 (3%) Frame = +3 Query: 717 PPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXXPPP---PPXXXXXRXPPXX 887 PP +PS S S P +T+P+ PP P P PP PP Sbjct: 406 PPVVVPSPPTTPSPGGSPPSPSISPSPPITVPS----PPTTPSPGGSPPSPSIVPSPPST 461 Query: 888 XXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 PP P P P P P P Sbjct: 462 TPSPGSPPTSPTTPTPGGSPPSSPTTPTP 490 Score = 32.3 bits (70), Expect = 0.51 Identities = 19/60 (31%), Positives = 20/60 (33%), Gaps = 4/60 (6%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXP--XPXXPXXPPP--XPPXPP 977 P+ PP P PP P P PP P P P P P P PP P Sbjct: 426 PSISPSPPITVPSPPTTPSPGGSPPSPSIVPSPPSTTPSPGSPPTSPTTPTPGGSPPSSP 485 Score = 32.3 bits (70), Expect = 0.51 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PP P P PP P P PP P PP+ PPP P Sbjct: 578 PPIIPSPPFTGPSPPSSPSP-PLPPVI-PSPPIVGPTPSSPPPSTP 621 Score = 31.9 bits (69), Expect = 0.67 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P P P PP P P P P PP P PP Sbjct: 516 PGGSPPSPSISPSPPITVPSPP-STPTSPGSPPSPSSPTPSSPIPSPPTPSTPP 568 Score = 31.1 bits (67), Expect = 1.2 Identities = 23/86 (26%), Positives = 26/86 (30%) Frame = +3 Query: 717 PPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXX 896 PP T+PS S S +P T P+ PP P P P Sbjct: 432 PPITVPSPPTTPSPGGSPPSPSIVPSPPSTTPS-PGSPPTSPTTPTPGGSPPSSPTTPTP 490 Query: 897 XPXPPPXPPXPXPXXPXXPPPXPPXP 974 PP P P P P P P Sbjct: 491 GGSPPSSPTTPTPGGSPPSSPTTPSP 516 Score = 31.1 bits (67), Expect = 1.2 Identities = 21/69 (30%), Positives = 22/69 (31%), Gaps = 7/69 (10%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPP-----PXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXP 953 P + T PT PP P P P P P P PP P P P Sbjct: 481 PPSSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPSPGGSPPSPSISPSPPITVPSPPSTP 540 Query: 954 --PPXPPXP 974 P PP P Sbjct: 541 TSPGSPPSP 549 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP---PXPP 978 P P P PP P P P P P P P P PP P PP Sbjct: 536 PPSTPTSPGSPPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPP 592 Score = 31.1 bits (67), Expect = 1.2 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 10/60 (16%) Frame = +2 Query: 818 PPPXPXX----PPPPPXXXXXXRP---PPXXXXPXXXPP---XXPXPXPSXPXXXPPXPP 967 PPP P PPPPP P PP PP P P PS PP P Sbjct: 724 PPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPPPTVHYNPPPPPSPAHYSPPPSP 783 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 4/54 (7%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPP-PXPPXPXPXXPXXPPPXP---PXPP 977 PP P PP P P PP P P P PP P P PP Sbjct: 406 PPVVVPSPPTTPSPGGSPPSPSISPSPPITVPSPPTTPSPGGSPPSPSIVPSPP 459 Score = 30.7 bits (66), Expect = 1.5 Identities = 24/90 (26%), Positives = 28/90 (31%), Gaps = 3/90 (3%) Frame = +3 Query: 717 PPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXX 896 P + PSS S S P +T+P+ P PP P Sbjct: 503 PGGSPPSSPTTPSPGGSPPSPSISPSPPITVPSPPSTPTSPGSPPSPSSPTPSSPIPSPP 562 Query: 897 XPXPPPXPPXPXPXXPXXPPPXP---PXPP 977 P PP P P P P P P PP Sbjct: 563 TPSTPPTPISPGQNSPPIIPSPPFTGPSPP 592 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/59 (28%), Positives = 17/59 (28%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 T S P P PP P PP P P P P P P P P Sbjct: 553 TPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSPSPPLPPVIPSPPIVGP 611 Score = 30.7 bits (66), Expect = 1.5 Identities = 22/63 (34%), Positives = 24/63 (38%), Gaps = 9/63 (14%) Frame = +1 Query: 817 PXXXPPXP--PPPPPXPXPXAXP----PXGXXPXPXPPXXPPXPPLXXXXXPP---PPPP 969 P PP P PP P P + P P P P PP PP+ PP P P Sbjct: 557 PIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSPSPPLPPV--IPSPPIVGPTPS 614 Query: 970 XPP 978 PP Sbjct: 615 SPP 617 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P P P PP P PP P P PP P Sbjct: 419 PGGSPPSPSISPSPPITVPSPPTTPSPGGSPPSPSIVPSPPSTTPSPGSPPTSP 472 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP-XPPLXXXXXPPPPPPXPP 978 P PP P P P PP P P PP P PP P P Sbjct: 465 PGSPPTSPTTPTPGGSPP-SSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTP 514 Score = 30.3 bits (65), Expect = 2.0 Identities = 19/63 (30%), Positives = 19/63 (30%), Gaps = 1/63 (1%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXP-XPXXPXXPPPXP 965 P T PT PP P P P PP P P P PPP Sbjct: 561 PPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSPSPPLPPVIPSPPIVGPTPSSPPPST 620 Query: 966 PXP 974 P P Sbjct: 621 PTP 623 Score = 29.9 bits (64), Expect = 2.7 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXPP--PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXX-PPPPPPXPP 978 P PP P P PP P P P P PP P PP P P Sbjct: 445 PGGSPPSPSIVPSPPSTTPSPGSPPTSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTP 501 Score = 29.9 bits (64), Expect = 2.7 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 9/65 (13%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPP--------PXPPXPXPXXPXXP-PPX 962 PT PP P P P P P P PP P P P PP Sbjct: 540 PTSPGSPPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSPSPPL 599 Query: 963 PPXPP 977 PP P Sbjct: 600 PPVIP 604 Score = 29.9 bits (64), Expect = 2.7 Identities = 19/61 (31%), Positives = 19/61 (31%), Gaps = 5/61 (8%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXP--PXXXXXXPXPPPXPPXPXPXXPXXPP---PXPPXP 974 P P PP P P P P PP P P P PP P P P Sbjct: 557 PIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSPSPPLPPVIPSPPIVGPTPSSP 616 Query: 975 P 977 P Sbjct: 617 P 617 Score = 29.9 bits (64), Expect = 2.7 Identities = 20/69 (28%), Positives = 20/69 (28%), Gaps = 5/69 (7%) Frame = +3 Query: 786 LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXP-----PXPXPXXPXX 950 LP L L PPPP P PPP P P P P Sbjct: 684 LPLLPLYLTCRHRLNLASPPPPAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPPPPTPIH 743 Query: 951 PPPXPPXPP 977 PP PP Sbjct: 744 SPPPQSHPP 752 Score = 29.5 bits (63), Expect = 3.6 Identities = 21/64 (32%), Positives = 22/64 (34%), Gaps = 2/64 (3%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXP--PPX 962 P + T PT PP P P P P PP P P P P P PP Sbjct: 494 PPSSPTTPTPGGSPPSSPTTPSPGGS----PPSPSISPSPPITVPSP-PSTPTSPGSPPS 548 Query: 963 PPXP 974 P P Sbjct: 549 PSSP 552 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PP P P PP P PP P P P P P Sbjct: 433 PITVPSPPTTPSPGGSPPSPSI-VPSPPSTTPSPGSPPTSPTTPTPGGSP 481 Score = 28.3 bits (60), Expect = 8.2 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +1 Query: 829 PPXPPPP---PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP P P PP P PP P P P P P P P P Sbjct: 439 PPTTPSPGGSPPSPSIVPSPP-STTPSPGSPPTSPTTPTPGGSPPSSPTTPTP 490 Score = 28.3 bits (60), Expect = 8.2 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXP 921 PP P PP P + P G P PP P Sbjct: 591 PPSSPSPPLPPVIPSPPIVGPTPSSPPPSTP 621 >At5g62210.1 68418.m07811 embryo-specific protein-related contains weak similarity to embryo-specific protein 3 (GI:3335171) [Arabidopsis thaliana] Length = 223 Score = 44.4 bits (100), Expect = 1e-04 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +1 Query: 853 PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P P P P PP PP PP PPPPPP PP Sbjct: 158 PPPSPDFPPFSPSIPPPSPPYFPPEPP----SIPPPPPPSPP 195 Score = 38.3 bits (85), Expect = 0.008 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 906 PPPXPPXPXPXXPXXPPPXPPXPP 977 PPP PP P P PPP PP PP Sbjct: 172 PPPSPPYFPPEPPSIPPPPPPSPP 195 Score = 34.3 bits (75), Expect = 0.13 Identities = 20/55 (36%), Positives = 23/55 (41%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 ++ + PPP P PP P PPP PP P PS P PP PP Sbjct: 153 NNTDLPPPSPDFPPFSPSI-----PPP-------SPPYFPPEPPSIPPPPPPSPP 195 Score = 32.7 bits (71), Expect = 0.38 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +1 Query: 838 PPPPPPXPX--PXAXPPXGXXPXPXPPXXPPXPP 933 PPP P P P PP P PP PP PP Sbjct: 158 PPPSPDFPPFSPSIPPPSPPYFPPEPPSIPPPPP 191 Score = 31.5 bits (68), Expect = 0.88 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXP 944 PP P PP PP P PP PP P P P Sbjct: 158 PPPSPDFPPFSPSI-PPPSPPYFPPEPPSIPPPPPPSPP 195 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 875 PPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXPXS 982 PPP P P P P P P PP P S Sbjct: 158 PPPSPDFPPFSPSIPPPSPPYFPPEPPSIPPPPPPS 193 >At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; glycine-rich protein 16 (GRP16) PMID:11431566 Length = 244 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GG GG GG G G G P G G G G GGG GG G Sbjct: 150 GGPGGASGGASGGASGGASGGASGGASGGGPGGASGGGPG-GASGGGPGGASGG 202 Score = 41.9 bits (94), Expect = 6e-04 Identities = 22/54 (40%), Positives = 23/54 (42%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGG GG GG GG G GG + G G GGG GG G Sbjct: 135 GGASGGGDKPGGASGGGPGGASGGASGGAS--GGASGGASGGASGGGPGGASGG 186 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 2/52 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGX--AXGXGXGGGGGGXGG 828 G GG GG GG G G G G GG A G G GG GG G Sbjct: 154 GASGGASGGASGGASGGASGGASGGGPGGASGGGPGGASGGGPGGASGGASG 205 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GGG GG GG G G G GG G GGG GG G G Sbjct: 146 GASGGGPGGASGGASGGASGGASGGASGGASGGGP--GGASGGGPGGASGGGPG 197 Score = 37.1 bits (82), Expect = 0.018 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GG GG GG G G G P G A G GG GG G G Sbjct: 178 GGPGGASGGGPGGASGGGPGGASGGASGDKPEG--APGDKPGGAWGGKPGKKPG 229 Score = 35.1 bits (77), Expect = 0.072 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GG GG G G G G G G GGG G G Sbjct: 145 GGASGGGPGGASGGASGGASGGASGGASGGASGGGPGGASGGGPGGASGGG 195 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GG G G GG G G GG G GGG GG G G Sbjct: 110 GASGGASGDKPGEMSGAGGPSGDK-PGGASGGGDKPGGASGGGPGGASGGASG 161 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GG G GG G G G G A G GG GG G G Sbjct: 125 GAGGPSGDKPGGASGGGDKPGGASGGGPGGASGGASGGASGGASGGASGGASG 177 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGG--XGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG GG G G GG GG G GG G GG GG Sbjct: 145 GGASGGGPGGASGGASGGASGGASGGASGGASGGGPGGASGGGPGGASGGGPGG 198 Score = 33.1 bits (72), Expect = 0.29 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGG-XGGGXGXXXXXXGGXRXXXXXGG-GGGXXGG 827 G G GGG G G G GG GGG G G + G GG GG Sbjct: 169 GGASGGASGGGPGGASGGGPGGASGGGPGGASGGASGDKPEGAPGDKPGGAWGG 222 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/55 (36%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGX--GGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G G GG GG GG G G P GG + G G GG GG G Sbjct: 121 GEMSGAGGPSGDKPGGASGGGDKPGGASGGGP-GGASGGASGGASGGASGGASGG 174 Score = 32.3 bits (70), Expect = 0.51 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGG-XGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G G GGG G G G GG GG G G + GG G G Sbjct: 177 GGGPGGASGGGPGGASGGGPGGASGGASGDKPEGAPGDKPGGAWGGKPGKKPG 229 Score = 31.9 bits (69), Expect = 0.67 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG GG G G G GGG G GG GG GG GG Sbjct: 158 GASGGASGGASG--GASGGASGGGPG---GASGGGPGGASGGGPGGASGG 202 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGX--GGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 GG GG GG G G G GG G G GGG G G Sbjct: 150 GGPGGASGGASGGASGGASGGASGGASGGGPGGASGGGPGGASGGGPGGASG 201 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -2 Query: 966 GGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 GG GG G G G G G GGG G GG G GG Sbjct: 150 GGPGGASGGASGGASGGASGGASGGAS-GGGPGGASGGGPGGASGGGPGG 198 Score = 29.9 bits (64), Expect = 2.7 Identities = 19/56 (33%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = -2 Query: 981 EXGXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGG-GGGXXGXGGG 817 + G GG G G E G G G G GG + GG GG G GG Sbjct: 108 QPGASGGASGDKPG-EMSGAGGPSGDKPGGASGGGDKPGGASGGGPGGASGGASGG 162 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G G G G GG GG GG G GG GG Sbjct: 117 GDKPGEMSGAGGPSGDKPGGASGGGDKPGGASGGGPGGASGGASGGASGG 166 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGG 839 G GG GG G G GG GG G G GG G Sbjct: 162 GASGGASGGASG--GASGGGPGGASGGGPGGASGGGPGGASGGASG 205 >At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 633 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/59 (42%), Positives = 26/59 (44%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXWXSE 801 GG G RGG GG GG G G GG G G GG GGG GG G + E Sbjct: 570 GGRDFRREGSFGSGRGGYGGGGGGYGGGGGYGGGGGYG-GGGGYGGGYGGASSGGYGGE 627 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GG G G GG G G GG G G GGG GG GG G Sbjct: 566 GGRFGGRDFRREGSFGSGRGGYGGGGGGYGGGG-GYGGGGGYGGGGGYGGG 615 Score = 33.9 bits (74), Expect = 0.17 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXW 810 G GG G GG G GG G G G G GG GGG G W Sbjct: 55 GYGGPPSGSRWAP-GGSGVGVGGGGGYRADAGRPGSGSGYGGRGGGGWNNRSGGW 108 Score = 33.5 bits (73), Expect = 0.22 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = -2 Query: 957 GGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGG 820 GG G + G G G GGG GGGGG G GG Sbjct: 566 GGRFGGRDFRREGSFGSGRGGYGGGGGGYGGGGGYGGGGGYGGGGG 611 Score = 33.1 bits (72), Expect = 0.29 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGG 820 G GG G G G G GG G GG GGGG G GG Sbjct: 567 GRFGGRDFRREGSFGSGRGGYGGGGGGYGGGGGYGGGGGYGGGGGYGGGYGG 618 Score = 32.7 bits (71), Expect = 0.38 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXG-XXXXXXGGXRXXXXXGGGGG 839 G GG GG GGG G GG GGG G GG GG GG Sbjct: 583 GRGGYGGGGGGYGGG-----GGYGGGGGYGGGGGYGGGYGGASSGGYGG 626 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/56 (42%), Positives = 26/56 (46%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXW 810 GG GGGGG GG G GG G GG + G G GGGG GG G + Sbjct: 98 GGSYGGGGGRR---EGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGY 150 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/49 (44%), Positives = 22/49 (44%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 GG G GGG RGG GG GG G G G GG GGG G Sbjct: 110 GGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 158 Score = 39.9 bits (89), Expect = 0.003 Identities = 26/60 (43%), Positives = 26/60 (43%), Gaps = 4/60 (6%) Frame = -3 Query: 977 GGXGG---GGGGXXXXXRG-GXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXW 810 GG GG GGGG G G GG G GG G G GGG GG GG G W Sbjct: 102 GGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGG--GGGW 159 Score = 35.9 bits (79), Expect = 0.041 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXG--XGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG GGG G G GG GG G GG GG GG GG Sbjct: 103 GGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGG 156 Score = 34.7 bits (76), Expect = 0.095 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 G G G GGG G G GGG GG GGGG GG G Sbjct: 94 GHRGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYG 151 Score = 33.9 bits (74), Expect = 0.17 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G G GG G G GG G GG GGG G G GGG Sbjct: 106 GRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 158 Score = 33.5 bits (73), Expect = 0.22 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 4/54 (7%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXG----GXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 GG GG G G G G G G GGG GG GGG G GG Sbjct: 102 GGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGG 155 Score = 29.5 bits (63), Expect = 3.6 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = -2 Query: 936 EGXGXGXXGGXXXGXXXXGGG---RXXXXXXGGGGGXXGXGGG 817 + G G GG G GGG GGGGG GGG Sbjct: 85 QSRGSGGGGGHRGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG 127 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/55 (40%), Positives = 24/55 (43%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXW 810 G GG GG GG G GG G GG + G G GGGG GG G + Sbjct: 113 GGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGY 167 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/49 (44%), Positives = 22/49 (44%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 GG G GGG RGG GG GG G G G GG GGG G Sbjct: 127 GGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 175 Score = 43.2 bits (97), Expect = 3e-04 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG G GGG GG GG GG G G G G GGGGG G Sbjct: 91 GGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG 144 Score = 39.9 bits (89), Expect = 0.003 Identities = 26/60 (43%), Positives = 26/60 (43%), Gaps = 4/60 (6%) Frame = -3 Query: 977 GGXGG---GGGGXXXXXRG-GXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXW 810 GG GG GGGG G G GG G GG G G GGG GG GG G W Sbjct: 119 GGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGG--GGGW 176 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG GGG G GG GG GG GGGGG GG Sbjct: 99 GGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGG 150 Score = 37.5 bits (83), Expect = 0.013 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G G GGG G G GG G G GG GGGG GG Sbjct: 100 GGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGG 151 Score = 37.1 bits (82), Expect = 0.018 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G GG GG G G G GGG G GG GGG GG Sbjct: 110 GYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGG 161 Score = 36.7 bits (81), Expect = 0.024 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 G G GG GGG G G G GG G G GGG GG G Sbjct: 92 GGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYG 149 Score = 36.7 bits (81), Expect = 0.024 Identities = 23/54 (42%), Positives = 24/54 (44%), Gaps = 4/54 (7%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXG----XGGGGGGXGG 828 G GGGGG G GG GG G GG + G G GGGGG GG Sbjct: 102 GYRSGGGGGY-----SGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGG 150 Score = 35.9 bits (79), Expect = 0.041 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXG--XGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG GGG G G GG GG G GG GG GG GG Sbjct: 120 GGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGG 173 Score = 35.5 bits (78), Expect = 0.054 Identities = 24/60 (40%), Positives = 24/60 (40%), Gaps = 6/60 (10%) Frame = -3 Query: 977 GGXGGG---GGGXXXXXRGGXGGXXGGX---GXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGG GGG GG G GG G G GG G GGG G G G Sbjct: 97 GGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGG 156 Score = 34.7 bits (76), Expect = 0.095 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGG 839 G GG G GGG G G GG GG G G GGGG Sbjct: 91 GGGGHRGGGGG--GYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGG 136 Score = 33.9 bits (74), Expect = 0.17 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G G GG G G GG G GG GGG G G GGG Sbjct: 123 GRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 175 Score = 33.5 bits (73), Expect = 0.22 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 4/54 (7%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXG----GXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 GG GG G G G G G G GGG GG GGG G GG Sbjct: 119 GGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGG 172 Score = 30.3 bits (65), Expect = 2.0 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 4/57 (7%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGG----GXXGXGGG 817 G G GG G G G G G GGG GGGG G GGG Sbjct: 102 GYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGG 158 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/58 (39%), Positives = 24/58 (41%), Gaps = 8/58 (13%) Frame = +1 Query: 829 PPXPPPPP--PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP------PPPPXPP 978 PP PPPP P P P PP P P PP P + PP PP P PP Sbjct: 86 PPSSPPPPDAPPPIPIVFPPPIDSPPPESTNSPPPPEVFEPPPPPADEDESPPAPPPP 143 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 6/57 (10%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPX----PXAXPPXGXXPXPXPPXX--PPXPPLXXXXXPPPPPP 969 P PP P PPP P P PP P PP PP PP PP PPP Sbjct: 86 PPSSPPPPDAPPPIPIVFPPPIDSPPPESTNSPPPPEVFEPPPPPADEDESPPAPPP 142 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/65 (35%), Positives = 24/65 (36%), Gaps = 2/65 (3%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXX--PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPX 962 P A +LP PP PPPP PP P PP P P P PPP Sbjct: 48 PPALPSLPPAVFSPPPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPPPI 107 Query: 963 PPXPP 977 PP Sbjct: 108 DSPPP 112 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 T S PPP PPPPP PP P P P P S P PP Sbjct: 64 TVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPPPESTNSPP 119 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/62 (35%), Positives = 23/62 (37%), Gaps = 1/62 (1%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPX-GXXPXPXPPXXPPXPPLXXXXXPPPPPPX 972 L SL PP PPP P + PP P P P P PP PPP Sbjct: 51 LPSLPPAVFSPPPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSP 110 Query: 973 PP 978 PP Sbjct: 111 PP 112 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 4/54 (7%) Frame = +1 Query: 829 PPXPPPP----PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PPPP PP P P P P PP P PP PP PP Sbjct: 137 PPAPPPPEQLPPPASSPQGGPKKPKKHHPGPATSPPAPS-APATSPPAPPNAPP 189 Score = 39.1 bits (87), Expect = 0.004 Identities = 25/60 (41%), Positives = 25/60 (41%), Gaps = 10/60 (16%) Frame = +1 Query: 829 PPXPP----PPPPXPX-PXAX--PPXGXXPXPXPPXX---PPXPPLXXXXXPPPPPPXPP 978 PP PP PPP P P A PP P PP PP P L PPPP PP Sbjct: 38 PPSPPADSSPPPALPSLPPAVFSPPPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAPP 97 Score = 37.9 bits (84), Expect = 0.010 Identities = 19/55 (34%), Positives = 20/55 (36%), Gaps = 5/55 (9%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPX-----PPXXPPXPPLXXXXXPPPPPPXPP 978 PP PPP P + PP P PP PP PPPPP P Sbjct: 31 PPTDSAPPPSPPADSSPPPALPSLPPAVFSPPPTVSSPPPPPLDSSPPPPPDLTP 85 Score = 37.5 bits (83), Expect = 0.013 Identities = 23/61 (37%), Positives = 23/61 (37%), Gaps = 7/61 (11%) Frame = +1 Query: 817 PXXXPPXPPPPPP--XPXPXAXP--PXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXP 975 P PPP PP P A P P P PP PPL PPP PPP Sbjct: 30 PPPTDSAPPPSPPADSSPPPALPSLPPAVFSPPPTVSSPPPPPLDSSPPPPPDLTPPPSS 89 Query: 976 P 978 P Sbjct: 90 P 90 Score = 37.5 bits (83), Expect = 0.013 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXPXS 982 PP PPPP PPP P PP P P PP P S Sbjct: 61 PPPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPPPES 114 Score = 37.5 bits (83), Expect = 0.013 Identities = 24/68 (35%), Positives = 24/68 (35%), Gaps = 14/68 (20%) Frame = +1 Query: 817 PXXXPPXPPP---PPPXPXPXAXPPXGXXPXPXPPXXP-------PXPPLXXXXXPPPP- 963 P P PPP PP P PP P PP P PP PPPP Sbjct: 63 PTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPPPESTNSPPPPE 122 Query: 964 ---PPXPP 978 PP PP Sbjct: 123 VFEPPPPP 130 Score = 37.5 bits (83), Expect = 0.013 Identities = 24/66 (36%), Positives = 24/66 (36%), Gaps = 4/66 (6%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRX--PPXXXXXXPXPPPXP--PXPXPXXPXXPP 956 P LT P PP PPP P PP P PPP P P P P Sbjct: 79 PPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPPPESTNSP-PPPEVFEPPPPPADEDESP 137 Query: 957 PXPPXP 974 P PP P Sbjct: 138 PAPPPP 143 Score = 36.3 bits (80), Expect = 0.031 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PPP PPPPP P P P P P P P P P Sbjct: 119 PPPEVFEPPPPPADEDESPPAPPPPEQLPPPASSPQGGPKKPKKHHPGPATSP 171 Score = 35.9 bits (79), Expect = 0.041 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PPP PP P P P PP PPPP PP Sbjct: 100 PIVFPPPIDSPPPESTNSPPPPEVFEPPPPPADEDESPP-----APPPPEQLPP 148 Score = 33.5 bits (73), Expect = 0.22 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P PP PPP PP P PPP P P P PP Sbjct: 98 PIPIVFPPPIDSPPP--ESTNSPPPPEVFEPPPPPADEDESPPAPPPPEQLPP 148 Score = 33.5 bits (73), Expect = 0.22 Identities = 18/59 (30%), Positives = 18/59 (30%), Gaps = 3/59 (5%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXP---XPPPXPPXPXPXXPXXPPPXPPXPP 977 P P PPPP P P P P P P P PP PP P Sbjct: 130 PADEDESPPAPPPPEQLPPPASSPQGGPKKPKKHHPGPATSPPAPSAPATSPPAPPNAP 188 Score = 32.7 bits (71), Expect = 0.38 Identities = 17/53 (32%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +2 Query: 806 SXNXPPPXPXX---PPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXP 955 S PP P PPP PPP P PP P P+ P P Sbjct: 4 SPTSSPPAPSADSAPPPDTSSDGSAAPPPTDSAPPPSPPADSSPPPALPSLPP 56 Score = 32.7 bits (71), Expect = 0.38 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PPP PP P PP P P P PP PP Sbjct: 18 PPPDTSSDGSAAPPPTDSAPPPSPPADSSPPPALPSLPPAVFSPPP 63 Score = 32.7 bits (71), Expect = 0.38 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 9/65 (13%) Frame = +3 Query: 810 PTXXXXPPXXP----PPP--PXXXXXRXPPXXXXXXPXPPPX---PPXPXPXXPXXPPPX 962 PT PP P PPP P P P PPP PP P P P Sbjct: 32 PTDSAPPPSPPADSSPPPALPSLPPAVFSPPPTVSSPPPPPLDSSPPPPPDLTPPPSSPP 91 Query: 963 PPXPP 977 PP P Sbjct: 92 PPDAP 96 Score = 32.3 bits (70), Expect = 0.51 Identities = 18/58 (31%), Positives = 20/58 (34%), Gaps = 2/58 (3%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPP--XXPXPXPSXPXXXPPXPP 967 T + PPP PP P PP PP P P P+ PP PP Sbjct: 84 TPPPSSPPPPDAPPPIPIVFPPPIDSPPPESTNSPPPPEVFEPPPPPADEDESPPAPP 141 Score = 31.9 bits (69), Expect = 0.67 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Frame = +2 Query: 821 PPXPXXPPP--PPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PP PPP P PPP P PP P P PP P P Sbjct: 41 PPADSSPPPALPSLPPAVFSPPPTVSSPPP-PPLDSSPPPPPDLTPPPSSPPPP 93 Score = 31.5 bits (68), Expect = 0.88 Identities = 19/65 (29%), Positives = 20/65 (30%), Gaps = 3/65 (4%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXP---PPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP 959 P + P PP PPPP PP P PP PP P P Sbjct: 97 PPIPIVFPPPIDSPPPESTNSPPPPEVFEPPPPPADEDESPPAPP-PPEQLPPPASSPQG 155 Query: 960 XPPXP 974 P P Sbjct: 156 GPKKP 160 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/55 (30%), Positives = 17/55 (30%), Gaps = 5/55 (9%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPX-----PPPXPPXPXPXXPXXPPPXPPXPP 977 PP PPP PP P PP P P PPP P P Sbjct: 31 PPTDSAPPPSPPADSSPPPALPSLPPAVFSPPPTVSSPPPPPLDSSPPPPPDLTP 85 Score = 29.9 bits (64), Expect = 2.7 Identities = 18/60 (30%), Positives = 18/60 (30%), Gaps = 4/60 (6%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPP----XXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 T S P P PPP PPP PP P P PP PP Sbjct: 22 TSSDGSAAPPPTDSAPPPSPPADSSPPPALPSLPPAVFSPPPTVSSPPPPPLDSSPPPPP 81 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/48 (29%), Positives = 14/48 (29%) Frame = +3 Query: 831 PXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P PP P P PPP P P P P P P Sbjct: 5 PTSSPPAPSADSAPPPDTSSDGSAAPPPTDSAPPPSPPADSSPPPALP 52 Score = 29.1 bits (62), Expect = 4.7 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PP P PP PP PP L P P P Sbjct: 111 PPESTNSPPPPEVFEPPPPPADEDESPPAPPPPEQLPPPASSPQGGPKKP 160 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/50 (32%), Positives = 16/50 (32%), Gaps = 2/50 (4%) Frame = +1 Query: 817 PXXXPPXPPPPPPX--PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP 960 P P P P P P PP P PP P PP PP Sbjct: 149 PASSPQGGPKKPKKHHPGPATSPPAPSAPATSPPAPPNAPPRNSSHALPP 198 Score = 28.3 bits (60), Expect = 8.2 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 4/53 (7%) Frame = +1 Query: 832 PXPPPPPP----XPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P P P P P PP PP PP P PP Sbjct: 5 PTSSPPAPSADSAPPPDTSSDGSAAPPPTDSAPPPSPP-ADSSPPPALPSLPP 56 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P P P PP P P A P P P P PP P PP P P P Sbjct: 61 PPKPKPAPAPTPPKPKP-APAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAP 112 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P PP P P P PP P P P PP P PP P P P Sbjct: 24 PAPKPPKPKPAPAPTPP---KPKPTPAPTPPKPKPKPAPTPPKPKPAP 68 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P P P PP P P A P P P P PP P PP P P P Sbjct: 50 PPKPKPKPAPTPPKPKP-APAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTP 101 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXX-PXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PP P P P PP P P PP P P P P P PP Sbjct: 35 PAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPP 84 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXX-PXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PP P P P PP P P PP P P P P P PP Sbjct: 46 PAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPP 95 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXX-PXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PP P P P PP P P PP P P P P P PP Sbjct: 57 PAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPP 106 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P P P PP P P P P P P PP P PP P P P Sbjct: 28 PPKPKPAPAPTPPKPKP-TPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAP 79 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P P P PP P P P P P P PP P PP P P P Sbjct: 39 PPKPKPTPAPTPPKPKPKPAPTP-PKPKPAPAPTPPKPKPAPAPTPPKPKPKP 90 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 2/50 (4%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXX-PXPXPPXXPPXP-PLXXXXXPPPPPPXP 975 P P PP P P P PP P P PP P P P P P P P Sbjct: 79 PAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTPAPKPKPAPKP 128 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXP-PXGXXPXPXP-PXXPPXPPLXXXXXPPPPPPXP 975 P P P P PP P P P P P P P P P P P P P P Sbjct: 72 PPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTPAPKPKPAP 126 Score = 37.5 bits (83), Expect = 0.013 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P T P P PP P P P PP P P P P P P Sbjct: 33 PAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAP 92 Query: 969 XPP 977 PP Sbjct: 93 TPP 95 Score = 37.5 bits (83), Expect = 0.013 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P T P P PP P P P PP P P P P P P Sbjct: 44 PTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAP 103 Query: 969 XPP 977 PP Sbjct: 104 TPP 106 Score = 37.1 bits (82), Expect = 0.018 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PP P P P P P P P P PP P P P P Sbjct: 68 PAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTPAP 120 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P P P P + P P P P PP P P P P P P Sbjct: 75 PKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTPAPKPKP 124 Score = 36.3 bits (80), Expect = 0.031 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P P PP P P P PP P P P P P P PP Sbjct: 29 PKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPP 84 Score = 35.9 bits (79), Expect = 0.041 Identities = 19/55 (34%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPP-XXPXPXPSXPXXXP-PXPPXXP 976 P P P PP P PP P PP P P P+ P P P P P Sbjct: 64 PKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTP 118 Score = 35.1 bits (77), Expect = 0.072 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = +1 Query: 829 PPXPPP-PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P P P P P P P P PP P P P P P PP Sbjct: 26 PKPPKPKPAPAPTPPKPKP---TPAPTPPKPKPKPAPTPPKPKPAPAPTPP 73 Score = 35.1 bits (77), Expect = 0.072 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 PT P P PP P P P P PP P P PP P P Sbjct: 59 PTPPKPKPAPAPTPP-KPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAP 112 Score = 34.7 bits (76), Expect = 0.095 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P P PP P PP P P P PP P P PP P P Sbjct: 28 PPKPKPAPAPTPPKPKPTPAPTPP---KPKPKPAPTPPKPKPAPAPTPPKPKPAP 79 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P T P P PP P P P PP P P P P P P Sbjct: 55 PKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAP 114 Query: 969 XP 974 P Sbjct: 115 AP 116 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXP 921 P P PP P P P P P P P P Sbjct: 101 PAPTPPKPKPAPAPAPTPAPKPKPAPKPAP 130 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP 958 P P P P PP P P P P P P P P Sbjct: 84 PKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTPAPKPKPAPKPAP 130 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/48 (29%), Positives = 14/48 (29%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PP P P P P P P P P P P P P Sbjct: 83 PPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTPAPKPKPAPKPAP 130 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/46 (32%), Positives = 15/46 (32%), Gaps = 1/46 (2%) Frame = +3 Query: 831 PXXPPPPPXXXXXRXPPXXXXXXPXPPPXP-PXPXPXXPXXPPPXP 965 P P P P P P P P P P P P P P P Sbjct: 83 PPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTPAPKPKPAPKP 128 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/43 (46%), Positives = 21/43 (48%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PPPP P P + PP P PP P PP PPPPPP Sbjct: 146 PPPPESPPPESLPPPSPES-PSPPSPEPPPP--SSLEPPPPPP 185 Score = 36.3 bits (80), Expect = 0.031 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP 959 PPPP PP P P PP P P PPP Sbjct: 146 PPPPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPPPP 185 Score = 35.9 bits (79), Expect = 0.041 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXX--PPXPP 933 PP PPP P P P P P PP PP PP Sbjct: 148 PPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPPP 184 Score = 35.9 bits (79), Expect = 0.041 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = +3 Query: 876 PPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP PPP P P P P PPP PP PP Sbjct: 148 PPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPPP 184 Score = 33.5 bits (73), Expect = 0.22 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP 912 P PP P P P P PP P P PP Sbjct: 154 PESLPPPSPESPSPPSPEPPPPSSLEPPPPPP 185 Score = 31.9 bits (69), Expect = 0.67 Identities = 20/61 (32%), Positives = 21/61 (34%) Frame = +2 Query: 785 TTXXXTHSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 T T + PP P PPP PPP P P P P P PP P Sbjct: 134 TAAAGTTTIAGQPPPPESPPPESL------PPP---SPESPSPPSPEPPPPSSLEPPPPP 184 Query: 965 P 967 P Sbjct: 185 P 185 >At1g26240.1 68414.m03201 proline-rich extensin-like family protein similar to hydroxyproline-rich glycoprotein precursor gi|727264|gb|AAA87902; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 478 Score = 44.0 bits (99), Expect = 2e-04 Identities = 25/70 (35%), Positives = 27/70 (38%), Gaps = 8/70 (11%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP---XXPPXPPLXXXXXPPPP- 963 +YS P PPPPP PP P PP PP PP PPPP Sbjct: 46 IYSSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPY 105 Query: 964 ----PPXPPF 981 PP PP+ Sbjct: 106 IYKSPPPPPY 115 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/70 (35%), Positives = 27/70 (38%), Gaps = 8/70 (11%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP---XXPPXPPLXXXXXPPPP- 963 +YS P PPPPP PP P PP PP PP PPPP Sbjct: 96 VYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPY 155 Query: 964 ----PPXPPF 981 PP PP+ Sbjct: 156 VYSSPPPPPY 165 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/70 (35%), Positives = 27/70 (38%), Gaps = 8/70 (11%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP---XXPPXPPLXXXXXPPPP- 963 +YS P PPPPP PP P PP PP PP PPPP Sbjct: 116 VYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPY 175 Query: 964 ----PPXPPF 981 PP PP+ Sbjct: 176 VYSSPPPPPY 185 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/70 (35%), Positives = 27/70 (38%), Gaps = 8/70 (11%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP---XXPPXPPLXXXXXPPPP- 963 +YS P PPPPP PP P PP PP PP PPPP Sbjct: 156 VYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPY 215 Query: 964 ----PPXPPF 981 PP PP+ Sbjct: 216 VYSSPPPPPY 225 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/70 (35%), Positives = 27/70 (38%), Gaps = 8/70 (11%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP---XXPPXPPLXXXXXPPPP- 963 +YS P PPPPP PP P PP PP PP PPPP Sbjct: 176 VYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPY 235 Query: 964 ----PPXPPF 981 PP PP+ Sbjct: 236 VYSSPPPPPY 245 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/70 (35%), Positives = 27/70 (38%), Gaps = 8/70 (11%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP---XXPPXPPLXXXXXPPPP- 963 +YS P PPPPP PP P PP PP PP PPPP Sbjct: 196 VYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPY 255 Query: 964 ----PPXPPF 981 PP PP+ Sbjct: 256 VYSSPPPPPY 265 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/70 (35%), Positives = 27/70 (38%), Gaps = 8/70 (11%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP---XXPPXPPLXXXXXPPPP- 963 +YS P PPPPP PP P PP PP PP PPPP Sbjct: 216 VYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPY 275 Query: 964 ----PPXPPF 981 PP PP+ Sbjct: 276 VYSSPPPPPY 285 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/70 (35%), Positives = 27/70 (38%), Gaps = 8/70 (11%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP---XXPPXPPLXXXXXPPPP- 963 +YS P PPPPP PP P PP PP PP PPPP Sbjct: 236 VYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPY 295 Query: 964 ----PPXPPF 981 PP PP+ Sbjct: 296 VYSSPPPPPY 305 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/70 (35%), Positives = 27/70 (38%), Gaps = 8/70 (11%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP---XXPPXPPLXXXXXPPPP- 963 +YS P PPPPP PP P PP PP PP PPPP Sbjct: 256 VYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPY 315 Query: 964 ----PPXPPF 981 PP PP+ Sbjct: 316 VYSSPPPPPY 325 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/70 (35%), Positives = 27/70 (38%), Gaps = 8/70 (11%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP---XXPPXPPLXXXXXPPPP- 963 +YS P PPPPP PP P PP PP PP PPPP Sbjct: 276 VYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPY 335 Query: 964 ----PPXPPF 981 PP PP+ Sbjct: 336 VYNSPPPPPY 345 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/70 (35%), Positives = 27/70 (38%), Gaps = 8/70 (11%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP---XXPPXPPLXXXXXPPPP- 963 +YS P PPPPP PP P PP PP PP PPPP Sbjct: 376 VYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPY 435 Query: 964 ----PPXPPF 981 PP PP+ Sbjct: 436 VYSSPPPPPY 445 Score = 43.2 bits (97), Expect = 3e-04 Identities = 25/70 (35%), Positives = 27/70 (38%), Gaps = 8/70 (11%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP---XXPPXPPLXXXXXPPPP- 963 +YS P PPPPP PP P PP PP PP PPPP Sbjct: 76 VYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPY 135 Query: 964 ----PPXPPF 981 PP PP+ Sbjct: 136 VYNSPPPPPY 145 Score = 42.3 bits (95), Expect = 5e-04 Identities = 24/70 (34%), Positives = 26/70 (37%), Gaps = 8/70 (11%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP---XXPPXPPLXXXXXPPPP- 963 +Y P PPPPP PP P PP PP PP PPPP Sbjct: 66 IYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPY 125 Query: 964 ----PPXPPF 981 PP PP+ Sbjct: 126 VYKSPPPPPY 135 Score = 42.3 bits (95), Expect = 5e-04 Identities = 24/70 (34%), Positives = 27/70 (38%), Gaps = 8/70 (11%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP---XXPPXPPLXXXXXPPPP- 963 +Y+ P PPPPP PP P PP PP PP PPPP Sbjct: 136 VYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPY 195 Query: 964 ----PPXPPF 981 PP PP+ Sbjct: 196 VYSSPPPPPY 205 Score = 41.9 bits (94), Expect = 6e-04 Identities = 24/70 (34%), Positives = 26/70 (37%), Gaps = 8/70 (11%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP---XXPPXPPLXXXXXPPPP- 963 +Y P PPPPP PP P PP PP PP PPPP Sbjct: 366 VYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPY 425 Query: 964 ----PPXPPF 981 PP PP+ Sbjct: 426 VYKSPPPPPY 435 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/61 (36%), Positives = 23/61 (37%), Gaps = 5/61 (8%) Frame = +2 Query: 800 THSXNXPPPXP---XXPPPPPXXXXXXRPPPXXXXPXXXPP--XXPXPXPSXPXXXPPXP 964 TH + PPP P PPPPP PPP PP P P PP P Sbjct: 44 THIYSSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPP 103 Query: 965 P 967 P Sbjct: 104 P 104 Score = 40.3 bits (90), Expect = 0.002 Identities = 24/70 (34%), Positives = 26/70 (37%), Gaps = 8/70 (11%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP---XXPPXPPLXXXXXPPPP- 963 +YS P PPPPP PP P PP PP PP PPPP Sbjct: 296 VYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPY 355 Query: 964 ----PPXPPF 981 PP P+ Sbjct: 356 VYSSPPPSPY 365 Score = 40.3 bits (90), Expect = 0.002 Identities = 24/70 (34%), Positives = 26/70 (37%), Gaps = 8/70 (11%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP---XXPPXPPLXXXXXPPPP- 963 +YS P PPPPP PP P PP PP P PPPP Sbjct: 316 VYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPPY 375 Query: 964 ----PPXPPF 981 PP PP+ Sbjct: 376 VYSSPPPPPY 385 Score = 39.5 bits (88), Expect = 0.003 Identities = 23/70 (32%), Positives = 26/70 (37%), Gaps = 8/70 (11%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPP---PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP- 963 +Y+ P PPPPP P P P P PP PP PPPP Sbjct: 336 VYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPY 395 Query: 964 ----PPXPPF 981 PP PP+ Sbjct: 396 VYSSPPPPPY 405 Score = 39.1 bits (87), Expect = 0.004 Identities = 24/69 (34%), Positives = 25/69 (36%), Gaps = 8/69 (11%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP---XXPPXPPLXXXXXPPPP- 963 +YS P PPPPP PP P PP PP PP PPP Sbjct: 396 VYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPSPPPY 455 Query: 964 ----PPXPP 978 PP PP Sbjct: 456 VYKSPPPPP 464 Score = 38.3 bits (85), Expect = 0.008 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 8/54 (14%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPP---XPPXPXPXXPXXPPPXP-----PXPP 977 PPPPP PP P PPP P P P PPP P P PP Sbjct: 370 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 423 Score = 37.9 bits (84), Expect = 0.010 Identities = 24/66 (36%), Positives = 25/66 (37%), Gaps = 11/66 (16%) Frame = +1 Query: 817 PXXXPPXPPP------PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----- 963 P PPP PPP P PP P P PP PP PPPP Sbjct: 364 PYVYKSPPPPPYVYSSPPPPPYVYKSPP----PPPYVYSSPPPPPYVYKSPPPPPYVYSS 419 Query: 964 PPXPPF 981 PP PP+ Sbjct: 420 PPPPPY 425 Score = 37.5 bits (83), Expect = 0.013 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PPP PPPP PPP PP PS P PP P Sbjct: 412 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPSPPPYVYKSPPPPP 464 Score = 36.7 bits (81), Expect = 0.024 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 9/56 (16%) Frame = +1 Query: 829 PPXP-----PPPPPXPXPXAXPPXGXXPXPXPPXX----PPXPPLXXXXXPPPPPP 969 PP P PPPPP PP P PP PP PP PPPP Sbjct: 421 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPSPPPYVYKSPPPPPSYSYSYSSPPPP 476 Score = 35.9 bits (79), Expect = 0.041 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 9/54 (16%) Frame = +1 Query: 847 PPPXPXPXAXPPXGXXPXPXPPXX----PPXPPLXXXXXPPPP-----PPXPPF 981 PP P PP P PP PP PP PPPP PP PP+ Sbjct: 32 PPSPPSYVYKPPTHIYSSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPY 85 Score = 35.9 bits (79), Expect = 0.041 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 2/57 (3%) Frame = +2 Query: 812 NXPPPXPX--XPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 N PPP P PPPP PPP PP P P PP P Sbjct: 138 NSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 194 Score = 35.5 bits (78), Expect = 0.054 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PPP PPPP PPP PP P P PP P Sbjct: 152 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 204 Score = 35.5 bits (78), Expect = 0.054 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PPP PPPP PPP PP P P PP P Sbjct: 372 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 424 Score = 35.1 bits (77), Expect = 0.072 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPX--PPXPXPXXPXXPPPXPP 968 PPPPP PP P PPP P P PP PP Sbjct: 50 PPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPP 94 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Frame = +2 Query: 818 PPPXPX--XPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PPP P PPPP PPP PP P P PP P Sbjct: 360 PPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 414 Score = 33.5 bits (73), Expect = 0.22 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 4/47 (8%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPP----XPPXPXPXXPXXPPPXPP 968 PPPPP PP P PPP PP P P PP Sbjct: 430 PPPPPYVYSSPPPPPYVYKSPSPPPYVYKSPPPPPSYSYSYSSPPPP 476 Score = 32.7 bits (71), Expect = 0.38 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 2/57 (3%) Frame = +2 Query: 812 NXPPPXPX--XPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 N PPP P PPPP PP PP P P PP P Sbjct: 338 NSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 394 Score = 31.9 bits (69), Expect = 0.67 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PP PPPP PPP PP P P PP P Sbjct: 42 PPTHIYSSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPP 94 Score = 31.5 bits (68), Expect = 0.88 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 3/45 (6%) Frame = +2 Query: 818 PPPXPX---XPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXP 943 PPP P PPPPP PPP PP S P Sbjct: 430 PPPPPYVYSSPPPPPYVYKSPSPPPYVYKSPPPPPSYSYSYSSPP 474 Score = 28.7 bits (61), Expect = 6.2 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 9/59 (15%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPP----XPPXPXPXXPXXPPPXP-----PXPP 977 PP PP PP PPP P P P PPP P P PP Sbjct: 35 PPSYVYKPPTHIYSSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPP 93 >At1g11850.1 68414.m01363 expressed protein Length = 93 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GGGG G G G GG G G G G G GG GGG GG G Sbjct: 41 GGGGSGDGLGLGLGGGAGLGGLGIGAGIGAGAGLGLGGGGFGGGAGGGLGG 91 Score = 32.7 bits (71), Expect = 0.38 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Frame = -1 Query: 982 GXGGXG-GXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG G G G G G G G GG G G G G GG GG GG Sbjct: 41 GGGGSGDGLGLGLGG--GAGLGGLGIGAGIGAGAGLGLGGGGFGGGAGGGLGG 91 Score = 29.5 bits (63), Expect = 3.6 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = -1 Query: 958 GGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 GGG G G GG G G G G GGGG GG +G Sbjct: 42 GGGSGDGLGLGLGG-GAGLGGLGIGAGIGAGAGLGLGGGGFGGGAGGGLG 90 >At1g04660.1 68414.m00463 glycine-rich protein Length = 212 Score = 44.0 bits (99), Expect = 2e-04 Identities = 25/52 (48%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXR-GGXG-GXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GGG GG GG G G GG G G GG G GG GGG GG Sbjct: 130 GGVGGGVGGLGGVGGLGGAGLGGVGGVGGGIGKAGGIGGLGGLGGAGGGLGG 181 Score = 41.5 bits (93), Expect = 8e-04 Identities = 26/56 (46%), Positives = 26/56 (46%), Gaps = 2/56 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXR-GGXGGXXG-GXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GG GGG GG GG G G G G G A G G GGG GG G G Sbjct: 151 GGVGGVGGGIGKAGGIGGLGGLGGAGGGLGGVGGLGKAGGIGVGGGIGGGHGVVGG 206 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG GG GGG G G G GG G GG G GGG GG Sbjct: 149 GLGGVGGVGGGIGKAGGIGGLGGLGGAGGGLGGVGGLGKAGGIGVGGGIGGG 200 Score = 38.7 bits (86), Expect = 0.006 Identities = 22/53 (41%), Positives = 22/53 (41%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG GG G G G G G G GGG GG GG G GGG Sbjct: 127 GGLGGVGGGVGGLGGVG-GLGGAGLGGVGGVGGGIGKAGGIGGLGGLGGAGGG 178 Score = 31.5 bits (68), Expect = 0.88 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG GG G G G G GG G G GGG G G GG Sbjct: 117 GGLGGVGGGVGGLGGVGGGV-GGLGGVGGLGGAGLGGVGGVGGGIGKAGGIGG 168 Score = 30.7 bits (66), Expect = 1.5 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXX--GXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG G G G G G GG G GGG G GG G GGG Sbjct: 143 GGLGGAGLGGVGGVGGGIGKAGGIGGLGGLGGAGGGLGGVGGLGKAGGI-GVGGG 196 Score = 29.5 bits (63), Expect = 3.6 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -2 Query: 975 GXXGGXG--GXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG G G G G G G G GGG GGG G G GG Sbjct: 90 GGLGGIGKYGGIGGAAGIGGFHSIGGVGGLGGVGGGVGGLGGVGGGVGGLGGVGG 144 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 43.6 bits (98), Expect = 2e-04 Identities = 29/70 (41%), Positives = 29/70 (41%), Gaps = 16/70 (22%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXX----------------GGXGXGXXPXGGXAXGXGXGGG 846 GG GGGGGG GG GG GG G G GG G G GGG Sbjct: 109 GGYGGGGGGYGGRGGGGRGGSDCYKCGEPGHMARDCSEGGGGYGGG-GGGYGGGGGYGGG 167 Query: 845 GGGXGGXXXG 816 GGG GG G Sbjct: 168 GGGYGGGGRG 177 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = -3 Query: 932 GGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG G GG G G GG G G GGGGGG GG G Sbjct: 88 GGSSGGRGGFGGGRG--GGRGSGGGYGGGGGGYGGRGGG 124 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G GG GGG G G G GG GG G GGGG GG Sbjct: 104 GRGSGGGYGGGGGGYGGRGGGGRGGSDCYKCGEPGHMARDCSEGGGGYGGGG 155 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -3 Query: 965 GGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 G GG RGG GG GG GG G G G GGGG GG Sbjct: 84 GNSGGGSSGGRGGFGGGRGGGRGSGGGYGGGGGGYG-GRGGGGRGG 128 Score = 39.5 bits (88), Expect = 0.003 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGG 845 G GG GG GGG G G G GG GGG G GG Sbjct: 157 GYGGGGGYGGGGGGYGGGGRGGGGGGGSCYSCGESGHFARDCTSGG 202 Score = 39.1 bits (87), Expect = 0.004 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGG 840 GG G GGGG GG GG GG G G G G GGGGG Sbjct: 147 GGGGYGGGGGGYGGGGGYGGGGGGYGGG---------GRGGGGGGG 183 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXR 869 GG GG GGG G G G GG GGG G GG R Sbjct: 92 GGRGGFGGGRGGGRGSG-GGYGGGGGGYGGRGGGGR 126 Score = 38.7 bits (86), Expect = 0.006 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = -3 Query: 962 GGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGG 837 GGGG GG GG GG G G GG G G GGGGGG Sbjct: 147 GGGGY-----GGGGGGYGG-GGGYGGGGGGYGGGGRGGGGGG 182 Score = 38.3 bits (85), Expect = 0.008 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGG 840 GG GG G RGG G GG G G GG G G GG GG Sbjct: 87 GGGSSGGRGGFGGGRGGGRGSGGGYGGG----GGGYGGRGGGGRGG 128 Score = 36.3 bits (80), Expect = 0.031 Identities = 20/36 (55%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -3 Query: 932 GGXGGXXGGXGXGXXPXGGXAXGXGXGGGG-GGXGG 828 GG GG GG G G GG G G GGGG GG GG Sbjct: 149 GGYGGGGGGYGGGGGYGGG---GGGYGGGGRGGGGG 181 Score = 35.5 bits (78), Expect = 0.054 Identities = 24/56 (42%), Positives = 24/56 (42%), Gaps = 4/56 (7%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGG--XGXXXXXXG--GXRXXXXXGGGGGXXGG 827 G GG G GGG G G G GG GGG G G G GGGG GG Sbjct: 100 GRGGGRGSGGGYGGGGG-GYGGRGGGGRGGSDCYKCGEPGHMARDCSEGGGGYGGG 154 Score = 35.1 bits (77), Expect = 0.072 Identities = 26/76 (34%), Positives = 26/76 (34%), Gaps = 18/76 (23%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXX------------------GXGXGGXGGGXGXXXXXXGGXRXXXX 857 G GG GG GGG G G G GG GGG G GG Sbjct: 114 GGGGYGGRGGGGRGGSDCYKCGEPGHMARDCSEGGGGYGGGGGGYGGGGGYGGGGGGYGG 173 Query: 856 XGGGGGXXGGXXXXVG 809 G GGG GG G Sbjct: 174 GGRGGGGGGGSCYSCG 189 Score = 33.5 bits (73), Expect = 0.22 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = -2 Query: 966 GGXGGXXXGXEGXGX-GXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G G G G G G GG G GGGR GGGGG G GG Sbjct: 76 GPDGAPVQGNSGGGSSGGRGGFGGGR---GGGRGSGGGYGGGGGGYGGRGG 123 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = -1 Query: 934 GXGXGGXGGGXGXXXXXXGGXR-XXXXXGGGGGXXGG 827 G GG GG G GG R GGGGG GG Sbjct: 84 GNSGGGSSGGRGGFGGGRGGGRGSGGGYGGGGGGYGG 120 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP PPP P A PP P P P PP PP PPP PP Sbjct: 255 PLKLPPGRSAPPPPPA--AAPPPQPPPPPPPKPQPPPPP--KIARPPPAPP 301 Score = 37.9 bits (84), Expect = 0.010 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXPP 978 PP PP P PP P P PP PP PP PP PPP PP Sbjct: 254 PPLKLPPGRSAPP---PPPAAAPPPQPP--PPPPPKPQPPPPPKIARPPPAPP 301 Score = 37.5 bits (83), Expect = 0.013 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PPP PP PPP PP P P P PP PP Sbjct: 259 PPGRSAPPP-------PPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPP 301 Score = 35.9 bits (79), Expect = 0.041 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +3 Query: 807 LPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 LP P PPPP PP P P P PP P PPP PP Sbjct: 253 LPPLKLPPGRSAPPPPPAAA---PPPQPPPPPPPKPQPPPPPKI--ARPPPAPP 301 Score = 32.7 bits (71), Expect = 0.38 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +3 Query: 801 LTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP 959 L LP PP PPP PP P PPP P P P P Sbjct: 256 LKLPPGRSAPP--PPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPPKGAAP 306 Score = 32.3 bits (70), Expect = 0.51 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 886 GXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 G P PP PP PP PPP PP Sbjct: 252 GLPPLKLPPGRSAPPPPPAAAPPPQPPPPPP 282 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +3 Query: 786 LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPP 923 LP P P PPPP + PP PPP PP Sbjct: 258 LPPGRSAPPPPPAAAPPPQPPPPPPPKPQPPP--PPKIARPPPAPP 301 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/66 (33%), Positives = 24/66 (36%), Gaps = 3/66 (4%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPP---PXPPXPXPXXPXXPPP 959 P ++ T P P PPP PP P PP P P P P PPP Sbjct: 71 PAISISPSTPIPSTPSTPSPPPPAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSPPP 130 Query: 960 XPPXPP 977 P PP Sbjct: 131 TPSLPP 136 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +1 Query: 832 PXPPPPP--PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 P PPP P P P P P P P P PP PP P PP Sbjct: 126 PSPPPTPSLPPPAPKKSPSTPSLPPPTPKKSPPPPPSHHSSSPSNPP 172 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = +3 Query: 810 PTXXXXPPXXP---PPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P+ PP P PPPP PP P P P P P PPP P P Sbjct: 85 PSTPSPPPPAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPPAPKKSP 143 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P P PPP + PP P PP P P P PPP P Sbjct: 80 PIPSTPSTPSPPPPAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSPPPTP 132 Score = 38.3 bits (85), Expect = 0.008 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 4/63 (6%) Frame = +1 Query: 802 SLXQXPXXXPPXPP--PPPPXPXPXAXPP--XGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 S P PP P PPPP P PP P P P P PP PPP P Sbjct: 83 STPSTPSPPPPAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSPPP--TPSLPPPAPK 140 Query: 970 XPP 978 P Sbjct: 141 KSP 143 Score = 37.1 bits (82), Expect = 0.018 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 3/53 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXP---PXXPPXPPLXXXXXPPPPP 966 P P P P P P + PP P P P P P PP PPPPP Sbjct: 110 PPSLTPFVPHPTPKKSP-SPPPTPSLPPPAPKKSPSTPSLPPPTPKKSPPPPP 161 Score = 33.9 bits (74), Expect = 0.17 Identities = 22/68 (32%), Positives = 22/68 (32%), Gaps = 4/68 (5%) Frame = +2 Query: 785 TTXXXTHSXNXPPPXPX-XPPPPPXXXXXXRPP---PXXXXPXXXPPXXPXPXPSXPXXX 952 T T S PPP PPPP PP P P P P PS P Sbjct: 79 TPIPSTPSTPSPPPPAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPPA 138 Query: 953 PPXPPXXP 976 P P P Sbjct: 139 PKKSPSTP 146 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/51 (31%), Positives = 16/51 (31%), Gaps = 1/51 (1%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPX-PPPXPPXPXPXXPXXPPPXPPXPP 977 P P PPP P P PPP P P P P PP Sbjct: 122 PKKSPSPPPTPSLPPPAPKKSPSTPSLPPPTPKKSPPPPPSHHSSSPSNPP 172 Score = 29.5 bits (63), Expect = 3.6 Identities = 22/89 (24%), Positives = 24/89 (26%), Gaps = 2/89 (2%) Frame = +3 Query: 714 PPPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXXP--PPPPXXXXXRXPPXX 887 PPP S + +S P P PP P PPP P Sbjct: 90 PPPPAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPPAPKKSPSTPSLP 149 Query: 888 XXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 PP PP P PP P Sbjct: 150 PPTPKKSPPPPPSHHSSSPSNPPHHQQNP 178 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/59 (38%), Positives = 24/59 (40%), Gaps = 10/59 (16%) Frame = +1 Query: 829 PPXPPPP------PPXPXPXAXPPXGXXPXPXPPXXP----PXPPLXXXXXPPPPPPXP 975 PP P P PP P P A PP P P PP P P PP+ P PP P Sbjct: 372 PPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = +1 Query: 844 PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PPPP P P P P P PP PP PP PPPPP P Sbjct: 370 PPPPVPAPQM--PSSAGP-PRPP--PPAPPPGSGGPKPPPPPGP 408 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP P P A PP P P P P PP P PPP Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPP 415 Score = 35.9 bits (79), Expect = 0.041 Identities = 21/62 (33%), Positives = 22/62 (35%), Gaps = 1/62 (1%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP-PPPX 972 L S+ P P P P P P P P PP P PP PP PP Sbjct: 127 LSSMLDIPRRNLATKPGSSPSPSPSRPPKRSRGP-PRPPTRPKSPPPRKSSFPPSRSPPP 185 Query: 973 PP 978 PP Sbjct: 186 PP 187 Score = 35.9 bits (79), Expect = 0.041 Identities = 20/66 (30%), Positives = 22/66 (33%), Gaps = 4/66 (6%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXP----PPXPPXPXPXXPXXPP 956 P L + + P P P P PP P P P PP P P P PP Sbjct: 356 PPKFLKVSSKKASAPPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPP 415 Query: 957 PXPPXP 974 P P Sbjct: 416 PMSLGP 421 Score = 35.9 bits (79), Expect = 0.041 Identities = 19/57 (33%), Positives = 21/57 (36%) Frame = +3 Query: 807 LPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 +P+ P PP P PP P PPP P P P P P P PP Sbjct: 379 MPSSAGPPRPPPPAP--------PPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPP 427 Score = 35.1 bits (77), Expect = 0.072 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXP-XXXPPXXPXPXPSXPXXXPP 958 PP P P P RPPP P P P P P P PP Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPP 416 Score = 33.5 bits (73), Expect = 0.22 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXP-XPXPPXXP 921 P P PPPPP P PP P P PP P Sbjct: 395 PGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 Score = 32.7 bits (71), Expect = 0.38 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P P P P PP P PP P P P PP P PP Sbjct: 142 PGSSPSPSPSR-----PPKRSRGPPRPPTRPKSPPPRKSSFPPSRSPPPP 186 Score = 31.5 bits (68), Expect = 0.88 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 844 PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P P PP P P PPPP PP Sbjct: 351 PLPPEPPKFLKVSSKKASAPPPPVPAPQMPSSAGPPRPPPPAPPP 395 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/45 (31%), Positives = 15/45 (33%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P PP + P P P P P P PPP P P Sbjct: 351 PLPPEPPKFLKVSSKKASAPPPPVPAPQMPSSAGPPRPPPPAPPP 395 Score = 31.1 bits (67), Expect = 1.2 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 7/62 (11%) Frame = +1 Query: 817 PXXXPPXPPP------PPPXPXPXA-XPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PP PPP PPP P P PP P P PP P P Sbjct: 386 PRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAP-RPPSGPADALDDDAPKTKLK 444 Query: 976 PF 981 PF Sbjct: 445 PF 446 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/59 (38%), Positives = 24/59 (40%), Gaps = 10/59 (16%) Frame = +1 Query: 829 PPXPPPP------PPXPXPXAXPPXGXXPXPXPPXXP----PXPPLXXXXXPPPPPPXP 975 PP P P PP P P A PP P P PP P P PP+ P PP P Sbjct: 372 PPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = +1 Query: 844 PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PPPP P P P P P PP PP PP PPPPP P Sbjct: 370 PPPPVPAPQM--PSSAGP-PRPP--PPAPPPGSGGPKPPPPPGP 408 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP P P A PP P P P P PP P PPP Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPP 415 Score = 35.9 bits (79), Expect = 0.041 Identities = 21/62 (33%), Positives = 22/62 (35%), Gaps = 1/62 (1%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP-PPPX 972 L S+ P P P P P P P P PP P PP PP PP Sbjct: 127 LSSMLDIPRRNLATKPGSSPSPSPSRPPKRSRGP-PRPPTRPKSPPPRKSSFPPSRSPPP 185 Query: 973 PP 978 PP Sbjct: 186 PP 187 Score = 35.9 bits (79), Expect = 0.041 Identities = 20/66 (30%), Positives = 22/66 (33%), Gaps = 4/66 (6%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXP----PPXPPXPXPXXPXXPP 956 P L + + P P P P PP P P P PP P P P PP Sbjct: 356 PPKFLKVSSKKASAPPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPP 415 Query: 957 PXPPXP 974 P P Sbjct: 416 PMSLGP 421 Score = 35.9 bits (79), Expect = 0.041 Identities = 19/57 (33%), Positives = 21/57 (36%) Frame = +3 Query: 807 LPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 +P+ P PP P PP P PPP P P P P P P PP Sbjct: 379 MPSSAGPPRPPPPAP--------PPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPP 427 Score = 35.1 bits (77), Expect = 0.072 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXP-XXXPPXXPXPXPSXPXXXPP 958 PP P P P RPPP P P P P P P PP Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPP 416 Score = 33.5 bits (73), Expect = 0.22 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXP-XPXPPXXP 921 P P PPPPP P PP P P PP P Sbjct: 395 PGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 Score = 32.7 bits (71), Expect = 0.38 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P P P P PP P PP P P P PP P PP Sbjct: 142 PGSSPSPSPSR-----PPKRSRGPPRPPTRPKSPPPRKSSFPPSRSPPPP 186 Score = 31.5 bits (68), Expect = 0.88 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 844 PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P P PP P P PPPP PP Sbjct: 351 PLPPEPPKFLKVSSKKASAPPPPVPAPQMPSSAGPPRPPPPAPPP 395 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/45 (31%), Positives = 15/45 (33%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P PP + P P P P P P PPP P P Sbjct: 351 PLPPEPPKFLKVSSKKASAPPPPVPAPQMPSSAGPPRPPPPAPPP 395 Score = 31.1 bits (67), Expect = 1.2 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 7/62 (11%) Frame = +1 Query: 817 PXXXPPXPPP------PPPXPXPXA-XPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PP PPP PPP P P PP P P PP P P Sbjct: 386 PRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAP-RPPSGPADALDDDAPKTKLK 444 Query: 976 PF 981 PF Sbjct: 445 PF 446 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 43.2 bits (97), Expect = 3e-04 Identities = 25/66 (37%), Positives = 26/66 (39%), Gaps = 12/66 (18%) Frame = +1 Query: 817 PXXXPPXPP--PPP-----PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP----- 960 P PP PP PPP P P + PP P P PP PP PPP Sbjct: 37 PVTPPPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPPVVIAS 96 Query: 961 PPPXPP 978 PPP P Sbjct: 97 PPPSTP 102 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = +1 Query: 829 PPXP----PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PP P PPP P P P P P PP P P PPPPP Sbjct: 125 PPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPPPP 175 Score = 41.9 bits (94), Expect = 6e-04 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP-PPPXPP 978 PPP P P A PP P P PP P PP PPP P P PP Sbjct: 97 PPPSTPATTPPA-PPQTVSPPP-PPDASPSPPAPTTTNPPPKPSPSPP 142 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 6/59 (10%) Frame = +1 Query: 817 PXXXPPXPP-----PPPPXPXPXAXPPXGXXPXPXPPXXPP-XPPLXXXXXPPPPPPXP 975 P PP PP PPPP P P P P P PP P P PP P P Sbjct: 102 PATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKPSP 160 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PPP P P P PP P PP PP PPP PP Sbjct: 32 PSAPPPVTPPPSPPQSPPPVVSSSPPPPVVSSPPP---SSSPPPSPP 75 Score = 39.5 bits (88), Expect = 0.003 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 5/56 (8%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP-----PPPP 969 P PP PP P P + PP P P PP P PP PPPP Sbjct: 36 PPVTPPPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPP 91 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P PP PPP PP P PP P P P PP PP Sbjct: 58 PPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTPATTPPAPP 110 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 4/53 (7%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXP----PPPPPXP 975 PP P PP P P P P PP PP P PPP P P Sbjct: 148 PPGETPSPPKPSPSTPTPTTTTSPPPPPATSASPPSSNPTDPSTLAPPPTPLP 200 Score = 37.9 bits (84), Expect = 0.010 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PP PPP P PP P PP PP PP PP Sbjct: 64 PPPSSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTPATTPPAPP 110 Score = 37.5 bits (83), Expect = 0.013 Identities = 22/70 (31%), Positives = 24/70 (34%), Gaps = 7/70 (10%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPP----PPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPP 956 P ++ P PP PP PPP PP P P P P PP Sbjct: 57 PPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTPATTPPAPPQTVSPP 116 Query: 957 PXP---PXPP 977 P P P PP Sbjct: 117 PPPDASPSPP 126 Score = 37.5 bits (83), Expect = 0.013 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP---PPXPP 978 PP PPP P PP P P PP P + P P PP PP Sbjct: 58 PPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTPATTPPAPP 110 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP P P PP PP P P P PS P P P Sbjct: 115 PPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKPSPSTP 163 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PP PP P P P P PP P PP P P P P Sbjct: 115 PPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKPSPSTP 163 Score = 37.1 bits (82), Expect = 0.018 Identities = 24/63 (38%), Positives = 24/63 (38%), Gaps = 9/63 (14%) Frame = +1 Query: 817 PXXXPPXPPP----PPPXPXPXAXPPX--GXXPXPXPPXXPPXPPLXXXXXPPPPP---P 969 P PP PP PPP PP P P PP PP PPPPP P Sbjct: 66 PSSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTPATTPPAPP--QTVSPPPPPDASP 123 Query: 970 XPP 978 PP Sbjct: 124 SPP 126 Score = 36.7 bits (81), Expect = 0.024 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PP P PP P P P P PP PP P P P Sbjct: 137 PSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPPPPATSASPPSSNPTDP 189 Score = 36.3 bits (80), Expect = 0.031 Identities = 18/65 (27%), Positives = 22/65 (33%) Frame = +2 Query: 782 LTTXXXTHSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPX 961 +T+ T + + PPP PPP PP P P P P PP Sbjct: 77 ITSPPPTVASSPPPPVVIASPPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPK 136 Query: 962 PPXXP 976 P P Sbjct: 137 PSPSP 141 Score = 35.9 bits (79), Expect = 0.041 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P PP P PP P P PP P + PPP PP Sbjct: 24 PLQTQPTTPSAPPPVTPPPSPPQS--PPPVVSSSPPPPVVSSPPPSSSPPPSPP 75 Score = 35.5 bits (78), Expect = 0.054 Identities = 22/60 (36%), Positives = 23/60 (38%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P T PT PP PPP + PP P PPP P P PPP PP Sbjct: 22 PPPLQTQPTTPSAPPPVTPPPSPP---QSPPPVVSSSP-PPPVVSSPPP--SSSPPPSPP 75 Score = 35.5 bits (78), Expect = 0.054 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 PP P PP PP P P PP P P P P P P Sbjct: 118 PPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPK-PSPSTPTP 165 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PT PP P PP PP P P P P P PPP P Sbjct: 128 PTTTNPPPKPSPSPPGETPS--PPGETPSPPKPSPSTPTPTTTTSPPPPPATSASP 181 Score = 33.1 bits (72), Expect = 0.29 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 6/56 (10%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXP---XPPPXPP---XPXPXXPXXPPP 959 P PP P PP PP P PPP PP P P PPP Sbjct: 35 PPPVTPPPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPP 90 Score = 32.7 bits (71), Expect = 0.38 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +2 Query: 782 LTTXXXTHSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPX 961 L T T S P P PP P PPP PP P PS P P Sbjct: 25 LQTQPTTPSAPPPVTPPPSPPQSPPPVVSSSPPPPV---VSSPPPSSSPPPSPPVITSPP 81 Query: 962 P 964 P Sbjct: 82 P 82 Score = 32.7 bits (71), Expect = 0.38 Identities = 20/58 (34%), Positives = 21/58 (36%), Gaps = 4/58 (6%) Frame = +2 Query: 806 SXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXP----XXXPPXPP 967 S + P P PPP P PP P P P P PS P PP PP Sbjct: 122 SPSPPAPTTTNPPPKP----SPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPPPP 175 Score = 31.9 bits (69), Expect = 0.67 Identities = 17/63 (26%), Positives = 20/63 (31%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P + + + P PP P PP P P P P P PP P Sbjct: 88 PPPPVVIASPPPSTPATTPPAPPQTVSPPPPPDASPSP-PAPTTTNPPPKPSPSPPGETP 146 Query: 969 XPP 977 PP Sbjct: 147 SPP 149 Score = 31.9 bits (69), Expect = 0.67 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 4/57 (7%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPP----XXPXPXPSXPXXXPPXPPXXP 976 PPP PP PPP P P P P PS P P P P Sbjct: 97 PPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETP 153 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PPPPP PP P PP P P P P P P Sbjct: 171 PPPPPATSAS--PPSSNPTDPSTLAPPPTPLPVVPREKPIAKPTGP 214 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +1 Query: 859 PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PP PP P P PPP PP Sbjct: 6 PLPILSPPSSNSSTTAPPPLQTQPTTPSAPPPVTPPPSPP 45 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/55 (27%), Positives = 15/55 (27%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P PP P PP P P PP P P P P P Sbjct: 142 PGETPSPPGETPSPPKPSPSTPTPTTTTSPPPPPATSASPPSSNPTDPSTLAPPP 196 Score = 29.5 bits (63), Expect = 3.6 Identities = 16/52 (30%), Positives = 16/52 (30%), Gaps = 3/52 (5%) Frame = +3 Query: 831 PXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 P PP PP P P P P P PPP P PP Sbjct: 8 PILSPPSSNSSTTAPPPLQTQPTTPSAPPPVTPPPSPPQSPPPVVSSSPPPP 59 Score = 29.1 bits (62), Expect = 4.7 Identities = 20/72 (27%), Positives = 22/72 (30%), Gaps = 8/72 (11%) Frame = +3 Query: 786 LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPP-----XPXPXXPXX 950 +P + P PPP P P PP PP P P Sbjct: 4 VPPLPILSPPSSNSSTTAPPPLQTQPTTPSAPPPVTPPPSPPQSPPPVVSSSPPPPVVSS 63 Query: 951 PPP---XPPXPP 977 PPP PP PP Sbjct: 64 PPPSSSPPPSPP 75 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/56 (28%), Positives = 16/56 (28%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P P PPP PP P P PP P PP PP Sbjct: 37 PVTPPPSPPQSPPP---VVSSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVASSPP 89 Score = 28.7 bits (61), Expect = 6.2 Identities = 20/87 (22%), Positives = 24/87 (27%) Frame = +3 Query: 714 PPPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXX 893 PPP+ PS + + P + P PP P P PP Sbjct: 117 PPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPPPPA 176 Query: 894 XXPXPPPXPPXPXPXXPXXPPPXPPXP 974 PP P P P P P Sbjct: 177 TSASPPSSNPTDPSTLAPPPTPLPVVP 203 Score = 28.3 bits (60), Expect = 8.2 Identities = 15/52 (28%), Positives = 15/52 (28%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PP P PP PP P P PS P PP P Sbjct: 5 PPLPILSPPSSNSSTTAPPPLQTQPTTPSAPPPVTPPPSPPQSPPPVVSSSP 56 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +1 Query: 844 PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PPP P PP P P PP PP PPPPPP PP Sbjct: 303 PPPQKSIPPPPPP----PPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXP 929 P PP PPPPP PP P PPP PP P Sbjct: 304 PPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 41.5 bits (93), Expect = 8e-04 Identities = 22/53 (41%), Positives = 22/53 (41%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PPPPPP P P P P PP PP PPPPPP P Sbjct: 303 PPPQKSIPPPPPPPPPPLLQQP------PPPPSVSKAPP------PPPPPPPP 343 Score = 37.9 bits (84), Expect = 0.010 Identities = 24/70 (34%), Positives = 25/70 (35%), Gaps = 12/70 (17%) Frame = +3 Query: 804 TLPTXXXXPPXXPPPPPXXXXX-------RXPPXXXXXXPXPPPXPPXPXPXXPXXPP-- 956 +L T P P PPP R P P PPP PP P P PP Sbjct: 271 SLSTVRSRVPRVPKPPPKRSISLGDSTENRADPPPQKSIPPPPPPPPPPLLQQPPPPPSV 330 Query: 957 ---PXPPXPP 977 P PP PP Sbjct: 331 SKAPPPPPPP 340 Score = 35.9 bits (79), Expect = 0.041 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 3/49 (6%) Frame = +2 Query: 800 THSXNXPPPX---PXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPS 937 T + PPP P PPPPP PPP PP P P S Sbjct: 297 TENRADPPPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPPKS 345 Score = 31.5 bits (68), Expect = 0.88 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXP 930 P P P PP P P PP PP P P Sbjct: 25 PSPLPLPPPPPPPLKPPSSGSATTKPPINPSKP 57 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/45 (33%), Positives = 17/45 (37%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPP 923 P + P PP PPP + PP P PPP PP Sbjct: 305 PQKSIPPPPPPPPPPLLQQPPPPPSVSKAPP------PPPPPPPP 343 >At2g43150.1 68415.m05358 proline-rich extensin-like family protein similar to CRANTZ hydroxyproline-rich glycoprotein [Manihot esculenta] gi|7211797|gb|AAF40442; similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 212 Score = 43.2 bits (97), Expect = 3e-04 Identities = 25/67 (37%), Positives = 27/67 (40%), Gaps = 5/67 (7%) Frame = +1 Query: 796 LYSLXQXPXXXPPXP----PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP- 960 +YS P PP P PPPP P PP P PP P PP PPP Sbjct: 89 VYSSPPPPVKSPPPPYYYHSPPPPVKSP---PPPYYYHSPPPPVKSPPPPYYYHSPPPPV 145 Query: 961 PPPXPPF 981 P PP+ Sbjct: 146 KSPPPPY 152 Score = 41.5 bits (93), Expect = 8e-04 Identities = 24/66 (36%), Positives = 25/66 (37%), Gaps = 5/66 (7%) Frame = +1 Query: 799 YSLXQXPXXXPPXP----PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP-P 963 Y P PP P PPPP P PP P PP P PP PPP Sbjct: 58 YKSPPPPVKSPPPPYYYHSPPPPVKSP---PPPYVYSSPPPPVKSPPPPYYYHSPPPPVK 114 Query: 964 PPXPPF 981 P PP+ Sbjct: 115 SPPPPY 120 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/66 (36%), Positives = 25/66 (37%), Gaps = 5/66 (7%) Frame = +1 Query: 799 YSLXQXPXXXPPXP----PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP-P 963 Y P PP P PPPP P PP P PP P PP PPP Sbjct: 42 YKSPPPPVKSPPPPYEYKSPPPPVKSP---PPPYYYHSPPPPVKSPPPPYVYSSPPPPVK 98 Query: 964 PPXPPF 981 P PP+ Sbjct: 99 SPPPPY 104 Score = 40.7 bits (91), Expect = 0.001 Identities = 24/66 (36%), Positives = 25/66 (37%), Gaps = 5/66 (7%) Frame = +1 Query: 799 YSLXQXPXXXPPXP----PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP-P 963 Y P PP P PPPP P PP P PP P PP PPP Sbjct: 74 YHSPPPPVKSPPPPYVYSSPPPPVKSP---PPPYYYHSPPPPVKSPPPPYYYHSPPPPVK 130 Query: 964 PPXPPF 981 P PP+ Sbjct: 131 SPPPPY 136 Score = 40.7 bits (91), Expect = 0.001 Identities = 24/66 (36%), Positives = 25/66 (37%), Gaps = 5/66 (7%) Frame = +1 Query: 799 YSLXQXPXXXPPXP----PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP-P 963 Y P PP P PPPP P PP P PP P PP PPP Sbjct: 106 YHSPPPPVKSPPPPYYYHSPPPPVKSP---PPPYYYHSPPPPVKSPPPPYYYHSPPPPVK 162 Query: 964 PPXPPF 981 P PP+ Sbjct: 163 SPPPPY 168 Score = 40.7 bits (91), Expect = 0.001 Identities = 24/66 (36%), Positives = 25/66 (37%), Gaps = 5/66 (7%) Frame = +1 Query: 799 YSLXQXPXXXPPXP----PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP-P 963 Y P PP P PPPP P PP P PP P PP PPP Sbjct: 122 YHSPPPPVKSPPPPYYYHSPPPPVKSP---PPPYYYHSPPPPVKSPPPPYYYHSPPPPVK 178 Query: 964 PPXPPF 981 P PP+ Sbjct: 179 SPPPPY 184 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/59 (37%), Positives = 23/59 (38%), Gaps = 4/59 (6%) Frame = +1 Query: 799 YSLXQXPXXXPPXP----PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 Y P PP P PPPP P PP P PP P PP+ PPPP Sbjct: 154 YHSPPPPVKSPPPPYYYHSPPPPVKSP---PPPYLYSSPPPPVKSPPPPVYIYASPPPP 209 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 4/64 (6%) Frame = +1 Query: 799 YSLXQXPXXXPPXP----PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 Y P PP P PPPP P PP P PP P PP PPP Sbjct: 138 YHSPPPPVKSPPPPYYYHSPPPPVKSP---PPPYYYHSPPPPVKSPPPPYLYSSPPPPVK 194 Query: 967 PXPP 978 PP Sbjct: 195 SPPP 198 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/53 (37%), Positives = 22/53 (41%), Gaps = 5/53 (9%) Frame = +1 Query: 838 PPPP----PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP-PPPXPPF 981 PPPP P P + PP P PP P PP PPP P PP+ Sbjct: 36 PPPPYEYKSPPPPVKSPPPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPPPY 88 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +1 Query: 838 PPPP-----PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PPPP PP P PP P P PP P L PP P PP Sbjct: 148 PPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYLYSSPPPPVKSPPPP 199 Score = 33.9 bits (74), Expect = 0.17 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 7/57 (12%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPX-----PPP--XPPXPXPXXPXXPPPXPPXPP 977 PP PPPP PP P PPP PP P PP P PP Sbjct: 143 PPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYLYSSPPPPVKSPPPP 199 Score = 32.7 bits (71), Expect = 0.38 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PP PP P P PP P PP P PP Sbjct: 38 PPYEYKSPPPPVKSPPPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPPP 87 Score = 31.9 bits (69), Expect = 0.67 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 7/57 (12%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXP----PPXPPXPXPXXP---XXPPPXPPXPP 977 PP PPPP + PP P P P PP P P PPP PP Sbjct: 47 PPVKSPPPPYE--YKSPPPPVKSPPPPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPP 101 Score = 31.5 bits (68), Expect = 0.88 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 4/54 (7%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP----XPPXPP 977 PP PPPP PP P PP P P PPP P PP Sbjct: 159 PPVKSPPPPYYYHSPPPPVKS---PPPPYLYSSPPPPVKSPPPPVYIYASPPPP 209 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 7/57 (12%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXP----PPXPPXPXPXXP---XXPPPXPPXPP 977 PP PPPP PP P P P PP P P PPP PP Sbjct: 63 PPVKSPPPPYY--YHSPPPPVKSPPPPYVYSSPPPPVKSPPPPYYYHSPPPPVKSPP 117 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 7/57 (12%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXP----PPXPPXPXPXXP---XXPPPXPPXPP 977 PP PPPP PP P P P PP P P PPP PP Sbjct: 95 PPVKSPPPPYY--YHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPP 149 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 7/57 (12%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXP----PPXPPXPXPXXP---XXPPPXPPXPP 977 PP PPPP PP P P P PP P P PPP PP Sbjct: 111 PPVKSPPPPYY--YHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPP 165 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 7/57 (12%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXP----PPXPPXPXPXXP---XXPPPXPPXPP 977 PP PPPP PP P P P PP P P PPP PP Sbjct: 127 PPVKSPPPPYY--YHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPP 181 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 7/57 (12%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXP----PPXPPXPXPXXP---XXPPPXPPXPP 977 PP PPPP PP P P P PP P P PPP PP Sbjct: 79 PPVKSPPPPYV--YSSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPP 133 >At1g11850.2 68414.m01364 expressed protein Length = 108 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/52 (44%), Positives = 23/52 (44%), Gaps = 1/52 (1%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGG-GGXGGXXXG 816 GGGG G G G GG G G G G G GGGG GG GG G Sbjct: 41 GGGGSGDGLGLGLGGGAGLGGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLG 92 Score = 39.9 bits (89), Expect = 0.003 Identities = 23/52 (44%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGX--GGGGGGXGG 828 GG G GG G G G GG G G GG G G GG GGG GG Sbjct: 55 GGAGLGGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLGGGGFGGGAGGGLGG 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Frame = -1 Query: 982 GXGGXGGXGG-GXXGXXGXGXG-GXGGGXGXXXXXXGGXRXXXXXGGG-GGXXGG 827 G GG G GG G G G G G GGG G GG GGG GG GG Sbjct: 52 GLGGGAGLGGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLGGGGFGGGAGGGLGG 106 Score = 37.1 bits (82), Expect = 0.018 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Frame = -1 Query: 982 GXGGXG-GXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG G G G G G G G G G G G G GGGGG GG Sbjct: 41 GGGGSGDGLGLGLGGGAGLGGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLGG 93 Score = 35.5 bits (78), Expect = 0.054 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXG-GXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GGG G G G G G G G GG G GGG GG G G Sbjct: 52 GLGGGAGLGGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLGGGGFGGGAGGGLG 105 Score = 35.1 bits (77), Expect = 0.072 Identities = 21/51 (41%), Positives = 22/51 (43%), Gaps = 2/51 (3%) Frame = -2 Query: 957 GGXXXGXEGXGXGXXGGXXXGXXXXGGG--RXXXXXXGGGGGXXGXGGGXL 811 GG G +G G G GG G G G GGGGG G GGG L Sbjct: 41 GGGGSG-DGLGLGLGGGAGLGGLGIGAGIGAGAGLGLGGGGGGLGGGGGGL 90 Score = 35.1 bits (77), Expect = 0.072 Identities = 24/61 (39%), Positives = 24/61 (39%), Gaps = 7/61 (11%) Frame = -3 Query: 977 GGXGGG-----GGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXG--GGGGGXGGXXX 819 GG G G GGG G G G G G GG G G G GGGG GG Sbjct: 43 GGSGDGLGLGLGGGAGLGGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLGGGGFGGGAGG 102 Query: 818 G 816 G Sbjct: 103 G 103 Score = 33.1 bits (72), Expect = 0.29 Identities = 21/56 (37%), Positives = 22/56 (39%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 GG G G G G G GG G G G G GGGGG GG +G Sbjct: 42 GGGSGDGLGLGLGGGAGLGGLGIGAGI-----GAGAGLGLGGGGGGLGGGGGGLLG 92 Score = 31.5 bits (68), Expect = 0.88 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Frame = -2 Query: 966 GGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXG-GGGGXXGXGGGXL 811 G GG G G G G G G GGG GGGG G GG L Sbjct: 52 GLGGGAGLGGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLGGGGFGGGAGGGL 104 Score = 31.1 bits (67), Expect = 1.2 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGG-GGGXXGXGGG 817 G G GG G G G G G G GGG GG GGG G GG Sbjct: 54 GGGAGLGGLGIGA-GIGAGAGLGLGGGGGGLGGGGGGLLGGGGFGGGAGGGLGG 106 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/58 (41%), Positives = 24/58 (41%), Gaps = 11/58 (18%) Frame = +1 Query: 829 PPXPPPPPPXPX--------PXAXPPX---GXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PP P PPP P A PP G P P PP P PP PPPPPP Sbjct: 648 PPRVPRPPPRSAGGGKSTNLPSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPPP 705 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 8/58 (13%) Frame = +3 Query: 828 PPXXPPPPPXXXXX--------RXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP P PPP PP P PPP P P P PP PP PP Sbjct: 648 PPRVPRPPPRSAGGGKSTNLPSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPPP 705 Score = 34.7 bits (76), Expect = 0.095 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +3 Query: 807 LPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPP 923 LP+ P PPPP PP P PPP PP Sbjct: 667 LPSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPPP 705 Score = 32.7 bits (71), Expect = 0.38 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXP 928 T+ + PP P PPPP PPP P PP P P Sbjct: 665 TNLPSARPPLPGGGPPPPPPPPGGGPPP---PPGGGPPPPPPP 704 >At3g22070.1 68416.m02785 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 178 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 6/51 (11%) Frame = +1 Query: 844 PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP------PPXPP 978 P PP P PP P P P PP P L PPPP PP PP Sbjct: 99 PNPPAPIVNPNPPPPSTPNPPPEFSPPPPDLDTTTAPPPPSTDIPIPPPPP 149 Score = 41.9 bits (94), Expect = 6e-04 Identities = 19/50 (38%), Positives = 20/50 (40%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP 959 P+ PP PPPP PP P PPP PP P P PP Sbjct: 113 PSTPNPPPEFSPPPPDLDTTTAPPPPSTDIPIPPP-PPAPVSASPPLTPP 161 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 P P PPP P P P PP P P PP PPPPP Sbjct: 104 PIVNPNPPPPSTPNPPPEFSPP----PPDLDTTTAPPPPSTDIPIPPPPP 149 Score = 34.7 bits (76), Expect = 0.095 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 4/55 (7%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP----XXPPXPPLXXXXXPPPPPP 969 P PP P PPP P P P PP PP PP PP PP Sbjct: 108 PNPPPPSTPNPPPEFSP-PPPDLDTTTAPPPPSTDIPIPPPPPAPVSASPPLTPP 161 Score = 34.3 bits (75), Expect = 0.13 Identities = 25/88 (28%), Positives = 28/88 (31%) Frame = +3 Query: 714 PPPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXX 893 P P + SS + S P A + P PP P PPP PP Sbjct: 76 PNPPVLGSSPPSPTDSSSSTSISPNPPAPIVNPNPP--PPSTPNPPPEFS----PPPPDL 129 Query: 894 XXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP P P P P P PP Sbjct: 130 DTTTAPPPPSTDIPIPPPPPAPVSASPP 157 Score = 31.5 bits (68), Expect = 0.88 Identities = 16/56 (28%), Positives = 16/56 (28%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PP P P P P P P PP P PP Sbjct: 72 PNPNPNPPVLGSSPPSPTDSSSSTSISPNPPAPIVNPNPPPPSTPNPPPEFSPPPP 127 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP P + P P P P PP PPP PP Sbjct: 74 PNPNPPVLGSSPPSP-TDSSSSTSISPNPPAPIVNPNPPPPSTPNPPPEFSPPP 126 Score = 30.3 bits (65), Expect = 2.0 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 8/58 (13%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXP------PXPPLXXXXXPPPPP--PXPP 978 P P P P P P PP P P P PP PPPP P PP Sbjct: 62 PFITPFPNPNPNPNPNPPVLGSSPPSPTDSSSSTSISPNPPAPIVNPNPPPPSTPNPP 119 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 42.3 bits (95), Expect = 5e-04 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = +1 Query: 799 YSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 YS P PP PPPPP P PP PP PP PPPPP Sbjct: 35 YSPPPPPVYSPPISPPPPPPP-----PPPQSHAAAYKRYSPPPPPSKYGRVYPPPPP 86 Score = 32.3 bits (70), Expect = 0.51 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +1 Query: 919 PPXPPLXXXXXPPPPPPXPP 978 PP PP+ PPPPP PP Sbjct: 37 PPPPPVYSPPISPPPPPPPP 56 Score = 31.9 bits (69), Expect = 0.67 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PPPPP PP P PPP PP P PP PP Sbjct: 37 PPPPPVYS----PPIS----PPPPPPPPPPQSHAAAYKRYSPPPPP 74 Score = 31.5 bits (68), Expect = 0.88 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 895 PXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P PP P PPPPPP PP Sbjct: 37 PPPPPVYSPPISP------PPPPPPPPP 58 Score = 29.9 bits (64), Expect = 2.7 Identities = 19/60 (31%), Positives = 22/60 (36%), Gaps = 4/60 (6%) Frame = +2 Query: 800 THSXNXPPPX----PXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 ++ + PPP P PPPPP PPP P P PS P PP Sbjct: 32 SYKYSPPPPPVYSPPISPPPPPP------PPPPQSHAAAYKRYSPPPPPSKYGRVYPPPP 85 >At4g29030.1 68417.m04151 glycine-rich protein glycine-rich protein - Onobrychis viciifolia,PID:g2565429 Length = 115 Score = 42.3 bits (95), Expect = 5e-04 Identities = 23/55 (41%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGG-GGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGG G GG GG GG G G G G G GGG G G G Sbjct: 53 GGVGGGVSGPGGNLGYGGFGGAGGGLGGGLGGGAGSGLGGGLGGGSGIGAGTSGG 107 Score = 37.5 bits (83), Expect = 0.013 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGX-XGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG G GG GG GG GG G G G G G G G G GG G Sbjct: 57 GGVSGPGGNLGYGGFGGAGGGLGGGLGGGAGSGLGGGLGGGSGIGAGTSGGSTGG 111 Score = 36.7 bits (81), Expect = 0.024 Identities = 22/53 (41%), Positives = 22/53 (41%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GGG G G G GG G G GG G GG GGG GG G Sbjct: 37 GYGGGYSGV-----GDNGLPFGGVGGGVSGPGGNLGYGGFGGAGGGLGGGLGG 84 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG G GG G G GG GGG G G G GG GG Sbjct: 61 GPGGNLGYGGFGGAGGGLG-GGLGGGAGSGLGGGLGGGSGIGAGTSGGSTGG 111 Score = 31.9 bits (69), Expect = 0.67 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = -1 Query: 976 GGXGGXGGGXX-GXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 GG G GG G G GG GGG G G G G G GG Sbjct: 57 GGVSGPGGNLGYGGFGGAGGGLGGGLGGGAGSGLGGGLGGGSGIGAGTSGG 107 Score = 29.9 bits (64), Expect = 2.7 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 4/54 (7%) Frame = -1 Query: 976 GGXGGXG--GGXXGXXGXGXGGXGG--GXGXXXXXXGGXRXXXXXGGGGGXXGG 827 GG G G G G G G G GG G G GG G G G GG Sbjct: 40 GGYSGVGDNGLPFGGVGGGVSGPGGNLGYGGFGGAGGGLGGGLGGGAGSGLGGG 93 Score = 28.3 bits (60), Expect = 8.2 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -2 Query: 963 GXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G G G G G GG G G GGG G G GGG Sbjct: 46 GDNGLPFGGVGGGVSGPGGNLGYGGFGGAGGGLGGGLGGGAGS-GLGGG 93 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 42.3 bits (95), Expect = 5e-04 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PPPPP P G P PP PP PPPP PP Sbjct: 120 PPPPPPPPPPPPTITPPVTTTTAGHHHHRRSPPPPPPPP------PPPPTITPP 167 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/60 (33%), Positives = 21/60 (35%), Gaps = 1/60 (1%) Frame = +2 Query: 782 LTTXXXTHSXNXPPPXPXXPPPPP-XXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP 958 +TT H PPP P PPPPP PP P P P P PP Sbjct: 108 ITTTGHHHHRRSPPPPPPPPPPPPTITPPVTTTTAGHHHHRRSPPPPPPPPPPPPTITPP 167 Score = 39.1 bits (87), Expect = 0.004 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 13/63 (20%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPL-------------XXXXXPPPPPP 969 PP PPPPP P PP PP PP PPPPPP Sbjct: 97 PPPPPPPPLSAITTTGHHHHRRSPPPPPPPPPPPPTITPPVTTTTAGHHHHRRSPPPPPP 156 Query: 970 XPP 978 PP Sbjct: 157 PPP 159 Score = 35.9 bits (79), Expect = 0.041 Identities = 21/63 (33%), Positives = 22/63 (34%), Gaps = 13/63 (20%) Frame = +1 Query: 829 PPXPPPPPPXPXPX-------------AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PP PPPPPP P + PP P P P PP PPP Sbjct: 123 PPPPPPPPPTITPPVTTTTAGHHHHRRSPPPPPPPPPPPPTITPPVTTTTTGHHHHRPPP 182 Query: 970 XPP 978 PP Sbjct: 183 PPP 185 Score = 33.1 bits (72), Expect = 0.29 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 4/55 (7%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXG----XXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP PPPPP P G P P P P PPPP Sbjct: 151 PPPPPPPPPPPPTITPPVTTTTTGHHHHRPPPPPPATTTPITNTSDHHQLHPPPP 205 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 42.3 bits (95), Expect = 5e-04 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPP 933 PPPPPP P PP P P PP P PP Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 41.5 bits (93), Expect = 8e-04 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +3 Query: 876 PPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 PP P PPP PP P P P PPP PP P Sbjct: 64 PPPPPPTSP-PPPSPPPPSPPPPSPPPPSPPPP 95 Score = 41.5 bits (93), Expect = 8e-04 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXP 954 PPPPP P P + PP P PP PP P P Sbjct: 65 PPPPPTSPPPPSPPPPSPPPPSPPPPSPPPPAFAVGKTP 103 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/47 (46%), Positives = 23/47 (48%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 PPPPP P + PP P P PP PP P PPP PP P F Sbjct: 64 PPPPP---PTSPPP----PSPPPPSPPPPSP------PPPSPPPPAF 97 Score = 39.5 bits (88), Expect = 0.003 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP 924 P PPPP P P PP P P PP PP Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPPSPPP 94 Score = 39.1 bits (87), Expect = 0.004 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP 912 P PP PPPP P P PP P P PP Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 36.7 bits (81), Expect = 0.024 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 2/28 (7%) Frame = +3 Query: 900 PXPP--PXPPXPXPXXPXXPPPXPPXPP 977 P PP P PP P P P P P PP PP Sbjct: 66 PPPPTSPPPPSPPPPSPPPPSPPPPSPP 93 Score = 36.3 bits (80), Expect = 0.031 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 906 PPPXPPXPXPXXPXXPPPXPPXPP 977 PPP P P P P P P PP PP Sbjct: 65 PPPPPTSPPPPSPPPPSPPPPSPP 88 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXA 873 P PP P PPPP P P A Sbjct: 78 PPPSPPPPSPPPPSPPPPA 96 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PPP P A PP P P PP P PP P PP Sbjct: 67 PANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPP 120 Score = 41.9 bits (94), Expect = 6e-04 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXP---XPXPPXXPPXPPLXXXXXPPPPPP 969 PP PPPP P A PP P P PP P P PPP P Sbjct: 66 PPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAP 115 Score = 41.5 bits (93), Expect = 8e-04 Identities = 22/58 (37%), Positives = 23/58 (39%), Gaps = 4/58 (6%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXP-XAXPPXGXXPXP---XPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PPP P P A PP P P PP P PP+ PPP PP Sbjct: 31 PAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPP 88 Score = 39.5 bits (88), Expect = 0.003 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXG-XXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PP PPP P P A PP P P P PP PP P P Sbjct: 73 PVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAP 126 Score = 38.7 bits (86), Expect = 0.006 Identities = 24/65 (36%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPP---PXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP 959 P A PT PP PPP P PP P PP PP P P PPP Sbjct: 27 PTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPP-PPVSSP-PPASPPP 84 Query: 960 XPPXP 974 P P Sbjct: 85 ATPPP 89 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/63 (31%), Positives = 21/63 (33%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P + P PP PPPP P P P PP P P PPP Sbjct: 52 PPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASP-PPATPPPVAT 110 Query: 969 XPP 977 PP Sbjct: 111 PPP 113 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PPP P P + PP P PP PP P PPP Sbjct: 65 PPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPP 107 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXP-PLXXXXXPPPPPPXPP 978 PP PPP P P A PP P PP P P P P P P P Sbjct: 95 PPVASPPPATPPPVATPPPA--PLASPPAQVPAPAPTTKPDSPSPSPSSSP 143 Score = 37.5 bits (83), Expect = 0.013 Identities = 23/60 (38%), Positives = 23/60 (38%), Gaps = 10/60 (16%) Frame = +1 Query: 829 PPXPPPPP----PXPXPXAXPPXGXXPX---PXPPXXPPXPPLXXXXXPPP---PPPXPP 978 PP PPP P P A PP P P P PP P PPP PPP P Sbjct: 46 PPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATP 105 Score = 37.5 bits (83), Expect = 0.013 Identities = 19/54 (35%), Positives = 20/54 (37%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PPP P P PP P P P PP+ PPPP PP Sbjct: 51 PPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPV---ASPPPPVASPP 101 Score = 37.5 bits (83), Expect = 0.013 Identities = 18/54 (33%), Positives = 20/54 (37%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP P + PP P PP P PP+ PPP P Sbjct: 59 PPVTTAPPPANPPPPV-SSPPPASPPPATPPPVASPPPPVASPPPATPPPVATP 111 Score = 37.1 bits (82), Expect = 0.018 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 3/56 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPX-PXPXAXPPXGXXPXPXPPXXPP--XPPLXXXXXPPPPPPXP 975 P PP PPPP P A PP P P P PP P P P P P Sbjct: 84 PATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPSP 139 Score = 36.7 bits (81), Expect = 0.024 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 3/63 (4%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXP---XPPPXPPXPXPXXPXXPPP 959 P T P PP PPP PP P PPP P P P P Sbjct: 58 PPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLA 117 Query: 960 XPP 968 PP Sbjct: 118 SPP 120 Score = 36.3 bits (80), Expect = 0.031 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPX--PPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P P PP P P PP PP PPP P PP Sbjct: 23 PTSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPP-PVTTAPPPANPPPP 73 Score = 36.3 bits (80), Expect = 0.031 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 3/51 (5%) Frame = +2 Query: 824 PXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXX---PXPXPSXPXXXPPXPP 967 P P PPPP PPP P PP P P P PP P Sbjct: 65 PPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAP 115 Score = 35.5 bits (78), Expect = 0.054 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PPP P P PP P PP PP P P P Sbjct: 79 PASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAP 128 Score = 35.5 bits (78), Expect = 0.054 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXPXS 982 PPP PP P P P P P P P P P P P S Sbjct: 94 PPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPSPSSSPPLPSS 148 Score = 35.1 bits (77), Expect = 0.072 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P PP PPP PP P PP P P PP P P Sbjct: 72 PPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAP 126 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = +1 Query: 829 PPXPPP-PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PPP P P P A PP P P P P P PP P P Sbjct: 102 PATPPPVATPPPAPLASPP-AQVPAPAPTTKPDSPSPSPSSSPPLPSSDAP 151 Score = 33.5 bits (73), Expect = 0.22 Identities = 18/63 (28%), Positives = 18/63 (28%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P A P P PPP P P P PP P PPP Sbjct: 40 PPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVAS 99 Query: 969 XPP 977 PP Sbjct: 100 PPP 102 Score = 33.1 bits (72), Expect = 0.29 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PT PP PPP PP P PP P PPP PP Sbjct: 27 PTATPAPPTPTTPPPAAT----PPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPP 78 Score = 32.3 bits (70), Expect = 0.51 Identities = 17/55 (30%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXX--PPXXPXPXPSXPXXXPPXPPXXP 976 PPP PP PPP P PP P P+ P P P P Sbjct: 39 PPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASP 93 Score = 32.3 bits (70), Expect = 0.51 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXP-PXPPXXPXS 982 PPP PPP PPP P PP P P S P P P P P S Sbjct: 87 PPPVASPPPP------VASPPPATPPPVATPP--PAPLASPPAQVPAPAPTTKPDS 134 Score = 31.9 bits (69), Expect = 0.67 Identities = 16/55 (29%), Positives = 16/55 (29%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P P PPPP PP P P PP P P P P Sbjct: 83 PPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSP 137 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 1/57 (1%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXP-XXPXXPPPXPPXPP 977 P PP PPP PP PP P P P P P P P P Sbjct: 89 PVASPPPPVASPPPATPPPVATPP--PAPLASPPAQVPAPAPTTKPDSPSPSPSSSP 143 Score = 29.9 bits (64), Expect = 2.7 Identities = 20/67 (29%), Positives = 20/67 (29%), Gaps = 4/67 (5%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPP---XPPXPXPXXP-XXPP 956 P A P P PP P PP PPP PP P P P Sbjct: 66 PPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPA 125 Query: 957 PXPPXPP 977 P P P Sbjct: 126 PAPTTKP 132 Score = 28.7 bits (61), Expect = 6.2 Identities = 20/67 (29%), Positives = 21/67 (31%), Gaps = 4/67 (5%) Frame = +2 Query: 788 TXXXTHSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXP----XXXPPXXPXPXPSXPXXXP 955 T T + P P PPP PPP P PP P P S P Sbjct: 24 TSPPTATPAPPTPTT--PPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPAS 81 Query: 956 PXPPXXP 976 P P P Sbjct: 82 PPPATPP 88 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PPP P A PP P P PP P PP P PP Sbjct: 67 PANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPP 120 Score = 41.9 bits (94), Expect = 6e-04 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXP---XPXPPXXPPXPPLXXXXXPPPPPP 969 PP PPPP P A PP P P PP P P PPP P Sbjct: 66 PPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAP 115 Score = 41.5 bits (93), Expect = 8e-04 Identities = 22/58 (37%), Positives = 23/58 (39%), Gaps = 4/58 (6%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXP-XAXPPXGXXPXP---XPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PPP P P A PP P P PP P PP+ PPP PP Sbjct: 31 PAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPP 88 Score = 39.5 bits (88), Expect = 0.003 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXG-XXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PP PPP P P A PP P P P PP PP P P Sbjct: 73 PVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAP 126 Score = 38.7 bits (86), Expect = 0.006 Identities = 24/65 (36%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPP---PXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP 959 P A PT PP PPP P PP P PP PP P P PPP Sbjct: 27 PTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPP-PPVSSP-PPASPPP 84 Query: 960 XPPXP 974 P P Sbjct: 85 ATPPP 89 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/63 (31%), Positives = 21/63 (33%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P + P PP PPPP P P P PP P P PPP Sbjct: 52 PPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASP-PPATPPPVAT 110 Query: 969 XPP 977 PP Sbjct: 111 PPP 113 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PPP P P + PP P PP PP P PPP Sbjct: 65 PPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPP 107 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXP-PLXXXXXPPPPPPXPP 978 PP PPP P P A PP P PP P P P P P P P Sbjct: 95 PPVASPPPATPPPVATPPPA--PLASPPAQVPAPAPTTKPDSPSPSPSSSP 143 Score = 37.5 bits (83), Expect = 0.013 Identities = 23/60 (38%), Positives = 23/60 (38%), Gaps = 10/60 (16%) Frame = +1 Query: 829 PPXPPPPP----PXPXPXAXPPXGXXPX---PXPPXXPPXPPLXXXXXPPP---PPPXPP 978 PP PPP P P A PP P P P PP P PPP PPP P Sbjct: 46 PPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATP 105 Score = 37.5 bits (83), Expect = 0.013 Identities = 19/54 (35%), Positives = 20/54 (37%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PPP P P PP P P P PP+ PPPP PP Sbjct: 51 PPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPV---ASPPPPVASPP 101 Score = 37.5 bits (83), Expect = 0.013 Identities = 18/54 (33%), Positives = 20/54 (37%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP P + PP P PP P PP+ PPP P Sbjct: 59 PPVTTAPPPANPPPPV-SSPPPASPPPATPPPVASPPPPVASPPPATPPPVATP 111 Score = 37.1 bits (82), Expect = 0.018 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 3/56 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPX-PXPXAXPPXGXXPXPXPPXXPP--XPPLXXXXXPPPPPPXP 975 P PP PPPP P A PP P P P PP P P P P P Sbjct: 84 PATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPSP 139 Score = 36.7 bits (81), Expect = 0.024 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 3/63 (4%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXP---XPPPXPPXPXPXXPXXPPP 959 P T P PP PPP PP P PPP P P P P Sbjct: 58 PPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLA 117 Query: 960 XPP 968 PP Sbjct: 118 SPP 120 Score = 36.3 bits (80), Expect = 0.031 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPX--PPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P P PP P P PP PP PPP P PP Sbjct: 23 PTSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPP-PVTTAPPPANPPPP 73 Score = 36.3 bits (80), Expect = 0.031 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 3/51 (5%) Frame = +2 Query: 824 PXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXX---PXPXPSXPXXXPPXPP 967 P P PPPP PPP P PP P P P PP P Sbjct: 65 PPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAP 115 Score = 35.5 bits (78), Expect = 0.054 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PPP P P PP P PP PP P P P Sbjct: 79 PASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAP 128 Score = 35.5 bits (78), Expect = 0.054 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXPXS 982 PPP PP P P P P P P P P P P P S Sbjct: 94 PPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPSPSSSPPLPSS 148 Score = 35.1 bits (77), Expect = 0.072 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P PP PPP PP P PP P P PP P P Sbjct: 72 PPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAP 126 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = +1 Query: 829 PPXPPP-PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PPP P P P A PP P P P P P PP P P Sbjct: 102 PATPPPVATPPPAPLASPP-AQVPAPAPTTKPDSPSPSPSSSPPLPSSDAP 151 Score = 33.5 bits (73), Expect = 0.22 Identities = 18/63 (28%), Positives = 18/63 (28%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P A P P PPP P P P PP P PPP Sbjct: 40 PPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVAS 99 Query: 969 XPP 977 PP Sbjct: 100 PPP 102 Score = 33.1 bits (72), Expect = 0.29 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PT PP PPP PP P PP P PPP PP Sbjct: 27 PTATPAPPTPTTPPPAAT----PPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPP 78 Score = 32.3 bits (70), Expect = 0.51 Identities = 17/55 (30%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXX--PPXXPXPXPSXPXXXPPXPPXXP 976 PPP PP PPP P PP P P+ P P P P Sbjct: 39 PPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASP 93 Score = 32.3 bits (70), Expect = 0.51 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXP-PXPPXXPXS 982 PPP PPP PPP P PP P P S P P P P P S Sbjct: 87 PPPVASPPPP------VASPPPATPPPVATPP--PAPLASPPAQVPAPAPTTKPDS 134 Score = 31.9 bits (69), Expect = 0.67 Identities = 16/55 (29%), Positives = 16/55 (29%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P P PPPP PP P P PP P P P P Sbjct: 83 PPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSP 137 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 1/57 (1%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXP-XXPXXPPPXPPXPP 977 P PP PPP PP PP P P P P P P P P Sbjct: 89 PVASPPPPVASPPPATPPPVATPP--PAPLASPPAQVPAPAPTTKPDSPSPSPSSSP 143 Score = 29.9 bits (64), Expect = 2.7 Identities = 20/67 (29%), Positives = 20/67 (29%), Gaps = 4/67 (5%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPP---XPPXPXPXXP-XXPP 956 P A P P PP P PP PPP PP P P P Sbjct: 66 PPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPA 125 Query: 957 PXPPXPP 977 P P P Sbjct: 126 PAPTTKP 132 Score = 28.7 bits (61), Expect = 6.2 Identities = 20/67 (29%), Positives = 21/67 (31%), Gaps = 4/67 (5%) Frame = +2 Query: 788 TXXXTHSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXP----XXXPPXXPXPXPSXPXXXP 955 T T + P P PPP PPP P PP P P S P Sbjct: 24 TSPPTATPAPPTPTT--PPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPAS 81 Query: 956 PXPPXXP 976 P P P Sbjct: 82 PPPATPP 88 >At3g32400.1 68416.m04142 formin homology 2 domain-containing protein / FH2 domain-containing protein common family members: At2g43800, At3g25500, At5g48360, At4g15200, At3g05470, At3g07540, At5g07780, At5g07650 [Arabidopsis thaliana]; Length = 488 Score = 41.9 bits (94), Expect = 6e-04 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = +1 Query: 844 PPPPXPXPXAXP-PXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PPPP P P P P PP PP L PPPPPP Sbjct: 12 PPPPPPPPLLQPHHSALSSSPLPPPLPPKKLLATTNTPPPPPP 54 Score = 37.5 bits (83), Expect = 0.013 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 PPPPP + P PPP PP PPP PP Sbjct: 12 PPPPPPPPLLQPHHSALSSSPLPPPLPPKKLLATTNTPPPPPP 54 Score = 36.7 bits (81), Expect = 0.024 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PPPPPP P P PP PP L PP PP PP Sbjct: 12 PPPPPPPPLLQPHHS---ALSSSPLPPPLPPKKLLATTNTPP--PPPPP 55 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 41.5 bits (93), Expect = 8e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGG 840 G GGGGGG RGG GG G G GG G GGGGG Sbjct: 86 GSGGGGGG-----RGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGG 125 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -3 Query: 932 GGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXW 810 GG GG GG G G GG G GGGGG GG G W Sbjct: 88 GGGGGGRGGSGGGYRSGGGG--GYSGGGGGGYSGGGGGGGW 126 Score = 34.7 bits (76), Expect = 0.095 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGG 875 G GG GG GGG G G G GGG GG Sbjct: 90 GGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGG 125 Score = 33.5 bits (73), Expect = 0.22 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 973 GXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGG 839 G GG GGG G G G GGG GG GGGGG Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSG-----GGGGGYSGGGGGGG 125 Score = 31.5 bits (68), Expect = 0.88 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 942 GXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G G G G GG G GGG GGGGG G GGG Sbjct: 86 GSGGGG-GGRGGSGGGYRSGGGG---GYSGGGGGGYSGGGGG 123 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGG 875 G GG G G G G G G GGG G GG Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGG 123 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 41.5 bits (93), Expect = 8e-04 Identities = 22/62 (35%), Positives = 23/62 (37%) Frame = +1 Query: 790 LXLYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 L L+ P PP PP PPP P PP PP PPPPPP Sbjct: 62 LHLHHNPPSPSPPPPPPPRPPPPPLSPGSETTTWTTTTTSSVLPPPPP------PPPPPP 115 Query: 970 XP 975 P Sbjct: 116 PP 117 Score = 41.5 bits (93), Expect = 8e-04 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP P PPPP P PP + PPPPPP PP Sbjct: 68 PPSPSPPPPPPPRPPPPPLSPGSETTTWTTTTTSSVLPPPPPPPPPPPPP 117 Score = 36.7 bits (81), Expect = 0.024 Identities = 21/63 (33%), Positives = 23/63 (36%), Gaps = 3/63 (4%) Frame = +1 Query: 799 YSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP---XPPLXXXXXPPPPPP 969 +S + P PP P P P P PP P P P PPPPPP Sbjct: 55 FSSKETPLHLHHNPPSPSPPPPPPPRPP----PPPLSPGSETTTWTTTTTSSVLPPPPPP 110 Query: 970 XPP 978 PP Sbjct: 111 PPP 113 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPP 912 PP PPPPPP P P + P PP Sbjct: 105 PPPPPPPPPPPPPSSTWDFWDPFIPPPP 132 Score = 32.3 bits (70), Expect = 0.51 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = +2 Query: 806 SXNXPPPXPXXPPPPPXXXXXXRPP-PXXXXPXXXPPXXPXPXPSXP 943 S + PPP P PPPPP PP P P P P Sbjct: 70 SPSPPPPPPPRPPPPPLSPGSETTTWTTTTTSSVLPPPPPPPPPPPP 116 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 918 PPXPXPXXPXXPPPXPPXPP 977 PP P P P PPP PP PP Sbjct: 68 PPSPSPPPP--PPPRPPPPP 85 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 776 EXLTTXXXTHSXNXPPPXPXXPPPPP 853 E T T S PPP P PPPPP Sbjct: 91 ETTTWTTTTTSSVLPPPPPPPPPPPP 116 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 788 TXXXTHSXNXPPPXPXXPPPPP 853 T T S PPP P PPPPP Sbjct: 96 TTTTTSSVLPPPPPPPPPPPPP 117 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 41.5 bits (93), Expect = 8e-04 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXP-PXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP PP P P P PP P PPP P PP Sbjct: 13 PSPPSPPTNSTTTTPPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLPP 62 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/60 (35%), Positives = 22/60 (36%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P + T T PP PPP PP PPP P P P PPP PP Sbjct: 15 PPSPPTNSTTTTPPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLP----PSLPPPSPP 70 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP---XPPLXXXXXPPPPPPXPP 978 P P PPP P + PP P PP PP PPL P P PP Sbjct: 35 PPTTTPSSPPPSPSTNSTSPPPSSPLPPSLPPPSPPGSLTPPLPQPSPSAPITPSPP 91 Score = 36.7 bits (81), Expect = 0.024 Identities = 19/60 (31%), Positives = 20/60 (33%), Gaps = 2/60 (3%) Frame = +3 Query: 804 TLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXP--XPPPXPPXPXPXXPXXPPPXPPXPP 977 T P+ P PP PP PP P P PP PPP P PP Sbjct: 3 TAPSPGTTPSPSPPSPPTNSTTTTPPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLPP 62 Score = 36.3 bits (80), Expect = 0.031 Identities = 21/62 (33%), Positives = 23/62 (37%), Gaps = 3/62 (4%) Frame = +2 Query: 800 THSXNXPPPXPXX---PPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPX 970 T + + PPP P PPP PPP P P P P PS P P P Sbjct: 37 TTTPSSPPPSPSTNSTSPPPSSPLPPSLPPPSP--PGSLTPPLPQPSPSAPITPSPPSPT 94 Query: 971 XP 976 P Sbjct: 95 TP 96 Score = 35.9 bits (79), Expect = 0.041 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 3/52 (5%) Frame = +3 Query: 831 PXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPX-PXXPXXPP--PXPPXPP 977 P PPP P PP PPP PP P P P P P PP Sbjct: 40 PSSPPPSPSTNSTSPPPSSPLPPSLPPPSPPGSLTPPLPQPSPSAPITPSPP 91 Score = 34.7 bits (76), Expect = 0.095 Identities = 18/54 (33%), Positives = 19/54 (35%), Gaps = 5/54 (9%) Frame = +1 Query: 817 PXXXPPXP-----PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 P PP P PPP P P + PP PP P P PP P Sbjct: 40 PSSPPPSPSTNSTSPPPSSPLPPSLPPPSPPGSLTPPLPQPSPSAPITPSPPSP 93 Score = 34.7 bits (76), Expect = 0.095 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PPP P P P P P P P PP PP Sbjct: 55 PPSSPLPPSLPPPSPPGSLTPPLPQPSPSAPITPSPPSPTTPSNPRSPPSPNQGPP 110 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 824 PXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXPXS 982 P P P PP PP P P P P PS PP P S Sbjct: 11 PSPSPPSPPTNSTTTTPPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLPPS 63 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/65 (29%), Positives = 22/65 (33%), Gaps = 1/65 (1%) Frame = +2 Query: 785 TTXXXTHSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXP-PX 961 TT + + PP PPP PPP P PP P + P P P Sbjct: 24 TTTPPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLPPSLPPPSPPGSLTPPLPQPSPS 83 Query: 962 PPXXP 976 P P Sbjct: 84 APITP 88 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P PP PP P + P P P P P PP P PP P Sbjct: 54 PPPSSPLPPSLPPPSPPGSLTPPLPQPSPSAP-ITPSPPSPTTPSNPRSPPSP 105 Score = 33.5 bits (73), Expect = 0.22 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 907 PPXXPPXPPLXXXXXPPPPPPXPPF 981 PP PP PP PPPPPP P F Sbjct: 217 PPPKPPSPP----RKPPPPPPPPAF 237 Score = 33.1 bits (72), Expect = 0.29 Identities = 21/59 (35%), Positives = 22/59 (37%), Gaps = 6/59 (10%) Frame = +1 Query: 817 PXXXPPXPPP------PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PPP PPP P + P P P P PP PP PP P P P Sbjct: 27 PPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLP-PSLPPPSPP--GSLTPPLPQPSP 82 Score = 31.9 bits (69), Expect = 0.67 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 802 SLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPL 936 SL PP PPPPP P G P PP P L Sbjct: 215 SLPPPKPPSPPRKPPPPPPPPAFMSSSGGSDYSDLPVLPPPSPGL 259 Score = 31.5 bits (68), Expect = 0.88 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Frame = +3 Query: 813 TXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPP-XPXPXXPXXP--PPXPPXP 974 T PP P PP P P P P P P P P P P PP P Sbjct: 49 TNSTSPPPSSPLPPSLPPPSPPGSLTPPLPQPSPSAPITPSPPSPTTPSNPRSPPSP 105 Score = 31.5 bits (68), Expect = 0.88 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 906 PPPXPPXPXPXXPXXPPPXPPXP 974 PPP PP P P PPP PP P Sbjct: 217 PPPKPPSP----PRKPPPPPPPP 235 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 4/58 (6%) Frame = +1 Query: 817 PXXXPPXPPP---PPPXPXP-XAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP PP P P + P P P P P PP P P P Sbjct: 61 PPSLPPPSPPGSLTPPLPQPSPSAPITPSPPSPTTPSNPRSPPSPNQGPPNTPSGSTP 118 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 6/60 (10%) Frame = +1 Query: 817 PXXXPPXPP----PPPPXPXPXAX--PPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP PP P P P A P P P PP P P P P Sbjct: 62 PSLPPPSPPGSLTPPLPQPSPSAPITPSPPSPTTPSNPRSPPSPNQGPPNTPSGSTPRTP 121 Score = 28.3 bits (60), Expect = 8.2 Identities = 23/88 (26%), Positives = 23/88 (26%), Gaps = 3/88 (3%) Frame = +3 Query: 714 PPPETMPSSCRFXSXDQSXCXXX*LPXAXLT---LPTXXXXPPXXPPPPPXXXXXRXPPX 884 PPP T PSS S P P PP P P P Sbjct: 34 PPPTTTPSSPPPSPSTNSTSPPPSSPLPPSLPPPSPPGSLTPPLPQPSPSAPITPSPPSP 93 Query: 885 XXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P PP P P P P P Sbjct: 94 TTPSNPRSPPSPNQGPPNTPSGSTPRTP 121 >At1g62240.1 68414.m07021 expressed protein Length = 227 Score = 41.5 bits (93), Expect = 8e-04 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GGGG G G G G G P G GGGGGG GG G Sbjct: 154 GGGGGGDGSSGSGSGSGSGSGSGTGTASGPDVYMHVEGGGGGGGGGGGGGGGG 206 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/62 (38%), Positives = 24/62 (38%), Gaps = 9/62 (14%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPX---------GGXAXGXGXGGGGGGXGGXX 822 G GGGGGG G G G G G GG G G GGGGGG G Sbjct: 152 GSGGGGGGDGSSGSGSGSGSGSGSGTGTASGPDVYMHVEGGGGGGGGGGGGGGGGVDGSG 211 Query: 821 XG 816 G Sbjct: 212 SG 213 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G G GG G G G G G G G GGGGG G GGG Sbjct: 150 GEGSGGGGGGDGSSGSGSGSGSGSGSGTGTASGPDVYMHVEGGGGGGGGGGGG 202 Score = 39.1 bits (87), Expect = 0.004 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 8/62 (12%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXG--------XXPXGGXAXGXGXGGGGGGXGGXX 822 GG GG GG G G G G G GG G G GGGGGG G Sbjct: 105 GGGGGSGGSNGSFFNGSGSGTGYGSGDGRVSSSGEYSASAGGGGSGEGSGGGGGGDGSSG 164 Query: 821 XG 816 G Sbjct: 165 SG 166 Score = 38.3 bits (85), Expect = 0.008 Identities = 26/65 (40%), Positives = 26/65 (40%), Gaps = 11/65 (16%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXG------GXXGGXGXGXXP-----XGGXAXGXGXGGGGGGXG 831 GG GGGGGG G G G G G GG G G GGGGGG G Sbjct: 47 GGGGGGGGGASVEGGTEKGIDDNANGYGDGNGNGNAHGRADCPGGIVVGGGGGGGGGGGG 106 Query: 830 GXXXG 816 G G Sbjct: 107 GGGSG 111 Score = 37.5 bits (83), Expect = 0.013 Identities = 25/64 (39%), Positives = 25/64 (39%), Gaps = 10/64 (15%) Frame = -3 Query: 977 GGXGGGG----GGXXXXXRGGXGGXXGGXGXGXX------PXGGXAXGXGXGGGGGGXGG 828 GG GGGG GG G G G G P G G G GGGGGG GG Sbjct: 49 GGGGGGGASVEGGTEKGIDDNANGYGDGNGNGNAHGRADCPGGIVVGGGGGGGGGGGGGG 108 Query: 827 XXXG 816 G Sbjct: 109 GSGG 112 Score = 37.5 bits (83), Expect = 0.013 Identities = 26/70 (37%), Positives = 26/70 (37%), Gaps = 4/70 (5%) Frame = -1 Query: 982 GXGGXG---GXGGGXXGXXGXGXG-GXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXX 815 G GG G G GGG G G G G G G G G GGGGG GG Sbjct: 145 GGGGSGEGSGGGGGGDGSSGSGSGSGSGSGSGTGTASGPDVYMHVEGGGGGGGGGGGGGG 204 Query: 814 VGRVSXAXGS 785 G GS Sbjct: 205 GGVDGSGSGS 214 Score = 35.1 bits (77), Expect = 0.072 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGG 846 GG GGGGGG GG GG GG G G G G G Sbjct: 95 GGGGGGGGG------GGGGGGSGGSNGSFFNGSGSGTGYGSGDG 132 Score = 35.1 bits (77), Expect = 0.072 Identities = 23/69 (33%), Positives = 23/69 (33%), Gaps = 3/69 (4%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXG---XXXXXXGGXRXXXXXGGGGGXXGGXXXXV 812 G GG GG GGG G G G G G G GGGG G Sbjct: 99 GGGGGGGGGGGSGGSNGSFFNGSGSGTGYGSGDGRVSSSGEYSASAGGGGSGEGSGGGGG 158 Query: 811 GRVSXAXGS 785 G S GS Sbjct: 159 GDGSSGSGS 167 Score = 35.1 bits (77), Expect = 0.072 Identities = 24/65 (36%), Positives = 24/65 (36%), Gaps = 11/65 (16%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXG-GXGXGXXPX----------GGXAXGXGXGGGGGGXG 831 GG GGG GG G G G G G G GG G G GGGG G Sbjct: 104 GGGGGGSGGSNGSFFNGSGSGTGYGSGDGRVSSSGEYSASAGGGGSGEGSGGGGGGDGSS 163 Query: 830 GXXXG 816 G G Sbjct: 164 GSGSG 168 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 932 GGXGGXXGGXGXGXXPXGGXAXGXGXGGGGG 840 GG GG GG G G G G G G GGG Sbjct: 191 GGGGGGGGGGGGGGGGVDGSGSGSGSGSGGG 221 Score = 33.5 bits (73), Expect = 0.22 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXG 899 G GG GG GGG G G GGG G Sbjct: 196 GGGGGGGGGGGVDGSGSGSGSGSGGGSG 223 Score = 32.3 bits (70), Expect = 0.51 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 6/56 (10%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXG------GXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 G G G G G G GG G G GG G G G G G GG Sbjct: 166 GSGSGSGSGSGTGTASGPDVYMHVEGGGGGGGGGGGGGGGGVDGSGSGSGSGSGGG 221 Score = 31.9 bits (69), Expect = 0.67 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 G G G GG GG G G G G G G G GG G Sbjct: 174 GSGTGTASGPDVYMHVEGGGGGGGGGGGGGGGGVDGSGSGSGSGSGGGSG 223 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXG 899 G GG GG GGG G G G G G Sbjct: 192 GGGGGGGGGGGGGGGVDGSGSGSGSGSG 219 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 G G G G G GG G G GG G G G G G G Sbjct: 124 GTGYGSGDGRVSSSGEYSASAGGGGSGEG-SGGGGGGDGSSGSGSGSG 170 Score = 29.9 bits (64), Expect = 2.7 Identities = 26/93 (27%), Positives = 29/93 (31%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRVSX 797 GG GGG G G G GG GG G G G G G G G S Sbjct: 90 GGIVVGGGGGGGGGGGGGGGSGGSNGSFFNGSGS-------GTGYGSGDGRVSSSGEYSA 142 Query: 796 AXGSQXFXQXD*SNDXNRQELGIVSGGGQRTWS 698 + G + G SG G + S Sbjct: 143 SAGGGGSGEGSGGGGGGDGSSGSGSGSGSGSGS 175 Score = 29.9 bits (64), Expect = 2.7 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G G G G GG G G GG G G G G G G Sbjct: 126 GYGSGDGRVSSSGEYSASAGGGGSGEGSGGGGGGDGSSGSGSGSGSGSGSGTG 178 Score = 28.7 bits (61), Expect = 6.2 Identities = 21/66 (31%), Positives = 21/66 (31%), Gaps = 14/66 (21%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXG--------------GXGGGXGXXXXXXGGXRXXXXXGGG 845 G GG G G G G G G G GGG G GG G G Sbjct: 156 GGGGDGSSGSGSGSGSGSGSGTGTASGPDVYMHVEGGGGGGGGGGGGGGGGVDGSGSGSG 215 Query: 844 GGXXGG 827 G GG Sbjct: 216 SGSGGG 221 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 41.5 bits (93), Expect = 8e-04 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P PPPP P PP PP PP PP P PPPP P Sbjct: 239 PDPTPPPPPP-----PPIPVKQSATPP--PPPPPKLKNNGPSPPPPPP 279 Score = 39.5 bits (88), Expect = 0.003 Identities = 22/51 (43%), Positives = 23/51 (45%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP PPPPPP P + P P P PP P PPPPPP Sbjct: 239 PDPTPP-PPPPPPIPVKQSATP----PPPPPPKLKNNGP-----SPPPPPP 279 Score = 35.9 bits (79), Expect = 0.041 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 900 PXPPPXPPXPXPXXPXXPPPXPPXP 974 P PPP PP P P PP PP P Sbjct: 241 PTPPPPPPPPIPVKQSATPPPPPPP 265 Score = 35.1 bits (77), Expect = 0.072 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +1 Query: 895 PXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PP PP PP+ PPPP PP Sbjct: 239 PDPTPPPPPP-PPIPVKQSATPPPPPPP 265 Score = 33.5 bits (73), Expect = 0.22 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 7/58 (12%) Frame = +1 Query: 817 PXXXPPXPPP-------PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP PPP PP P P G P P PP PPP P Sbjct: 241 PTPPPPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPPPLKKTAALSSSASKKPPPAP 298 Score = 33.1 bits (72), Expect = 0.29 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 T S P P PPPP PPP PP P P PP PP Sbjct: 231 TDSFEFVKPDPTPPPPP--------PPPIPVKQSATPPPPPPPKLKNNGPSPPPPP 278 >At1g15840.1 68414.m01901 expressed protein Length = 126 Score = 41.5 bits (93), Expect = 8e-04 Identities = 23/55 (41%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXG-GXAXGXGXGGGGGGXGGXXXG 816 GG GGGG G GG G G G G G G G GGG G GG G Sbjct: 40 GGEGGGGEGTSGEGGGGGGDGTKGGGDGISGGGHGDGLGCSGGGGDGTKGGGRRG 94 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXX-PXGGXAXGXGXGGGGG 840 G G GGGG GG GG G G G GG G G GGGG Sbjct: 39 GGGEGGGGEGTSGEGGGGGGDGTKGGGDGISGGGHGDGLGCSGGGG 84 Score = 39.9 bits (89), Expect = 0.003 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG G GGG GG G G G G GG G GGGGGG G G Sbjct: 16 GGDGTKGGGNTITGGGGEGKKKNGGGEG----GGGEGTSGEGGGGGGDGTKGGG 65 Score = 38.3 bits (85), Expect = 0.008 Identities = 21/51 (41%), Positives = 22/51 (43%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GGGG G +GG GG G G GG G G G G G GG G Sbjct: 14 GGGGDGT----KGGGNTITGGGGEGKKKNGGGEGGGGEGTSGEGGGGGGDG 60 Score = 35.9 bits (79), Expect = 0.041 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 6/56 (10%) Frame = -3 Query: 977 GGXG--GGGGGXXXXXRGGXGGXXGGXGXGXXPXG----GXAXGXGXGGGGGGXGG 828 GG G GGG G G G GG G G G G G G GGG GG G Sbjct: 57 GGDGTKGGGDGISGGGHGDGLGCSGGGGDGTKGGGRRGDGLGRGLGRGGGRGGWNG 112 Score = 35.5 bits (78), Expect = 0.054 Identities = 21/54 (38%), Positives = 23/54 (42%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G G GGGG +GG G GG G G + G G G GGG G G Sbjct: 48 GTSGEGGGGGGDGTKGGGDGISGG---GHGDGLGCSGGGGDGTKGGGRRGDGLG 98 Score = 34.7 bits (76), Expect = 0.095 Identities = 23/58 (39%), Positives = 23/58 (39%), Gaps = 6/58 (10%) Frame = -1 Query: 982 GXGGXGGXGGGXX--GXXGXGX----GGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG G GGG G G G GG GGG GG GGG G GG Sbjct: 14 GGGGDGTKGGGNTITGGGGEGKKKNGGGEGGGGEGTSGEGGGGGGDGTKGGGDGISGG 71 Score = 34.7 bits (76), Expect = 0.095 Identities = 20/56 (35%), Positives = 21/56 (37%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 GG GGG G G G GGG G GG GG G GG +G Sbjct: 23 GGNTITGGGGEGKKKNGGGEGGGGEGTSGEGGGGGGDGTKGGGDGISGGGHGDGLG 78 Score = 34.7 bits (76), Expect = 0.095 Identities = 24/62 (38%), Positives = 24/62 (38%), Gaps = 3/62 (4%) Frame = -1 Query: 982 GXGGXG-GXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGG--GGGXXGGXXXXV 812 G G G G GGG G G G G GGG G GG GG G G G Sbjct: 46 GEGTSGEGGGGGGDGTKGGGDGISGGGHGDGLGCSGGGGDGTKGGGRRGDGLGRGLGRGG 105 Query: 811 GR 806 GR Sbjct: 106 GR 107 Score = 33.1 bits (72), Expect = 0.29 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = -1 Query: 982 GXGGXGGX-GGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGG-GXXGG 827 G GG G GG G G G G GGG G GG G G G GG Sbjct: 29 GGGGEGKKKNGGGEGGGGEGTSGEGGGGGGDGTKGGGDGISGGGHGDGLGCSGG 82 Score = 30.3 bits (65), Expect = 2.0 Identities = 23/57 (40%), Positives = 23/57 (40%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGR 806 GG G GG G G G G GGG G GG R G G G GG GR Sbjct: 63 GGGDGISGGGHG-DGLGCSG-GGGDG----TKGGGRRGDGLGRGLGRGGGRGGWNGR 113 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXG-GXGGGXG 899 G GG G GGG G G G G G GGG G Sbjct: 81 GGGGDGTKGGGRRG-DGLGRGLGRGGGRG 108 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 41.5 bits (93), Expect = 8e-04 Identities = 23/53 (43%), Positives = 23/53 (43%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GGGG G G GG GG GG G G GGGGGG G G Sbjct: 383 GWGGGGAGAVTQVMQGCGGGGGGG------DGGGGQGTGIGGGGGGEQGTGVG 429 Score = 39.1 bits (87), Expect = 0.004 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGG 839 G GG GG G G G G G GG GGG GG GGGG Sbjct: 398 GCGGGGGGGDGGGGQ-GTGIGGGGGGEQGTGVGGGGDTCTQVTHGGGG 444 Score = 39.1 bits (87), Expect = 0.004 Identities = 23/52 (44%), Positives = 23/52 (44%), Gaps = 1/52 (1%) Frame = -1 Query: 982 GXGGXG-GXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXG 830 G GG G G GGG G G G GG GG GG GGGGG G Sbjct: 408 GGGGQGTGIGGGGGGEQGTGVGG-GGDTCTQVTHGGGGAPLTMIGGGGGEQG 458 Score = 37.1 bits (82), Expect = 0.018 Identities = 30/98 (30%), Positives = 35/98 (35%), Gaps = 6/98 (6%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGG-XGGGXGXXXXXXGGXRXXXXXGGGGG-----XXGGXX 821 G GG G G G G GG GGG G GG GGGG GG Sbjct: 385 GGGGAGAVTQVMQGCGGGGGGGDGGGGQGTGIGGGGGGEQGTGVGGGGDTCTQVTHGGGG 444 Query: 820 XXVGRVSXAXGSQXFXQXD*SNDXNRQELGIVSGGGQR 707 + + G Q D R G V+GGG++ Sbjct: 445 APLTMIGGGGGEQGVTGSDGGGGRGRGG-GKVAGGGKK 481 Score = 36.3 bits (80), Expect = 0.031 Identities = 22/58 (37%), Positives = 22/58 (37%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXWXSE 801 G GGG G G GG GG G G G G G GGGG G G E Sbjct: 368 GCGGGDAGAITQVMQGWGG--GGAGAVTQVMQGCGGGGGGGDGGGGQGTGIGGGGGGE 423 Score = 33.9 bits (74), Expect = 0.17 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 7/54 (12%) Frame = -3 Query: 968 GGGGGGXXXXXRGG------XGGXXGGXGXGXXPXG-GXAXGXGXGGGGGGXGG 828 G GGGG RGG GG G G G G G G G G GG GG Sbjct: 271 GRGGGGDKTNGRGGEGREEDNGGGRGAEGGGRGSTGEGVTDGGGRTGNKGGNGG 324 Score = 32.7 bits (71), Expect = 0.38 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 9/58 (15%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGG------XGXGXXPXGGXA---XGXGXGGGGGGXGG 828 G GGGG G G GG G G G G G G GGGGG GG Sbjct: 353 GWGGGGSGAATQVMQGCGGGDAGAITQVMQGWGGGGAGAVTQVMQGCGGGGGGGDGGG 410 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 962 GGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 GGGG GG GG G G GG G G GGG G Sbjct: 441 GGGGAPLTMIGGGGGEQGVTGSDG--GGGRGRGGGKVAGGGKKG 482 Score = 29.1 bits (62), Expect = 4.7 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGG 837 G GG GG G G GG G G G G GGGG G Sbjct: 317 GNKGGNGGSIKIGV--GTNGITGGTGGGEA-GAGMQVMQGWGGGGSG 360 Score = 29.1 bits (62), Expect = 4.7 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 2/52 (3%) Frame = -2 Query: 966 GGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGX--XGXGGG 817 GG G +G G G GG GGG GGGGG G GGG Sbjct: 387 GGAGAVTQVMQGCGGGGGGGD-------GGGGQGTGIGGGGGGEQGTGVGGG 431 >At1g23540.1 68414.m02960 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 720 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/63 (36%), Positives = 24/63 (38%), Gaps = 5/63 (7%) Frame = +1 Query: 805 LXQXPXXXPPXPP----PPPPXPXPX-AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 L + P PP PP PPP P A PP P P PPL PPP Sbjct: 4 LGESPSSSPPAPPADTAPPPETPSENSALPPVDSSPPSPPADSSSTPPLSEPSTPPPDSQ 63 Query: 970 XPP 978 PP Sbjct: 64 LPP 66 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP-PPXPP 978 P PP PP P P A P P P P P P PP P P PP Sbjct: 151 PLQSPPAPPASDPTNSPPASPLDPTNPPPIQPSGPATSPPANPNAPPSPFPTVPP 205 Score = 37.1 bits (82), Expect = 0.018 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 1/56 (1%) Frame = +3 Query: 810 PTXXXXPPXX-PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 PT PP PP PP PP PPP P P P PP P Sbjct: 144 PTNPESPPLQSPPAPPASDPTNSPPASPLDPTNPPPIQPSGPATSPPANPNAPPSP 199 Score = 35.5 bits (78), Expect = 0.054 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P PP PP P PP PP P P P PP P Sbjct: 147 PESPPLQSPPAPPASDPTNSPPASPLDPTNPPPIQPSGPATSPPANPNAPPSP 199 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/55 (32%), Positives = 19/55 (34%) Frame = +1 Query: 805 LXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 L P PP PPP + PP P P PP P PP PP Sbjct: 64 LPPLPSILPPLTDSPPPPSD--SSPPVDSTPSPPPPTSNESPSPPEDSETPPAPP 116 Score = 33.5 bits (73), Expect = 0.22 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +2 Query: 812 NXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 N P PP PP PP P PP P + P P PP Sbjct: 146 NPESPPLQSPPAPPASDPTNSPPASPLDPTNPPPIQPSGPATSPPANPNAPP 197 Score = 32.7 bits (71), Expect = 0.38 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXP---PXPPLXXXXXPPPPPPXP 975 P P PPPP P PP P PP PP PPP P P Sbjct: 87 PVDSTPSPPPPTSNESP--SPPEDSETPPAPPNESNDNNPPPSQDLQSPPPSSPSP 140 Score = 32.7 bits (71), Expect = 0.38 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 3/52 (5%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXP---XPPXXPPXPPLXXXXXPPPPPPXP 975 PP P P P PP P P P PP PL PP P P Sbjct: 134 PPSSPSPNVGPTNPESPPLQSPPAPPASDPTNSPPASPLDPTNPPPIQPSGP 185 Score = 32.3 bits (70), Expect = 0.51 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 1/47 (2%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPP-PXPPXPP 977 P PP PP P P P P P PP PP PP Sbjct: 113 PAPPNESNDNNPPPSQDLQSPPPSSPSPNVGPTNPESPPLQSPPAPP 159 Score = 32.3 bits (70), Expect = 0.51 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 844 PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PPP P P P P P PP PP PP P P Sbjct: 133 PPPSSPSPNVGP---TNPESPPLQSPPAPPASDPTNSPPASPLDP 174 Score = 32.3 bits (70), Expect = 0.51 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P P P P P G P PP P PP PP P P Sbjct: 163 PTNSPPASPLDPTNPPP--IQPSG--PATSPPANPNAPPSPFPTVPPKTPSSGP 212 Score = 31.5 bits (68), Expect = 0.88 Identities = 22/60 (36%), Positives = 23/60 (38%), Gaps = 10/60 (16%) Frame = +1 Query: 829 PPXPPP--PPP----XPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPP 978 PP P PPP P P PP P PP PP+ PPPP P PP Sbjct: 50 PPLSEPSTPPPDSQLPPLPSILPPLTDSP---PPPSDSSPPVDSTPSPPPPTSNESPSPP 106 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/48 (31%), Positives = 17/48 (35%), Gaps = 1/48 (2%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXP-PXXPPXPPLXXXXXPPPPPP 969 P PP P + PP P P PP P + PPPP Sbjct: 34 PVDSSPPSPPADSSSTPPLSEPSTPPPDSQLPPLPSILPPLTDSPPPP 81 Score = 31.1 bits (67), Expect = 1.2 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 12/66 (18%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPX-PXAXPPXGXXPXPX----PPXX--PPXPPLXXXXXPPPP---- 963 P P PPP P P PP P P PP P PP P PP Sbjct: 51 PLSEPSTPPPDSQLPPLPSILPPLTDSPPPPSDSSPPVDSTPSPPPPTSNESPSPPEDSE 110 Query: 964 -PPXPP 978 PP PP Sbjct: 111 TPPAPP 116 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/59 (25%), Positives = 18/59 (30%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 ++ N PP PPP P P PP P P+ P P P Sbjct: 119 SNDNNPPPSQDLQSPPPSSPSPNVGPTNPESPPLQSPPAPPASDPTNSPPASPLDPTNP 177 Score = 29.9 bits (64), Expect = 2.7 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PP P + P PP PPL PPP PP Sbjct: 39 PPSPPADSSSTPPLSEPSTPPPDSQLPPLPSILPPLTDSP-PPPSDSSPP 87 Score = 29.5 bits (63), Expect = 3.6 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 6/56 (10%) Frame = +1 Query: 829 PPXPPP------PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PP PPP + PP P P P PPL PP PP P Sbjct: 112 PPAPPNESNDNNPPPSQDLQSPPPSSPSPN-VGPTNPESPPL---QSPPAPPASDP 163 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PP P + P P PP PPL P P PP Sbjct: 33 PPVDSSPPSPPADSSSTPPLSEPSTPPPDS-QLPPLPSILPPLTDSPPPP 81 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/52 (30%), Positives = 18/52 (34%) Frame = +2 Query: 812 NXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 N PP P P PP +P P P P P P+ P P P Sbjct: 165 NSPPASPLDPTNPP----PIQPSGPATSPPANPNAPPSPFPTVPPKTPSSGP 212 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P P A P P P P PP P PP P Sbjct: 147 PESPPLQSPPAPPASDPTNSPPAS--PLDPTNPPPIQPSGPATSPPANP 193 Score = 28.3 bits (60), Expect = 8.2 Identities = 24/87 (27%), Positives = 27/87 (31%) Frame = +3 Query: 714 PPPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXX 893 PPPET + D S P A + T P PPP + PP Sbjct: 21 PPPETPSENSALPPVDSSPPS----PPADSS-STPPLSEPSTPPPDS-----QLPPLPSI 70 Query: 894 XXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P PP P P PP P Sbjct: 71 LPPLTDSPPPPSDSSPPVDSTPSPPPP 97 Score = 28.3 bits (60), Expect = 8.2 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PPP P P P P PP P P P P PP Sbjct: 133 PPPSSPSPNVGPTNPES-PPLQSPPAPPASDPTNSPPASPLDPTNPP 178 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +1 Query: 847 PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PPP P A P PP PPL PPPPPP P Sbjct: 347 PPPPPNRAAFQAITQEKSPVPPPRRSPPPLQTPPPPPPPPPLAP 390 Score = 37.1 bits (82), Expect = 0.018 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 3/49 (6%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPP---XPPXPXPXXPXXPPPXPPXPP 977 PPPPP + P PPP PP P P PPP P PP Sbjct: 347 PPPPPNRAAFQ--AITQEKSPVPPPRRSPPPLQTPPPPPPPPPLAPPPP 393 Score = 36.3 bits (80), Expect = 0.031 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +1 Query: 853 PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P PP P PP PP PPL PPPPP P Sbjct: 365 PVPPPRRSPP----PLQTPPPPPPPPPLA----PPPPPQKRP 398 Score = 32.3 bits (70), Expect = 0.51 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPP 933 P PPP P P PP P P PP PP PP Sbjct: 365 PVPPPR-RSPPPLQTPP---PPPPPPPLAPPPPP 394 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPP 883 PPP PPPPP PPP Sbjct: 373 PPPLQTPPPPPPPPPLAPPPPP 394 Score = 29.9 bits (64), Expect = 2.7 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PPPP PP P P P P PPPPP Sbjct: 37 PESSTPPPPDFQSTPSPPL--PDTPDQPFFPENPSTPQQTLFPPPPP 81 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXP 921 PP PPP P PP P P P P Sbjct: 368 PPRRSPPPLQTPPPPPPPPPLAPPPPPQKRP 398 >At5g26070.1 68418.m03102 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; similar to root nodule extensin [Pisum sativum] gi|15021750|gb|AAK77902; Common family members: At5g19800, At5g57070, At1g72790 [Arabidopsis thaliana] Length = 102 Score = 40.7 bits (91), Expect = 0.001 Identities = 27/82 (32%), Positives = 32/82 (39%), Gaps = 3/82 (3%) Frame = +1 Query: 739 LADSYHXINLXVXXTDYLXLYSLXQXPXXXPPXPPPPPPXP---XPXAXPPXGXXPXPXP 909 +A++ + L T+Y LYS P P PPPPP P P A PP P P Sbjct: 20 VAEANNNRKLLKTPTNYQPLYSPSPSPYRSPVTLPPPPPHPAYSRPVALPP----TLPIP 75 Query: 910 PXXPPXPPLXXXXXPPPPPPXP 975 P PPPP P Sbjct: 76 HPSPHAERFYYRQSPPPPSGKP 97 >At4g29020.1 68417.m04149 glycine-rich protein supporting cDNA gi|20465684|gb|AY096677.1| Length = 158 Score = 40.7 bits (91), Expect = 0.001 Identities = 24/50 (48%), Positives = 24/50 (48%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GGG GG GG GG GG G G GG G G G GG GG Sbjct: 86 GGLGGGVGGL-----GGLGGLGGGSGLGHG-VGGIGGDPGIGSGIGGLGG 129 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGX-GGGGGGXGG 828 G G GG G GG G GG G P GG G G GGG GG GG Sbjct: 48 GAAGIGGAGGVGAGLGGVAGGVGGVA-GVLPVGGVGGGIGGLGGGVGGLGG 97 Score = 39.5 bits (88), Expect = 0.003 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 GG GG GGG G G G G G G G GG GG G GG Sbjct: 83 GGIGGLGGGVGGLGGLGGLGGGSGLGHGVGGIGGDPGIGSGIGGLGGAGG 132 Score = 39.1 bits (87), Expect = 0.004 Identities = 24/54 (44%), Positives = 24/54 (44%), Gaps = 4/54 (7%) Frame = -3 Query: 977 GGXGGGGGGXXXXXR-GGXGGXXGGXG---XGXXPXGGXAXGXGXGGGGGGXGG 828 GG GG GG GG GG GG G G GG G G G G GG GG Sbjct: 63 GGVAGGVGGVAGVLPVGGVGGGIGGLGGGVGGLGGLGGLGGGSGLGHGVGGIGG 116 Score = 35.9 bits (79), Expect = 0.041 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -3 Query: 965 GGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GG GG G GG G G G GGG GG GG G Sbjct: 45 GVGGAAGIGGAGGVGAGLGGVAGGVGGVAGVLPVGGVGGGIGGLGGGVGG 94 Score = 35.9 bits (79), Expect = 0.041 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = -1 Query: 973 GXGGXGGGXXGXXGX-GXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG GG G G GG GGG G GG GGG G G Sbjct: 61 GLGGVAGGVGGVAGVLPVGGVGGGIGGLGGGVGGLGGLGGLGGGSGLGHG 110 Score = 34.7 bits (76), Expect = 0.095 Identities = 23/65 (35%), Positives = 25/65 (38%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRV 803 G GG G GG G G G GG GG G G GGG G GG +G + Sbjct: 45 GVGGAAGIGGA--GGVGAGLGGVAGGVGGV----AGVLPVGGVGGGIGGLGGGVGGLGGL 98 Query: 802 SXAXG 788 G Sbjct: 99 GGLGG 103 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 4/56 (7%) Frame = -2 Query: 975 GXXGGXGGXXXGXEG----XGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGG 820 G GG GG G G G G G G GG GG GG G GG Sbjct: 80 GVGGGIGGLGGGVGGLGGLGGLGGGSGLGHGVGGIGGDPGIGSGIGGLGGAGGLGG 135 Score = 30.7 bits (66), Expect = 1.5 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 4/57 (7%) Frame = -2 Query: 975 GXXGGXGGXXX-GXEGXGXGXXGGXXXGXXXXGG---GRXXXXXXGGGGGXXGXGGG 817 G GG G G G G G GG G GG G GG GG G G G Sbjct: 67 GGVGGVAGVLPVGGVGGGIGGLGGGVGGLGGLGGLGGGSGLGHGVGGIGGDPGIGSG 123 Score = 29.5 bits (63), Expect = 3.6 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 4/57 (7%) Frame = -2 Query: 975 GXXGGXGGXXXGXE-GXGXGXXGGXXX---GXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG GG G G G G GG G GG GG GG G GGG Sbjct: 93 GGLGGLGGLGGGSGLGHGVGGIGGDPGIGSGIGGLGGA-GGLGGIGGVGGLGGIGGG 148 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PPPPP P P P P PP PP PP PPPPP P Sbjct: 8 PPPPPLP-PRLELRRQRAPPPQPPPPPPPPP------PPPPPRLGP 46 Score = 36.7 bits (81), Expect = 0.024 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 5/49 (10%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPP-----LXXXXXPPP 960 PP PP PP P P P PP PP PP L PPP Sbjct: 8 PPPPPLPPRLELRRQRAPPPQPPPPPPPPPPPPPPRLGPRLRLRLLPPP 56 Score = 35.1 bits (77), Expect = 0.072 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 PPPPP P PPP PP P P PPP PP P Sbjct: 8 PPPPPLP-----PRLELRRQRAPPPQPPPPPP-----PPPPPPPP 42 Score = 35.1 bits (77), Expect = 0.072 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXP 909 P PP PPPPPP P P P P P Sbjct: 26 PPQPPPPPPPPPPPPPPRLGPRLRLRLLPPP 56 Score = 33.9 bits (74), Expect = 0.17 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 900 PXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PPP PP PPP PP PP Sbjct: 8 PPPPPLPPRLELRRQRAPPPQPPPPP 33 Score = 33.5 bits (73), Expect = 0.22 Identities = 15/46 (32%), Positives = 17/46 (36%) Frame = +3 Query: 807 LPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXP 944 + T PP P PP + P P PPP PP P P Sbjct: 1 METFGTIPPPPPLPPRLELRRQRAPPPQPPPPPPPPPPPPPPRLGP 46 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPP 913 PPP P PPPPP R P PP Sbjct: 25 PPPQPPPPPPPPPPPPPPRLGPRLRLRLLPPP 56 Score = 29.9 bits (64), Expect = 2.7 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 8/52 (15%) Frame = +1 Query: 832 PXPPPPPPX--------PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 P PPP PP P P PP P P PP P P PPP Sbjct: 8 PPPPPLPPRLELRRQRAPPPQPPPPP---PPPPPPPPPRLGPRLRLRLLPPP 56 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 5/59 (8%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXP--XPPXXPP---XPPLXXXXXPPPPPPXPP 978 P PP PP P P PP P P PP PP PP P PPP P Sbjct: 469 PIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKP 527 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP PPP P P PP P PP PP+ PP P Sbjct: 464 PTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTP 514 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP P P PP P P P PP P P P P PP Sbjct: 688 PVKPPPVQVPPTPTYSPPVKPPPVQVP-PTPTYSPPIKPPPVQVPPTPTTPSPP 740 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP PPP P P PP P PP PP+ PP P Sbjct: 514 PTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTP 564 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP PPP P P PP P PP PP+ PP P Sbjct: 330 PTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTP 380 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/55 (34%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +1 Query: 817 PXXXPPXPPPP-PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PPP P P PP P PP PP+ PP P P Sbjct: 480 PTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSP 534 Score = 38.7 bits (86), Expect = 0.006 Identities = 22/60 (36%), Positives = 23/60 (38%), Gaps = 5/60 (8%) Frame = +1 Query: 817 PXXXPPXPP-PPPPXPXPXAXPPXGXXPXPX--PPXXPPXPPLXXXXXPPP--PPPXPPF 981 P PP P PP P P PP P PP PP P PPP PP P + Sbjct: 490 PVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTY 549 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 5/56 (8%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXP--XPPXXPP---XPPLXXXXXPPPPPP 969 P PP PP P P PP P P PP PP PP P PPP Sbjct: 519 PIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPP 574 Score = 38.3 bits (85), Expect = 0.008 Identities = 25/65 (38%), Positives = 25/65 (38%), Gaps = 11/65 (16%) Frame = +1 Query: 817 PXXXPPXPPPP---PPXPX---PXAXPPXGXXPXPX--PPXXPP---XPPLXXXXXPPPP 963 P PP PPP PP P P PP P P PP PP PP P P Sbjct: 279 PIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKP 338 Query: 964 PPXPP 978 PP P Sbjct: 339 PPVKP 343 Score = 38.3 bits (85), Expect = 0.008 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 5/56 (8%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXP--XPPXXPP---XPPLXXXXXPPPPPP 969 P PP PP P P PP P P PP PP PP P PPP Sbjct: 335 PIKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPP 390 Score = 38.3 bits (85), Expect = 0.008 Identities = 21/60 (35%), Positives = 22/60 (36%), Gaps = 5/60 (8%) Frame = +1 Query: 817 PXXXPPXP---PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP--PPPXPPF 981 P PP P PP P P P P PP PP P PPP PP P + Sbjct: 440 PVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTY 499 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 1/59 (1%) Frame = +1 Query: 805 LXQXPXXXPPXPPPP-PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 L P PP PPP P P PP P PP PP+ PP P P Sbjct: 679 LPPTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKPPPVQVPPTPTTP 737 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 5/56 (8%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXP--XPPXXPP---XPPLXXXXXPPPPPP 969 P PP PP P P PP P P PP PP PP P PPP Sbjct: 318 PIKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPP 373 Score = 37.9 bits (84), Expect = 0.010 Identities = 19/56 (33%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXG--XXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P PP P PP P PP P P+ PPP PP Sbjct: 323 PVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPP 378 Score = 37.9 bits (84), Expect = 0.010 Identities = 19/55 (34%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +1 Query: 817 PXXXPPXPPPP-PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PPP P P PP P PP PP+ PP P P Sbjct: 380 PIYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTPIYSP 434 Score = 37.9 bits (84), Expect = 0.010 Identities = 19/56 (33%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXG--XXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P PP P PP P PP P P+ PPP PP Sbjct: 407 PLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPP 462 Score = 37.9 bits (84), Expect = 0.010 Identities = 19/55 (34%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +1 Query: 817 PXXXPPXPPPPP-PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PPP P P PP P PP PP+ PP P P Sbjct: 430 PIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSP 484 Score = 37.5 bits (83), Expect = 0.013 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = +1 Query: 817 PXXXPPXPP--PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PP PP P P PP P PP P P PPP PP Sbjct: 53 PSYTTPPPPIYSPPIYPPPIQKPPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPP 108 Score = 37.5 bits (83), Expect = 0.013 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 5/56 (8%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXP--XPPXXPP---XPPLXXXXXPPPPPP 969 P PP PP P P PP P P PP PP PP P PPP Sbjct: 166 PIKPPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPP 221 Score = 37.5 bits (83), Expect = 0.013 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 5/56 (8%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPX--PPXXPP---XPPLXXXXXPPPPPP 969 P PP PP P P PP P P PP PP PP P PPP Sbjct: 452 PVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPP 507 Score = 37.5 bits (83), Expect = 0.013 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 5/56 (8%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXP--XPPXXPP---XPPLXXXXXPPPPPP 969 P PP PP P P PP P P PP PP PP P PPP Sbjct: 502 PVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP 557 Score = 37.5 bits (83), Expect = 0.013 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXPP 978 P PP PP P P PP P P P PP P P P PP PP Sbjct: 654 PIKPPPVQKPPTPTYSPPVKPPPVQLP-PTPTYSPPVKPPPVQVPPTPTYSPPVKPP 709 Score = 37.1 bits (82), Expect = 0.018 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXPP 978 P PP PP P P PP P P P PP P P P PP PP Sbjct: 132 PIYPPPIQKPPTPSYSPPVKPPPVQMP-PTPTYSPPIKPPPVHKPPTPTYSPPIKPP 187 Score = 37.1 bits (82), Expect = 0.018 Identities = 19/55 (34%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +1 Query: 817 PXXXPPXPPPP-PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PPP P P PP P PP PP+ PP P P Sbjct: 144 PSYSPPVKPPPVQMPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPVHKPPTPIYSP 198 Score = 37.1 bits (82), Expect = 0.018 Identities = 19/56 (33%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXG--XXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P PP P PP P PP P P+ PPP PP Sbjct: 171 PVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPP 226 Score = 37.1 bits (82), Expect = 0.018 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = +1 Query: 817 PXXXPPXPPPPPPX-PXPXAXPPXGXXPXPX-PPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P PP P P PP P PP P P+ PPP PP Sbjct: 306 PVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPP 361 Score = 36.7 bits (81), Expect = 0.024 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 7/57 (12%) Frame = +2 Query: 818 PPPXPXXP-----PPPPXXXXXXRPPPXXXXPXXXPPXXPXP--XPSXPXXXPPXPP 967 PPP P PPPP PPP P PP P P P P PP P Sbjct: 45 PPPIYGAPPSYTTPPPPIYSPPIYPPPIQKPPTYSPPIYPPPIQKPPTPTYSPPIYP 101 Score = 36.7 bits (81), Expect = 0.024 Identities = 19/57 (33%), Positives = 21/57 (36%) Frame = +1 Query: 799 YSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 Y+ P PP PPP P P PP P PP PP+ PP P Sbjct: 55 YTTPPPPIYSPPIYPPPIQKP-PTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTP 110 Score = 36.7 bits (81), Expect = 0.024 Identities = 19/57 (33%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXP---PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P PP P P P P PP P P+ PPP PP Sbjct: 221 PVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPP 277 Score = 36.7 bits (81), Expect = 0.024 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 5/58 (8%) Frame = +1 Query: 817 PXXXPPXPPPPPPX-PXPXAXPPXGXXPXPX--PPXXPPXPPLXXXXXPPP--PPPXP 975 P PP P PP P P PP P PP PP P PPP PP P Sbjct: 390 PIQKPPTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPPTP 447 Score = 36.7 bits (81), Expect = 0.024 Identities = 26/67 (38%), Positives = 26/67 (38%), Gaps = 13/67 (19%) Frame = +1 Query: 817 PXXXPPXPPPP---PPXPX---PXAXPPXGXXPXPX--PPXXPPX---PPLXXXXXP--P 957 P PP PPP PP P P PP P P PP PP PP P P Sbjct: 598 PTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKP 657 Query: 958 PPPPXPP 978 PP PP Sbjct: 658 PPVQKPP 664 Score = 36.7 bits (81), Expect = 0.024 Identities = 26/67 (38%), Positives = 26/67 (38%), Gaps = 13/67 (19%) Frame = +1 Query: 817 PXXXPPXPPPP---PPXPX---PXAXPPXGXXPXPX--PPXXPPX---PPLXXXXXP--P 957 P PP PPP PP P P PP P P PP PP PP P P Sbjct: 615 PTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKP 674 Query: 958 PPPPXPP 978 PP PP Sbjct: 675 PPVQLPP 681 Score = 36.7 bits (81), Expect = 0.024 Identities = 26/67 (38%), Positives = 26/67 (38%), Gaps = 13/67 (19%) Frame = +1 Query: 817 PXXXPPXPPPP---PPXPX---PXAXPPXGXXPXPX--PPXXPPX---PPLXXXXXP--P 957 P PP PPP PP P P PP P P PP PP PP P P Sbjct: 632 PTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKP 691 Query: 958 PPPPXPP 978 PP PP Sbjct: 692 PPVQVPP 698 Score = 36.7 bits (81), Expect = 0.024 Identities = 24/62 (38%), Positives = 24/62 (38%), Gaps = 11/62 (17%) Frame = +1 Query: 817 PXXXPPXPPPP---PPXPX---PXAXPPXGXXPXPX--PPXXPP---XPPLXXXXXPPPP 963 P PP PPP PP P P PP P P PP PP PP P P Sbjct: 649 PTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKP 708 Query: 964 PP 969 PP Sbjct: 709 PP 710 Score = 36.7 bits (81), Expect = 0.024 Identities = 26/67 (38%), Positives = 26/67 (38%), Gaps = 13/67 (19%) Frame = +1 Query: 817 PXXXPPXPPPP---PPXPX---PXAXPPXGXXPXPX--PPXXPP---XPPLXXXXXP--P 957 P PP PPP PP P P PP P P PP PP PP P P Sbjct: 666 PTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKP 725 Query: 958 PPPPXPP 978 PP PP Sbjct: 726 PPVQVPP 732 Score = 36.3 bits (80), Expect = 0.031 Identities = 26/67 (38%), Positives = 26/67 (38%), Gaps = 13/67 (19%) Frame = +1 Query: 817 PXXXPPXPPPP---PPXPX---PXAXPPXGXXPXPX--PPXXPPX---PPLXXXXXP--P 957 P PP PPP PP P P PP P P PP PP PP P P Sbjct: 194 PIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKP 253 Query: 958 PPPPXPP 978 PP PP Sbjct: 254 PPVHKPP 260 Score = 36.3 bits (80), Expect = 0.031 Identities = 26/67 (38%), Positives = 26/67 (38%), Gaps = 13/67 (19%) Frame = +1 Query: 817 PXXXPPXPPPP---PPXPX---PXAXPPXGXXPXPX--PPXXPPX---PPLXXXXXP--P 957 P PP PPP PP P P PP P P PP PP PP P P Sbjct: 228 PTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKP 287 Query: 958 PPPPXPP 978 PP PP Sbjct: 288 PPVHKPP 294 Score = 36.3 bits (80), Expect = 0.031 Identities = 26/67 (38%), Positives = 26/67 (38%), Gaps = 13/67 (19%) Frame = +1 Query: 817 PXXXPPXPPPP---PPXPX---PXAXPPXGXXPXPX--PPXXPPX---PPLXXXXXP--P 957 P PP PPP PP P P PP P P PP PP PP P P Sbjct: 346 PIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKP 405 Query: 958 PPPPXPP 978 PP PP Sbjct: 406 PPLQKPP 412 Score = 36.3 bits (80), Expect = 0.031 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = +1 Query: 817 PXXXPPXPPPPP-PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP PPP P P PP P PP PP+ PP P Sbjct: 363 PIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPPTP 414 Score = 36.3 bits (80), Expect = 0.031 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 2/57 (3%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP--XPPXP 974 PT PP PPP PP P P PP P P PPP PP P Sbjct: 462 PTPTYSPPIKPPPVKPPTPTYSPP----VQPPPVQKPPTPTYSPPVKPPPIQKPPTP 514 Score = 36.3 bits (80), Expect = 0.031 Identities = 21/59 (35%), Positives = 22/59 (37%), Gaps = 3/59 (5%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPP---XPPXPXPXXPXXPPPXPPXPP 977 PT PP PPP + PP P PP PP P P PPP P P Sbjct: 478 PTPTYSPPVQPPP------VQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTP 530 Score = 36.3 bits (80), Expect = 0.031 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 2/56 (3%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXG--XXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P PP P PP P PP P P PPP PP Sbjct: 507 PIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPP 562 Score = 36.3 bits (80), Expect = 0.031 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXPP 978 P PP PP P P PP P P P PP P P P PP PP Sbjct: 552 PIKPPPIHKPPTPTYSPPIKPPPVHKP-PTPTYSPPIKPPPVHKPPTPTYSPPIKPP 607 Score = 36.3 bits (80), Expect = 0.031 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXPP 978 P PP PP P P PP P P P PP P P P PP PP Sbjct: 569 PIKPPPVHKPPTPTYSPPIKPPPVHKP-PTPTYSPPIKPPPVHKPPTPTYSPPIKPP 624 Score = 36.3 bits (80), Expect = 0.031 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXPP 978 P PP PP P P PP P P P PP P P P PP PP Sbjct: 586 PIKPPPVHKPPTPTYSPPIKPPPVHKP-PTPTYSPPIKPPPVHKPPTPTYSPPIKPP 641 Score = 35.9 bits (79), Expect = 0.041 Identities = 18/56 (32%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = +1 Query: 805 LXQXPXXXPPXPPPP-PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 + + P PP PPP P P PP P PP PP+ PP P Sbjct: 72 IQKPPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTP 127 Score = 35.9 bits (79), Expect = 0.041 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP--XPPLXXXXXPPPPPPXPP 978 P PP PP P P PP P P P PP PP+ P PP P Sbjct: 98 PIYPPPIQKPPTPTYSPPIYPPPIQKP-PTPTYSPPIYPPPIQKPPTPSYSPPVKP 152 Score = 35.9 bits (79), Expect = 0.041 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = +1 Query: 817 PXXXPPXPPPP-PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP PPP P P PP P PP PP+ PP P Sbjct: 262 PIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTP 313 Score = 35.9 bits (79), Expect = 0.041 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 2/57 (3%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP--XPPXP 974 PT PP PPP PP P P PP P P PPP PP P Sbjct: 328 PTPTYSPPIKPPPVKPPTPIYSPP----VKPPPVHKPPTPIYSPPVKPPPVHKPPTP 380 Score = 35.9 bits (79), Expect = 0.041 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP P P PP P P P PP P PP P PP Sbjct: 435 PVKPPPVHKPPTPIYSPPVKPPPVHKP-PTPTYSPPIKP--PPVKPPTPTYSPP 485 Score = 35.9 bits (79), Expect = 0.041 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP P P PP P P P PP P PP P PP Sbjct: 485 PVQPPPVQKPPTPTYSPPVKPPPIQKP-PTPTYSPPIKP--PPVKPPTPTYSPP 535 Score = 35.9 bits (79), Expect = 0.041 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 2/57 (3%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP--XPPXP 974 PT PP PPP PP P P PP P P PPP PP P Sbjct: 512 PTPTYSPPIKPPPVKPPTPTYSPP----IKPPPVHKPPTPTYSPPIKPPPIHKPPTP 564 Score = 35.9 bits (79), Expect = 0.041 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXPP 978 P PP PP P P PP P P P PP P P P PP PP Sbjct: 535 PIKPPPVHKPPTPTYSPPIKPPPIHKP-PTPTYSPPIKPPPVHKPPTPTYSPPIKPP 590 Score = 35.5 bits (78), Expect = 0.054 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXPP 978 P PP PP P P PP P P P PP P P P PP PP Sbjct: 81 PIYPPPIQKPPTPTYSPPIYPPPIQKP-PTPTYSPPIYPPPIQKPPTPTYSPPIYPP 136 Score = 35.5 bits (78), Expect = 0.054 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = +1 Query: 817 PXXXPPXPPPP-PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP PPP P P PP P PP PP+ PP P Sbjct: 93 PTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTP 144 Score = 35.5 bits (78), Expect = 0.054 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = +1 Query: 817 PXXXPPXPPPP-PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP PPP P P PP P PP PP+ PP P Sbjct: 127 PTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVHKPPTP 178 Score = 35.5 bits (78), Expect = 0.054 Identities = 20/55 (36%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP-XPPLXXXXXPPPPPPXPP 978 P PP PP P P PP P P P PP PP+ P PP P Sbjct: 149 PVKPPPVQMPPTPTYSPPIKPPPVHKP-PTPTYSPPIKPPVHKPPTPIYSPPIKP 202 Score = 35.5 bits (78), Expect = 0.054 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP PP P P PP P PP PP+ PP P Sbjct: 178 PTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTP 228 Score = 35.5 bits (78), Expect = 0.054 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP P P PP P P P PP P PP P PP Sbjct: 250 PIKPPPVHKPPTPIYSPPVKPPPVQTP-PTPIYSPPVKP-PPVHKPPTPTYSPP 301 Score = 35.5 bits (78), Expect = 0.054 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 5/56 (8%) Frame = +1 Query: 817 PXXXPP-XPPPPPPXPXPXAXPPXGXXPXP--XPPXXPP--XPPLXXXXXPPPPPP 969 P PP PP P P PP P P PP PP PP P PPP Sbjct: 301 PVKSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPP 356 Score = 35.5 bits (78), Expect = 0.054 Identities = 22/59 (37%), Positives = 23/59 (38%), Gaps = 4/59 (6%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPP--XPPXPXPXXPXXPPP--XPPXP 974 PT PP PPP + PP P PP PP P P PPP PP P Sbjct: 311 PTPTYSPPIKPPP------VQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPPTP 363 Score = 35.5 bits (78), Expect = 0.054 Identities = 21/59 (35%), Positives = 23/59 (38%), Gaps = 3/59 (5%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPPXXXX-PXXXPPXXPXP--XPSXPXXXPPXPP 967 T+S PP P PP P +PPP P PP P P P P PP P Sbjct: 314 TYSPPIKPP-PVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKP 371 Score = 35.5 bits (78), Expect = 0.054 Identities = 24/64 (37%), Positives = 24/64 (37%), Gaps = 10/64 (15%) Frame = +1 Query: 817 PXXXPP--XPPPPPPXP---XPXAXPPXGXXPXP--XPPXXPP---XPPLXXXXXPPPPP 966 P PP PP PP P P PP P P PP PP PP P PP Sbjct: 414 PTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPP 473 Query: 967 PXPP 978 P P Sbjct: 474 PVKP 477 Score = 35.5 bits (78), Expect = 0.054 Identities = 21/59 (35%), Positives = 23/59 (38%), Gaps = 3/59 (5%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPP--XXXXPXXXPPXXPXP-XPSXPXXXPPXPP 967 T+S PP P PP P +PPP P PP P P P P PP P Sbjct: 481 TYSPPVQPP-PVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKP 538 Score = 35.5 bits (78), Expect = 0.054 Identities = 22/59 (37%), Positives = 23/59 (38%), Gaps = 4/59 (6%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPP--XPPXPXPXXPXXPPP--XPPXP 974 PT PP PPP + PP P PP PP P P PPP PP P Sbjct: 495 PTPTYSPPVKPPP------IQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTP 547 Score = 35.5 bits (78), Expect = 0.054 Identities = 21/59 (35%), Positives = 23/59 (38%), Gaps = 3/59 (5%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPPXXXX-PXXXPPXXPXP--XPSXPXXXPPXPP 967 T+S PP P PP P +PPP P PP P P P P PP P Sbjct: 498 TYSPPVKPP-PIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKP 555 Score = 35.5 bits (78), Expect = 0.054 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = +1 Query: 817 PXXXPPXPPPPP-PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP PPP P P PP P PP PP+ PP P Sbjct: 530 PTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTP 581 Score = 35.5 bits (78), Expect = 0.054 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = +1 Query: 817 PXXXPPXPPPP-PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP PPP P P PP P PP PP+ PP P Sbjct: 547 PTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTP 598 Score = 35.5 bits (78), Expect = 0.054 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = +1 Query: 817 PXXXPPXPPPPP-PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP PPP P P PP P PP PP+ PP P Sbjct: 564 PTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTP 615 Score = 35.5 bits (78), Expect = 0.054 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = +1 Query: 817 PXXXPPXPPPPP-PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP PPP P P PP P PP PP+ PP P Sbjct: 581 PTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTP 632 Score = 35.5 bits (78), Expect = 0.054 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXP---PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P PP P P P P PP P P PPP PP Sbjct: 659 PVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVPP 715 Score = 35.5 bits (78), Expect = 0.054 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 2/50 (4%) Frame = +1 Query: 817 PXXXPPXPPPP-PPXPXPXAXPPXGXXPXPXPP-XXPPXPPLXXXXXPPP 960 P PP PPP P P PP P PP P PP PPP Sbjct: 700 PTYSPPVKPPPVQVPPTPTYSPPIKPPPVQVPPTPTTPSPPQGGYGTPPP 749 Score = 35.1 bits (77), Expect = 0.072 Identities = 26/67 (38%), Positives = 26/67 (38%), Gaps = 13/67 (19%) Frame = +1 Query: 817 PXXXPPXPPPP---PPXPX---PXAXPPXGXXPXPX--PPXXPPX---PPLXXXXXP--P 957 P PP PPP PP P P PP P P PP PP PP P P Sbjct: 110 PTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKP 169 Query: 958 PPPPXPP 978 PP PP Sbjct: 170 PPVHKPP 176 Score = 35.1 bits (77), Expect = 0.072 Identities = 21/63 (33%), Positives = 22/63 (34%), Gaps = 8/63 (12%) Frame = +3 Query: 810 PTXXXXPPXXPPP------PPXXXXXRXPPXXXXXXP--XPPPXPPXPXPXXPXXPPPXP 965 PT PP PPP P + PP P PP PP P P PP Sbjct: 142 PTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIK 201 Query: 966 PXP 974 P P Sbjct: 202 PPP 204 Score = 35.1 bits (77), Expect = 0.072 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 4/59 (6%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPP--XPPXPXPXXPXXPPP--XPPXP 974 PT PP PPP PP P PP PP P P PPP PP P Sbjct: 159 PTPTYSPPIKPPP------VHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTP 211 Score = 35.1 bits (77), Expect = 0.072 Identities = 22/59 (37%), Positives = 23/59 (38%), Gaps = 4/59 (6%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXP--XPPPXPPXPXPXXPXXPPP--XPPXP 974 PT PP PPP + PP P PP PP P P PPP PP P Sbjct: 395 PTPTYSPPIKPPP------LQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPPTP 447 Score = 35.1 bits (77), Expect = 0.072 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 4/59 (6%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPP--XPPXPXPXXPXXPPP--XPPXP 974 PT PP PPP PP P PP PP P P PPP PP P Sbjct: 445 PTPIYSPPVKPPP------VHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTP 497 Score = 34.7 bits (76), Expect = 0.095 Identities = 21/64 (32%), Positives = 23/64 (35%), Gaps = 2/64 (3%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP--X 962 P + T P PP PPP + P P P PP P P PPP Sbjct: 52 PPSYTTPPPPIYSPPIYPPP-----IQKPPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQK 106 Query: 963 PPXP 974 PP P Sbjct: 107 PPTP 110 Score = 34.7 bits (76), Expect = 0.095 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 5/56 (8%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXP--XPPXXPP---XPPLXXXXXPPPPPP 969 P P PP P P PP P P PP PP PP P PPP Sbjct: 183 PIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTPTYSPPVKPPP 238 Score = 34.7 bits (76), Expect = 0.095 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = +1 Query: 817 PXXXPPXPPPPP-PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP PPP P P PP P PP PP+ PP P Sbjct: 211 PIYSPPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTP 262 Score = 34.7 bits (76), Expect = 0.095 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = +1 Query: 817 PXXXPPXPPPPP-PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP PPP P P PP P PP PP+ PP P Sbjct: 245 PIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPPTP 296 Score = 34.7 bits (76), Expect = 0.095 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Frame = +1 Query: 817 PXXXPPXPPPP-PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP P P PP P PP PP+ PP P P Sbjct: 296 PTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSP 350 Score = 34.7 bits (76), Expect = 0.095 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 6/60 (10%) Frame = +1 Query: 817 PXXXPPXPPPP-PPXPXPXAXPPXGXXP--XPXPPXXPPXPPLXXXXXPPP---PPPXPP 978 P PP PPP P P PP P P P PP P P P PP PP Sbjct: 313 PTYSPPIKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPP 372 Score = 34.7 bits (76), Expect = 0.095 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 2/58 (3%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXP--XPSXPXXXPPXPP 967 T+S PP PP P PP P PP P P P P PP P Sbjct: 398 TYSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKP 455 Score = 34.7 bits (76), Expect = 0.095 Identities = 19/64 (29%), Positives = 21/64 (32%), Gaps = 2/64 (3%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXP--XPPPXPPXPXPXXPXXPPPX 962 P + P P PP P + PP P PP PP P P PP Sbjct: 427 PPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPV 486 Query: 963 PPXP 974 P P Sbjct: 487 QPPP 490 Score = 34.7 bits (76), Expect = 0.095 Identities = 20/55 (36%), Positives = 21/55 (38%), Gaps = 5/55 (9%) Frame = +2 Query: 818 PP--PXPXXPPPPPXXXXXXRPPP--XXXXPXXXPPXXPXP-XPSXPXXXPPXPP 967 PP P P PP P +PPP P PP P P P P PP P Sbjct: 434 PPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQP 488 Score = 34.7 bits (76), Expect = 0.095 Identities = 20/55 (36%), Positives = 21/55 (38%), Gaps = 5/55 (9%) Frame = +2 Query: 818 PP--PXPXXPPPPPXXXXXXRPPPXXXX-PXXXPPXXPXP--XPSXPXXXPPXPP 967 PP P P PP P +PPP P PP P P P P PP P Sbjct: 451 PPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKP 505 Score = 34.7 bits (76), Expect = 0.095 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXP---PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P PP P P P P PP P P PPP PP Sbjct: 523 PPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPP 579 Score = 34.7 bits (76), Expect = 0.095 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXP---PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P PP P P P P PP P P PPP PP Sbjct: 540 PVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPP 596 Score = 34.7 bits (76), Expect = 0.095 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXP---PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P PP P P P P PP P P PPP PP Sbjct: 557 PIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPP 613 Score = 34.7 bits (76), Expect = 0.095 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXP---PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P PP P P P P PP P P PPP PP Sbjct: 574 PVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPP 630 Score = 34.3 bits (75), Expect = 0.13 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 5/60 (8%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPP---XPPXPXPXXPXXPPP--XPPXP 974 PT PP PPP PP P PP PP P P PPP PP P Sbjct: 192 PTPIYSPPIKPPP------VHKPPTPIYSPPIKPPPVHKPPTPTYSPPVKPPPVHKPPTP 245 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 2/57 (3%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXP--XPPPXPPXPXPXXPXXPPPXPPXP 974 P P PP P + PP P PP PP P P PP P P Sbjct: 300 PPVKSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPP 356 Score = 34.3 bits (75), Expect = 0.13 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 5/60 (8%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPP---XPPXPXPXXPXXPPP--XPPXP 974 PT PP PPP PP P PP PP P P PPP PP P Sbjct: 344 PTPIYSPPVKPPP------VHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTP 397 Score = 34.3 bits (75), Expect = 0.13 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP--XPPLXXXXXPPPPPPXPP 978 P PP PP P P PP P P P PP PP+ PP PP Sbjct: 385 PVKPPPIQKPPTPTYSPPIKPPPLQKP-PTPTYSPPIKLPPVKPPTPIYSPPVKPP 439 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 2/57 (3%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXP--XPPPXPPXPXPXXPXXPPPXPPXP 974 P P PP P + PP P PP PP P P PP P P Sbjct: 484 PPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPP 540 Score = 34.3 bits (75), Expect = 0.13 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 5/60 (8%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPP---XPPXPXPXXPXXPPP--XPPXP 974 PT PP PPP PP P PP PP P P PPP PP P Sbjct: 528 PTPTYSPPIKPPP------VHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTP 581 Score = 33.9 bits (74), Expect = 0.17 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 6/56 (10%) Frame = +2 Query: 818 PP--PXPXXPPPPPXXXXXXRPPPXXXXPXXX--PPXXPXP--XPSXPXXXPPXPP 967 PP P P PP P +PPP P PP P P P P PP P Sbjct: 215 PPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKP 270 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXP--SXPXXXPPXPPXXP 976 PP P PP P P P PP P P S P PP P P Sbjct: 293 PPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVKPPTP 346 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXP--SXPXXXPPXPPXXP 976 PP P PP P P P PP P P S P PP P P Sbjct: 427 PPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTP 480 Score = 33.5 bits (73), Expect = 0.22 Identities = 18/64 (28%), Positives = 20/64 (31%), Gaps = 2/64 (3%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPP--XPPXPXPXXPXXPPPX 962 P + P P PP P + PP PP PP P P PP Sbjct: 444 PPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPV 503 Query: 963 PPXP 974 P P Sbjct: 504 KPPP 507 Score = 33.5 bits (73), Expect = 0.22 Identities = 19/64 (29%), Positives = 20/64 (31%) Frame = +3 Query: 786 LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXP 965 LP P P PP P + PP P P PP P P P Sbjct: 679 LPPTPTYSPPVKPPPVQVPPTPTYSPPVKPPP--VQVPPTPTYSPPIKPPPVQVPPTPTT 736 Query: 966 PXPP 977 P PP Sbjct: 737 PSPP 740 Score = 33.1 bits (72), Expect = 0.29 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 2/57 (3%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPP--XPPXPXPXXPXXPPPXPPXP 974 P P PPPP PP PP PP P P PP P P Sbjct: 47 PIYGAPPSYTTPPPPIYSPPIYPPPIQKPPTYSPPIYPPPIQKPPTPTYSPPIYPPP 103 Score = 33.1 bits (72), Expect = 0.29 Identities = 19/60 (31%), Positives = 22/60 (36%), Gaps = 4/60 (6%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXX--PPXXPXP--XPSXPXXXPPXPP 967 T + + P P PP P +PPP P PP P P P P PP P Sbjct: 177 TPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTPTYSPPVKP 236 Score = 33.1 bits (72), Expect = 0.29 Identities = 19/60 (31%), Positives = 22/60 (36%), Gaps = 4/60 (6%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXX--PPXXPXP--XPSXPXXXPPXPP 967 T + + P P PP P +PPP P PP P P P P PP P Sbjct: 329 TPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKP 388 Score = 33.1 bits (72), Expect = 0.29 Identities = 19/60 (31%), Positives = 22/60 (36%), Gaps = 4/60 (6%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPP--XXXXPXXXPPXXPXP--XPSXPXXXPPXPP 967 T + + P P PP P +PPP P PP P P P P PP P Sbjct: 413 TPTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKP 472 Score = 33.1 bits (72), Expect = 0.29 Identities = 19/60 (31%), Positives = 22/60 (36%), Gaps = 4/60 (6%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPP--XXXXPXXXPPXXPXP--XPSXPXXXPPXPP 967 T + + P P PP P +PPP P PP P P P P PP P Sbjct: 513 TPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKP 572 Score = 32.7 bits (71), Expect = 0.38 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 10/59 (16%) Frame = +3 Query: 828 PPXXPPP-----PPXXXXXRXPPXXXXXXPXPPP---XPPXPXPXXPXXPPP--XPPXP 974 PP PP PP PP P PP PP P P PPP PP P Sbjct: 170 PPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTP 228 Score = 32.7 bits (71), Expect = 0.38 Identities = 19/60 (31%), Positives = 22/60 (36%), Gaps = 4/60 (6%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPP--XXXXPXXXPPXXPXP--XPSXPXXXPPXPP 967 T + + P P PP P +PPP P PP P P P P PP P Sbjct: 463 TPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKP 522 Score = 32.3 bits (70), Expect = 0.51 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 6/60 (10%) Frame = +1 Query: 817 PXXXPPXPPPP---PPX-PXPXAXPPXGXXPXP--XPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP PP P P PP P PP P P PPP PP Sbjct: 66 PIYPPPIQKPPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPP 125 Score = 32.3 bits (70), Expect = 0.51 Identities = 19/65 (29%), Positives = 21/65 (32%), Gaps = 3/65 (4%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXP-XPPPXPPXP--XPXXPXXPPP 959 P + P P PP P + PP P PP P P P P PP Sbjct: 208 PPTPIYSPPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPP 267 Query: 960 XPPXP 974 P P Sbjct: 268 VKPPP 272 Score = 31.9 bits (69), Expect = 0.67 Identities = 22/60 (36%), Positives = 23/60 (38%), Gaps = 5/60 (8%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPX-PPPXPPXPXP--XXPXXPPP--XPPXP 974 PT PP PPP + PP P PPP P P P PPP PP P Sbjct: 108 PTPTYSPPIYPPP------IQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTP 161 Score = 31.9 bits (69), Expect = 0.67 Identities = 20/59 (33%), Positives = 22/59 (37%), Gaps = 3/59 (5%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPPXXXX-PXXXPPXXPXP--XPSXPXXXPPXPP 967 T+S PP P PP P +PP P PP P P P P PP P Sbjct: 162 TYSPPIKPP-PVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKP 219 Score = 31.9 bits (69), Expect = 0.67 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 6/53 (11%) Frame = +2 Query: 818 PP--PXPXXPPPPPXXXXXXRPPPXXXXPXXX--PPXXPXP--XPSXPXXXPP 958 PP P P PP P +PPP P PP P P P P PP Sbjct: 249 PPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPP 301 Score = 31.9 bits (69), Expect = 0.67 Identities = 23/89 (25%), Positives = 27/89 (30%), Gaps = 2/89 (2%) Frame = +3 Query: 714 PPPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXX 893 PPP P + + +S P P P PP P + PP Sbjct: 287 PPPVHKPPTPTYSPPVKSPPVQK--PPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVKPP 344 Query: 894 XXPXPPPXPPXP--XPXXPXXPPPXPPXP 974 PP P P P P PP P P Sbjct: 345 TPIYSPPVKPPPVHKPPTPIYSPPVKPPP 373 Score = 31.9 bits (69), Expect = 0.67 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 2/57 (3%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP--XPPXP 974 PT PP PP PP P P PP P P PPP PP P Sbjct: 412 PTPTYSPPIKLPPVKPPTPIYSPP----VKPPPVHKPPTPIYSPPVKPPPVHKPPTP 464 Score = 31.9 bits (69), Expect = 0.67 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 3/52 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXP-XPPPXPPXP--XPXXPXXPPPXPPXP 974 PP PP P PP P PP P P P P PP P P Sbjct: 506 PPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP 557 Score = 31.5 bits (68), Expect = 0.88 Identities = 22/60 (36%), Positives = 23/60 (38%), Gaps = 5/60 (8%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPX-PPPXPPXPXP--XXPXXPPP--XPPXP 974 PT PP PPP + PP P PPP P P P PPP PP P Sbjct: 125 PTPTYSPPIYPPP------IQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVHKPPTP 178 Score = 31.5 bits (68), Expect = 0.88 Identities = 19/65 (29%), Positives = 21/65 (32%), Gaps = 3/65 (4%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXP-XPPPXPPXP--XPXXPXXPPP 959 P + P P PP P + PP P PP P P P P PP Sbjct: 191 PPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPP 250 Query: 960 XPPXP 974 P P Sbjct: 251 IKPPP 255 Score = 31.5 bits (68), Expect = 0.88 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 5/60 (8%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPX-PPPXPPXPXP--XXPXXPPP--XPPXP 974 PT PP PPP PP P PPP P P P PPP PP P Sbjct: 243 PTPIYSPPIKPPP------VHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPPTP 296 Score = 31.5 bits (68), Expect = 0.88 Identities = 18/65 (27%), Positives = 20/65 (30%), Gaps = 3/65 (4%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXP---XPPPXPPXPXPXXPXXPPP 959 P + P P PP P + PP P P PP P P PP Sbjct: 259 PPTPIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPP 318 Query: 960 XPPXP 974 P P Sbjct: 319 IKPPP 323 Score = 31.5 bits (68), Expect = 0.88 Identities = 18/65 (27%), Positives = 20/65 (30%), Gaps = 3/65 (4%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXP---XPPPXPPXPXPXXPXXPPP 959 P + P P PP P + PP P P PP P P PP Sbjct: 343 PPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPP 402 Query: 960 XPPXP 974 P P Sbjct: 403 IKPPP 407 Score = 31.5 bits (68), Expect = 0.88 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 5/60 (8%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPX-PPPXPPXPXP--XXPXXPPP--XPPXP 974 PT PP PPP PP P PPP P P P PPP PP P Sbjct: 361 PTPIYSPPVKPPP------VHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPPTP 414 Score = 31.5 bits (68), Expect = 0.88 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 5/60 (8%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPX-PPPXPPXPXP--XXPXXPPP--XPPXP 974 PT PP PPP PP P PPP P P P PPP PP P Sbjct: 630 PTPTYSPPIKPPP------VHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPPTP 683 Score = 31.5 bits (68), Expect = 0.88 Identities = 22/60 (36%), Positives = 23/60 (38%), Gaps = 5/60 (8%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPX-PPPXPPXPXP--XXPXXPPP--XPPXP 974 PT PP PPP + PP P PPP P P P PPP PP P Sbjct: 664 PTPTYSPPVKPPP------VQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVPPTP 717 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PP P PP P P P PP P PS P P P Sbjct: 107 PPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMP 158 Score = 31.1 bits (67), Expect = 1.2 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 5/60 (8%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPX-PPPXPPXPXP--XXPXXPPP--XPPXP 974 PT PP PPP PP P PPP P P P PPP PP P Sbjct: 226 PTPTYSPPVKPPP------VHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTP 279 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/60 (33%), Positives = 22/60 (36%), Gaps = 4/60 (6%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPP--XXXXPXXXPPXXPXP--XPSXPXXXPPXPP 967 T+S PP PP P +PPP P PP P P P P PP P Sbjct: 229 TYSPPVKPPPVH-KPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKP 287 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/52 (28%), Positives = 16/52 (30%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PP P PP P P P PP P P+ P P P Sbjct: 276 PPTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKP 327 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/60 (33%), Positives = 22/60 (36%), Gaps = 4/60 (6%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPP--XXXXPXXXPPXXPXP--XPSXPXXXPPXPP 967 T+S PP PP P +PPP P PP P P P P PP P Sbjct: 531 TYSPPIKPPPVH-KPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKP 589 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/58 (31%), Positives = 19/58 (32%), Gaps = 3/58 (5%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXP-XPPPXPPXP--XPXXPXXPPPXPPXP 974 P P PP P + PP P PP P P P P PP P P Sbjct: 534 PPIKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP 591 Score = 31.1 bits (67), Expect = 1.2 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 5/60 (8%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPX-PPPXPPXPXP--XXPXXPPP--XPPXP 974 PT PP PPP PP P PPP P P P PPP PP P Sbjct: 545 PTPTYSPPIKPPP------IHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTP 598 Score = 31.1 bits (67), Expect = 1.2 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 5/60 (8%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPX-PPPXPPXPXP--XXPXXPPP--XPPXP 974 PT PP PPP PP P PPP P P P PPP PP P Sbjct: 562 PTPTYSPPIKPPP------VHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTP 615 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/60 (33%), Positives = 22/60 (36%), Gaps = 4/60 (6%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPP--XXXXPXXXPPXXPXP--XPSXPXXXPPXPP 967 T+S PP PP P +PPP P PP P P P P PP P Sbjct: 565 TYSPPIKPPPVH-KPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKP 623 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/58 (31%), Positives = 19/58 (32%), Gaps = 3/58 (5%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXP-XPPPXPPXP--XPXXPXXPPPXPPXP 974 P P PP P + PP P PP P P P P PP P P Sbjct: 568 PPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP 625 Score = 31.1 bits (67), Expect = 1.2 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 5/60 (8%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPX-PPPXPPXPXP--XXPXXPPP--XPPXP 974 PT PP PPP PP P PPP P P P PPP PP P Sbjct: 579 PTPTYSPPIKPPP------VHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTP 632 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/60 (33%), Positives = 22/60 (36%), Gaps = 4/60 (6%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPP--XXXXPXXXPPXXPXP--XPSXPXXXPPXPP 967 T+S PP PP P +PPP P PP P P P P PP P Sbjct: 582 TYSPPIKPPPVH-KPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKP 640 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/58 (31%), Positives = 19/58 (32%), Gaps = 3/58 (5%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXP-XPPPXPPXP--XPXXPXXPPPXPPXP 974 P P PP P + PP P PP P P P P PP P P Sbjct: 585 PPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP 642 Score = 31.1 bits (67), Expect = 1.2 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 5/60 (8%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPX-PPPXPPXPXP--XXPXXPPP--XPPXP 974 PT PP PPP PP P PPP P P P PPP PP P Sbjct: 596 PTPTYSPPIKPPP------VHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTP 649 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/60 (33%), Positives = 22/60 (36%), Gaps = 4/60 (6%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPP--XXXXPXXXPPXXPXP--XPSXPXXXPPXPP 967 T+S PP PP P +PPP P PP P P P P PP P Sbjct: 599 TYSPPIKPPPVH-KPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKP 657 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/58 (31%), Positives = 19/58 (32%), Gaps = 3/58 (5%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXP-XPPPXPPXP--XPXXPXXPPPXPPXP 974 P P PP P + PP P PP P P P P PP P P Sbjct: 602 PPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP 659 Score = 31.1 bits (67), Expect = 1.2 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 5/60 (8%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPX-PPPXPPXPXP--XXPXXPPP--XPPXP 974 PT PP PPP PP P PPP P P P PPP PP P Sbjct: 613 PTPTYSPPIKPPP------VHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTP 666 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/60 (33%), Positives = 22/60 (36%), Gaps = 4/60 (6%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPP--XXXXPXXXPPXXPXP--XPSXPXXXPPXPP 967 T+S PP PP P +PPP P PP P P P P PP P Sbjct: 616 TYSPPIKPPPVH-KPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKP 674 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/58 (31%), Positives = 19/58 (32%), Gaps = 3/58 (5%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXP--XPP-PXPPXPXPXXPXXPPPXPPXP 974 P P PP P + PP P PP PP P P PP P P Sbjct: 619 PPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPP 676 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/59 (32%), Positives = 20/59 (33%), Gaps = 3/59 (5%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPP-PXXXXPXXXPPXXPXP--XPSXPXXXPPXPP 967 T+S PP PP P PP P PP P P P P PP P Sbjct: 633 TYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKP 691 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/58 (29%), Positives = 18/58 (31%), Gaps = 3/58 (5%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXP---XPPPXPPXPXPXXPXXPPPXPPXP 974 P P PP P + PP P P PP P P PP P P Sbjct: 636 PPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPP 693 Score = 31.1 bits (67), Expect = 1.2 Identities = 22/60 (36%), Positives = 23/60 (38%), Gaps = 5/60 (8%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPX-PPPXP--PXPXPXXPXXPPP--XPPXP 974 PT PP PPP + PP P PPP P P P PPP PP P Sbjct: 647 PTPTYSPPIKPPP------VQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTP 700 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/59 (32%), Positives = 20/59 (33%), Gaps = 3/59 (5%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPP-PXXXXPXXXPPXXPXP--XPSXPXXXPPXPP 967 T+S PP PP P PP P PP P P P P PP P Sbjct: 650 TYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKP 708 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/58 (29%), Positives = 18/58 (31%), Gaps = 3/58 (5%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXP---XPPPXPPXPXPXXPXXPPPXPPXP 974 P P PP P + PP P P PP P P PP P P Sbjct: 653 PPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPPP 710 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/59 (32%), Positives = 20/59 (33%), Gaps = 3/59 (5%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPP-PXXXXPXXXPPXXPXP--XPSXPXXXPPXPP 967 T+S PP PP P PP P PP P P P P PP P Sbjct: 667 TYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKP 725 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/58 (29%), Positives = 18/58 (31%), Gaps = 3/58 (5%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXP---XPPPXPPXPXPXXPXXPPPXPPXP 974 P P PP P + PP P P PP P P PP P P Sbjct: 670 PPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKPPP 727 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/52 (28%), Positives = 16/52 (30%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PP P PP P P P PP P P+ P P P Sbjct: 191 PPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTPTYSPPVKPPPVHKP 242 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/60 (33%), Positives = 22/60 (36%), Gaps = 4/60 (6%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPPP--XXXXPXXXPPXXPXP--XPSXPXXXPPXPP 967 T+S PP PP P +PPP P PP P P P P PP P Sbjct: 548 TYSPPIKPPPIH-KPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKP 606 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/58 (31%), Positives = 19/58 (32%), Gaps = 3/58 (5%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXP-XPPPXPPXP--XPXXPXXPPPXPPXP 974 P P PP P + PP P PP P P P P PP P P Sbjct: 551 PPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP 608 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/52 (28%), Positives = 16/52 (30%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PP P PP P P P PP P P+ P P P Sbjct: 595 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKP 646 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/58 (29%), Positives = 18/58 (31%), Gaps = 3/58 (5%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXP---XPPPXPPXPXPXXPXXPPPXPPXP 974 P P PP P + PP P P PP P P PP P P Sbjct: 232 PPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKPPP 289 Score = 30.3 bits (65), Expect = 2.0 Identities = 19/57 (33%), Positives = 20/57 (35%), Gaps = 1/57 (1%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXP-XPPPXPPXPXPXXPXXPPPXPPXPP 977 PT PP PPP + PP P PPP P P P P PP Sbjct: 698 PTPTYSPPVKPPP------VQVPPTPTYSPPIKPPPVQVPPTPTTPSPPQGGYGTPP 748 Score = 29.9 bits (64), Expect = 2.7 Identities = 19/59 (32%), Positives = 20/59 (33%), Gaps = 3/59 (5%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPP-PXXXXPXXXPPXXPXP--XPSXPXXXPPXPP 967 T+S PP PP P PP P PP P P P P PP P Sbjct: 94 TYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKP 152 Score = 29.9 bits (64), Expect = 2.7 Identities = 19/59 (32%), Positives = 20/59 (33%), Gaps = 3/59 (5%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPP-PXXXXPXXXPPXXPXP--XPSXPXXXPPXPP 967 T+S PP PP P PP P PP P P P P PP P Sbjct: 111 TYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKP 169 Score = 29.9 bits (64), Expect = 2.7 Identities = 19/59 (32%), Positives = 20/59 (33%), Gaps = 3/59 (5%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPP-PXXXXPXXXPPXXPXP--XPSXPXXXPPXPP 967 T+S PP PP P PP P PP P P P P PP P Sbjct: 128 TYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVHKPPTPTYSPPIKP 186 Score = 29.9 bits (64), Expect = 2.7 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 2/48 (4%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXP--SXPXXXPP 958 PP P PP P P P PP P P S P PP Sbjct: 259 PPTPIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSPP 306 Score = 29.5 bits (63), Expect = 3.6 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 4/59 (6%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPX-PPPXPPXPXPXXP---XXPPPXPPXP 974 PT PP PPP + PP P PPP P P PP PP P Sbjct: 378 PTPIYSPPVKPPP------IQKPPTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTP 430 Score = 29.1 bits (62), Expect = 4.7 Identities = 19/59 (32%), Positives = 20/59 (33%), Gaps = 3/59 (5%) Frame = +2 Query: 800 THSXNXPPPXPXXPPPPPXXXXXXRPP-PXXXXPXXXPPXXPXP--XPSXPXXXPPXPP 967 T+S PP PP P PP P PP P P P P PP P Sbjct: 77 TYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYP 135 Score = 29.1 bits (62), Expect = 4.7 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 3/58 (5%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXP-XPPP--XPPXPXPXXPXXPPPXPPXP 974 P P PP P PP P PP PP P P PP P P Sbjct: 97 PPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPP 154 Score = 29.1 bits (62), Expect = 4.7 Identities = 17/58 (29%), Positives = 17/58 (29%), Gaps = 3/58 (5%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXP---XPPPXPPXPXPXXPXXPPPXPPXP 974 P P PP P PP P P PP P P PP P P Sbjct: 114 PPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPPP 171 Score = 29.1 bits (62), Expect = 4.7 Identities = 19/59 (32%), Positives = 21/59 (35%), Gaps = 4/59 (6%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPP--XXXXPXXXPPXXPXP--XPSXPXXXPPXPP 967 +S PP PP P +PPP P PP P P P P PP P Sbjct: 196 YSPPIKPPPVH-KPPTPIYSPPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKP 253 Score = 29.1 bits (62), Expect = 4.7 Identities = 18/58 (31%), Positives = 20/58 (34%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 +S PP PP P +PPP P P P S P PP P P Sbjct: 264 YSPPVKPPPVQ-TPPTPIYSPPVKPPPVHKPP---TPTYSPPVKSPPVQKPPTPTYSP 317 Score = 29.1 bits (62), Expect = 4.7 Identities = 19/59 (32%), Positives = 21/59 (35%), Gaps = 4/59 (6%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPP--XXXXPXXXPPXXPXP--XPSXPXXXPPXPP 967 +S PP PP P +PPP P PP P P P P PP P Sbjct: 348 YSPPVKPPPVH-KPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKP 405 Score = 29.1 bits (62), Expect = 4.7 Identities = 20/68 (29%), Positives = 22/68 (32%), Gaps = 5/68 (7%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXP--XPP-PXPPXPXPXXPXXPPP 959 P + P P PP P + PP P PP PP P P PP Sbjct: 360 PPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYSPP 419 Query: 960 --XPPXPP 977 PP P Sbjct: 420 IKLPPVKP 427 Score = 29.1 bits (62), Expect = 4.7 Identities = 17/60 (28%), Positives = 17/60 (28%), Gaps = 2/60 (3%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXP--PXXPXPXPSXPXXXPPXPPXXP 976 H P P PPP PP P P P P P PP P P Sbjct: 459 HKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSP 518 Score = 28.7 bits (61), Expect = 6.2 Identities = 21/65 (32%), Positives = 21/65 (32%), Gaps = 10/65 (15%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXP------XPPP--XPPXPXPXXPXXPPP-- 959 P P PP P PP P PPP PP P P PPP Sbjct: 80 PPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQ 139 Query: 960 XPPXP 974 PP P Sbjct: 140 KPPTP 144 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 2/48 (4%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXP--SXPXXXPP 958 PP P PP P P P PP P P S P PP Sbjct: 90 PPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPP 137 Score = 28.3 bits (60), Expect = 8.2 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PPP P PP P P PP PPP PP Sbjct: 45 PPPIYGAPPSYTTPPPPIYSPPIYPPPIQKPPTYSPPIYPPPIQKPP 91 Score = 28.3 bits (60), Expect = 8.2 Identities = 18/60 (30%), Positives = 19/60 (31%), Gaps = 4/60 (6%) Frame = +3 Query: 810 PTXXXXPPXXP-PPPPXXXXXRXPPXXXXXXPXPPP---XPPXPXPXXPXXPPPXPPXPP 977 P PP PP + PP P PP PP P P PP P P Sbjct: 135 PPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPVHKPPTP 194 Score = 28.3 bits (60), Expect = 8.2 Identities = 18/65 (27%), Positives = 20/65 (30%), Gaps = 3/65 (4%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXP-XPPPXPPXP--XPXXPXXPPP 959 P + P P PP P + PP P PP P P P P PP Sbjct: 242 PPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPP 301 Query: 960 XPPXP 974 P Sbjct: 302 VKSPP 306 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 PP PPPP P P A PP P P P PP PP Sbjct: 93 PPSPPPPSPPPPSQACPPPPLPPSPPKKSYCPPPPSTYIYMTGPP 137 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 844 PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP 960 PPP P P PP P PP PP PP PPP Sbjct: 92 PPPSPPPPSPPPPSQACP---PPPLPPSPPKKSYCPPPP 127 Score = 36.7 bits (81), Expect = 0.024 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 3/27 (11%) Frame = +3 Query: 906 PPPXPPXPXPXXPXX---PPPXPPXPP 977 PPP PP P P P PPP PP PP Sbjct: 92 PPPSPPPPSPPPPSQACPPPPLPPSPP 118 Score = 33.9 bits (74), Expect = 0.17 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP 959 P PP PPPP PP P PPP PP P P PPP Sbjct: 86 PCLQNIPPPSPPPP-------SPPPPSQACP-PPPLPPSP-PKKSYCPPP 126 Score = 33.1 bits (72), Expect = 0.29 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 895 PXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PP P PP PPP PP PP Sbjct: 92 PPPSPPPPSPPPP-SQACPPPPLPPSPP 118 Score = 32.7 bits (71), Expect = 0.38 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 812 NXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP 958 N PPP P P PPP PPP P P P PP Sbjct: 90 NIPPPSPPPPSPPPPSQACP-PPPLPPSPPKKSYCPPPPSTYIYMTGPP 137 Score = 28.3 bits (60), Expect = 8.2 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +3 Query: 876 PPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PPP P P P PP PP Sbjct: 92 PPPSPPPPSPPPPSQACPPPPLPPSPPKKSYCPP 125 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 40.7 bits (91), Expect = 0.001 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 865 PXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P P PP PP PPL PPPP PP Sbjct: 32 PSLIPTRFFLPHPPPPPPPPPPPLYFSYFSLPPPPPPP 69 Score = 38.3 bits (85), Expect = 0.008 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP 924 P PPPPPP P P P P PP PP Sbjct: 42 PHPPPPPPPPPPPLYFSYFSLPPPPPPPHLPP 73 Score = 33.1 bits (72), Expect = 0.29 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = +3 Query: 807 LPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXP 953 +PT P PPPPP PP PPP PP P P Sbjct: 35 IPTRFFLPHPPPPPPPPP-----PPLYFSYFSLPPPPPPPHLPPTSVTP 78 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPP 933 P PPPP P P P PP P PP Sbjct: 42 PHPPPPPPPPPPPLYFSYFSLPPPPPPPHLPP 73 >At5g19090.2 68418.m02270 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 465 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -3 Query: 932 GGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GG GG G G G G GGGGGG GG Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGG 136 Score = 36.7 bits (81), Expect = 0.024 Identities = 22/47 (46%), Positives = 22/47 (46%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGG 837 GG GGGGGG GG G G GG G G GGGGGG Sbjct: 102 GGKGGGGGG------GGPANNNKGQKIG---GGGGGGGGGGGGGGGG 139 Score = 35.5 bits (78), Expect = 0.054 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -3 Query: 923 GGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GG G G G GGGGGG GG G Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGG 137 Score = 29.9 bits (64), Expect = 2.7 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = -1 Query: 982 GXGGXGGXGGG-XXGXXGXGXGGXGGGXGXXXXXXGG 875 G G GG GGG G GG GGG G GG Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGG 138 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 40.3 bits (90), Expect = 0.002 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPP 912 PP PPPPP P PP G P P PP Sbjct: 230 PPPPPPPPHQAQPPPPPPSGLFPPPPPP 257 Score = 37.9 bits (84), Expect = 0.010 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 PPPPP P A PP P P PP PP+ P PP Sbjct: 230 PPPPPPPPHQAQPP---PPPPSGLFPPPPPPMANNGFRPMPP 268 Score = 36.3 bits (80), Expect = 0.031 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXX--PPXPPLXXXXXPPPPPP 969 P P P A G P P PP P PP PPPPPP Sbjct: 212 PTKPEPNKPQSAVGANGLPPPPPPPPHQAQPPPPPPSGLFPPPPPP 257 Score = 33.5 bits (73), Expect = 0.22 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 3/27 (11%) Frame = +3 Query: 906 PPPXPPXPXPXXPXXPPP---XPPXPP 977 PPP PP P P PPP PP PP Sbjct: 230 PPPPPPPPHQAQPPPPPPSGLFPPPPP 256 Score = 31.9 bits (69), Expect = 0.67 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPP 956 PPPPP PP PPP PP PP Sbjct: 230 PPPPPPPPHQAQPPPPPPSGLFPPPPPPMANNGFRPMPP 268 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPP 883 PPP PPPPP PPP Sbjct: 235 PPPHQAQPPPPPPSGLFPPPPP 256 Score = 29.9 bits (64), Expect = 2.7 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 4/47 (8%) Frame = +1 Query: 850 PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP----PPPXPP 978 P P P P PP PP P PPP PPP PP Sbjct: 212 PTKPEPNK-PQSAVGANGLPPPPPPPPHQAQPPPPPPSGLFPPPPPP 257 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 4/27 (14%) Frame = +3 Query: 900 PXPPPXP----PXPXPXXPXXPPPXPP 968 P PPP P P P P PPP PP Sbjct: 231 PPPPPPPHQAQPPPPPPSGLFPPPPPP 257 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 3/30 (10%) Frame = +2 Query: 803 HSXNXPPPXP---XXPPPPPXXXXXXRPPP 883 H PPP P PPPPP RP P Sbjct: 238 HQAQPPPPPPSGLFPPPPPPMANNGFRPMP 267 >At2g11005.1 68415.m01177 glycine-rich protein Length = 170 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 G GGG GG G G GG G G G GGG G GG Sbjct: 13 GDGGGSGGGGGSGDGSGSGDGGGSGDGGGSRDSDGSGDSSGGGSGDSGG 61 Score = 37.9 bits (84), Expect = 0.010 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGG 840 GG GGGGG G GG G G G + G G G GG Sbjct: 16 GGSGGGGGSGDGSGSGDGGGSGDGGGSRDSDGSGDSSGGGSGDSGG 61 Score = 36.7 bits (81), Expect = 0.024 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G GG GGG G G G GGG G GGG G GG Sbjct: 11 GSGDGGGSGGGGGSGDGSG-SGDGGGSGDGGGSRDSDGSGDSSGGGSGDSGG 61 Score = 28.3 bits (60), Expect = 8.2 Identities = 22/72 (30%), Positives = 23/72 (31%) Frame = -1 Query: 922 GGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRVSXAXGSQXFXQXD*SNDXNR 743 GG GGG G G GGG G GG G + G N N Sbjct: 16 GGSGGGGGSGDGSGSG------DGGGSGDGGGSRDSDGSGDSSGGGSGDSGGFGDNSDNN 69 Query: 742 QELGIVSGGGQR 707 SGGG R Sbjct: 70 SVSSDSSGGGSR 81 >At1g65440.1 68414.m07424 glycine-rich protein Length = 1647 Score = 40.3 bits (90), Expect = 0.002 Identities = 25/63 (39%), Positives = 27/63 (42%), Gaps = 4/63 (6%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGX---GXXPXGGXAXGXGXGGGG-GGXGGXXXGXW 810 G GGGG G + GG GG G G G + G G GGGG GG G G Sbjct: 1524 GNSGGGGWGSESAGKKTGGGSTGGWGSESGGNKSDGAGSWGSGSGGGGSGGWGNDSGGKK 1583 Query: 809 XSE 801 SE Sbjct: 1584 SSE 1586 Score = 37.1 bits (82), Expect = 0.018 Identities = 22/66 (33%), Positives = 23/66 (34%), Gaps = 3/66 (4%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXX---GXWX 807 GG G GG GG G GG G G GG G GG G W Sbjct: 1573 GGWGNDSGGKKSSEDGGFGSGSGGGGSDWGNESGGKKSSADGGWGSESGGKKSDGEGGWG 1632 Query: 806 SEXSXR 789 +E S R Sbjct: 1633 NEPSSR 1638 Score = 34.7 bits (76), Expect = 0.095 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = -1 Query: 976 GGXGGXGGGXX--GXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 GG G GG G G G GGG G GG + G G G GG Sbjct: 1546 GGWGSESGGNKSDGAGSWGSGSGGGGSGGWGNDSGGKKSSEDGGFGSGSGGG 1597 Score = 34.7 bits (76), Expect = 0.095 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG G GG G G GG G G + GG G GG Sbjct: 1571 GSGGWGNDSGGKKSSEDGGFGSGSGGGGSDWGNESGGKKSSADGGWGSESGG 1622 Score = 34.3 bits (75), Expect = 0.13 Identities = 24/87 (27%), Positives = 27/87 (31%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRVSX 797 GG G GGG G G GG G GG + G G GG G S Sbjct: 1521 GGWGNSGGGGWGSESAGKKTGGGSTGGWGSESGGNKSDGAGSWGSGSGGGGSGGWGNDSG 1580 Query: 796 AXGSQXFXQXD*SNDXNRQELGIVSGG 716 S + + G SGG Sbjct: 1581 GKKSSEDGGFGSGSGGGGSDWGNESGG 1607 Score = 31.5 bits (68), Expect = 0.88 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXX--PXGGXAXGXGXG-GGGGGXGGXXXG 816 GG G GG G G GG G G GG G G G G GG G Sbjct: 1546 GGWGSESGGNKSDGAGSWGSGSGGGGSGGWGNDSGGKKSSEDGGFGSGSGGGGSDWG 1602 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G G G GG G G G G G GGGG G G Sbjct: 1554 GNKSDGAGSWGSGSGGGGSGGWGNDSGGKKSSEDGGFGSGSGGGGSDWGNESGG 1607 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/59 (28%), Positives = 17/59 (28%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXWXSE 801 G G G GG G G G G G G GG G W SE Sbjct: 1561 GSWGSGSGGGGSGGWGNDSGGKKSSEDGGFGSGSGGGGSDWGNESGGKKSSADGGWGSE 1619 >At1g27750.1 68414.m03391 ubiquitin system component Cue domain-containing protein very low similarity to ASC-1 complex subunit P100 [Homo sapiens] GI:12061187; contains Pfam profile PF02845: CUE domain Length = 1973 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 P PP PPP P P A PP P PP PP PP P PP Sbjct: 865 PQSQPPEPPPEMMPPPPQALPP--PLPHSHPPLVPP-PPFSPLLSPRLPP 911 Score = 33.5 bits (73), Expect = 0.22 Identities = 17/45 (37%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Frame = +1 Query: 811 QXPXXXPPXPPPPP---PXPXPXAXPPXGXXPXPXPPXXPPXPPL 936 Q P P PPPP P P P + PP P P P PP+ Sbjct: 868 QPPEPPPEMMPPPPQALPPPLPHSHPPLVPPPPFSPLLSPRLPPM 912 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXP-PXPPLXXXXXPPPPPPXPP 978 P P PP P P PP P PP P PPL PPPP P Sbjct: 862 PLQPQSQPPEPPPEMMPP---PPQALPPPLPHSHPPLV------PPPPFSP 903 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 PP P P PP P P PP P PPPP Sbjct: 861 PPLQPQSQPPEPPPE-MMPPPPQALPPPLPHSHPPLVPPPP 900 >At5g11990.1 68418.m01402 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 181 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 5/56 (8%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP-----PPPXPPF 981 PP P P P P P P P PP PPL PPP PP P F Sbjct: 45 PPSKPSPSMSPPPSPSLPLSSSPPPPPPHKHSPPPLSQSLSPPPLITVIHPPPPRF 100 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXP---PXXPPXPPLXXXXXPPPPPPXPP 978 P PPPP P + PP P P PP P PPPPP P Sbjct: 62 PLSSSPPPPPPHKHSPPPLSQSLSPPPLITVIHPPPPRFYYFESTPPPPPLSP 114 Score = 32.7 bits (71), Expect = 0.38 Identities = 19/61 (31%), Positives = 20/61 (32%), Gaps = 7/61 (11%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP-------PPPXP 975 P PP P P P PP P P P P + PPP PP P Sbjct: 51 PSMSPPPSPSLPLSSSPPPPPPHKHSPPPLSQSLSPPPLITVIHPPPPRFYYFESTPPPP 110 Query: 976 P 978 P Sbjct: 111 P 111 Score = 32.3 bits (70), Expect = 0.51 Identities = 21/65 (32%), Positives = 21/65 (32%), Gaps = 5/65 (7%) Frame = +1 Query: 802 SLXQXPXXXPPXPPPP-----PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 SL P PPPP P P P G P P PP P PP Sbjct: 83 SLSPPPLITVIHPPPPRFYYFESTPPPPPLSPDGKGSPPSVPSSPPSPKGQSQGQQQPPY 142 Query: 967 PXPPF 981 P P F Sbjct: 143 PFPYF 147 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/66 (28%), Positives = 21/66 (31%), Gaps = 3/66 (4%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXP---PPXPPXPXPXXPXXPPP 959 P ++ P P PPPP PP P P PP P PP Sbjct: 49 PSPSMSPPPSPSLPLSSSPPPPPPHKHSPPPLSQSLSPPPLITVIHPPPPRFYYFESTPP 108 Query: 960 XPPXPP 977 PP P Sbjct: 109 PPPLSP 114 Score = 28.3 bits (60), Expect = 8.2 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PPP P P PP P P P PP PPP PP Sbjct: 39 PTICSPPPSKPSPSMSPP----PSPSLPLSSSPPP------PPPHKHSPP 78 >At5g04970.1 68418.m00526 pectinesterase, putative contains similarity to pectinesterase from Vitis vinifera GI:15081598, Prunus persica SP|Q43062; contains Pfam profile PF01095 pectinesterase Length = 624 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPX-PPLXXXXXPPPPPP 969 PP PP P P + PP P PP PP PP PP PPP Sbjct: 27 PPSQPPSHPPIQPSSQPPT--QPPSQPPTQPPTQPPSHPPTQPPTPPP 72 Score = 38.3 bits (85), Expect = 0.008 Identities = 21/64 (32%), Positives = 22/64 (34%) Frame = +1 Query: 787 YLXLYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 +L L L P PP PP P P P P P PP PP P Sbjct: 10 FLALLCLSWALLVSPTRPPSQPPSHPP--IQPSSQPPTQPPSQPPTQPPTQPPSHPPTQP 67 Query: 967 PXPP 978 P PP Sbjct: 68 PTPP 71 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PP P P PP P PP PP PP P P P PP Sbjct: 35 PPIQPSSQPPTQPPSQPPTQPPT--QPPSHPPTQPPTPP--PSQSPSQPSPLPP 84 Score = 36.7 bits (81), Expect = 0.024 Identities = 24/64 (37%), Positives = 24/64 (37%) Frame = +3 Query: 786 LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXP 965 L A L PT PP PP P PP P PP P P P PP P Sbjct: 16 LSWALLVSPTR---PPSQPPSHPPIQPSSQPP---TQPPSQPPTQPPTQP--PSHPPTQP 67 Query: 966 PXPP 977 P PP Sbjct: 68 PTPP 71 Score = 29.9 bits (64), Expect = 2.7 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXPXPXAXP--PXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 Q P P PP PP P P P P P P PP P P Sbjct: 42 QPPTQPPSQPPTQPPTQPPSHPPTQPPTPPPSQSPSQPSPLPPNIACKSTPYP 94 Score = 29.5 bits (63), Expect = 3.6 Identities = 17/52 (32%), Positives = 18/52 (34%), Gaps = 3/52 (5%) Frame = +3 Query: 828 PPXXPPP-PPXXXXXRXPPXXXXXXPXPPP--XPPXPXPXXPXXPPPXPPXP 974 PP PP PP + P P PPP P P P P P P Sbjct: 43 PPTQPPSQPPTQPPTQPPSHPPTQPPTPPPSQSPSQPSPLPPNIACKSTPYP 94 >At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin family protein similar to arabinogalactan protein [Daucus carota] GI:11322245; contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 359 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPP--XGXXPXPXPPXXPP-XPPLXXXXXPPPPPPXPP 978 P PP PP P P PP P PP PP PP PP PP P Sbjct: 106 PPVKPPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKP 162 Score = 37.5 bits (83), Expect = 0.013 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPX-PPXXPPX-PPLXXXXXPPPPPPXPP 978 P P PP PP P P P PP PP PP PP PP P Sbjct: 127 PTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKP 182 Score = 37.5 bits (83), Expect = 0.013 Identities = 19/50 (38%), Positives = 20/50 (40%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PP P P A PP P P P PP+ PP PP P Sbjct: 174 PPTKPPVKPPVSPPAKPPV-KPPVYPPTKAPVKPPVSPPTKPPVTPPVYP 222 Score = 37.1 bits (82), Expect = 0.018 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPX-PPLXXXXXPP-PPPPXPP 978 P PP P P P PP P PP PP PP PP PP PP Sbjct: 162 PPVYPPTKAPVKPPTKPPVKPPVS--PPAKPPVKPPVYPPTKAPVKPPVSPPTKPP 215 Score = 36.7 bits (81), Expect = 0.024 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPX-PPLXXXXXPPP-PPPXPP 978 P PP P P P PP P PP PP PP PP PP PP Sbjct: 90 PPVYPPTKAPVKPPTKPPVKPPVS--PPAKPPVKPPVYPPTKAPVKPPTKPPVKPP 143 Score = 35.9 bits (79), Expect = 0.041 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPX-PPXXPPX-PPLXXXXXPPPPPPXPP 978 P P P PP P P P PP PP PP PP PP P Sbjct: 60 PHPHPHPPAKSPVKPPVKAPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKP 110 Score = 35.5 bits (78), Expect = 0.054 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PP P P PP P P P PP+ PP PP P Sbjct: 74 PPVKAPVSPPAKPPVKPPVYPPT-KAPVKPPTKPPVKPPVSPPAKPPVKPPVYP 126 Score = 35.5 bits (78), Expect = 0.054 Identities = 19/63 (30%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXP--PXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 +Y + P P PP PP P P P P P P PP+ PP P Sbjct: 92 VYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAP 151 Query: 970 XPP 978 P Sbjct: 152 VKP 154 Score = 35.5 bits (78), Expect = 0.054 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PP P P PP P P P PP+ PP PP P Sbjct: 146 PPTKAPVKPPTKPPVKPPVYPPT-KAPVKPPTKPPVKPPVSPPAKPPVKPPVYP 198 Score = 35.5 bits (78), Expect = 0.054 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPP--XGXXPXPXPPXXPP-XPPLXXXXXPPPPPPXPP 978 P PP PP P PP P PP PP PP PP PP P Sbjct: 158 PPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPPVSPPTKP 214 Score = 35.5 bits (78), Expect = 0.054 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP PP P P PP P P P PP PP PP Sbjct: 174 PPTKPPVKPPVSPPAKPPVKPPV-YPPTKAPVKPPVSPPTKPPVTPPVYPP 223 Score = 35.1 bits (77), Expect = 0.072 Identities = 19/63 (30%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXP--PXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 +Y + P P PP PP P P P P P P PP+ PP P Sbjct: 144 VYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPPVYPPTKAP 203 Query: 970 XPP 978 P Sbjct: 204 VKP 206 Score = 34.7 bits (76), Expect = 0.095 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 9/63 (14%) Frame = +1 Query: 817 PXXXPPXPPP--PP------PXPXPXAXPPXGXXPXPXPPXXPP-XPPLXXXXXPPPPPP 969 P PP PP PP P P PP P PP PP PP PP PP Sbjct: 82 PPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVS--PPAKPPVKPPVYPPTKAPVKPPTKPP 139 Query: 970 XPP 978 P Sbjct: 140 VKP 142 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 2/56 (3%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXP--PXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PP PP P P P P P P PP PP PP P Sbjct: 135 PTKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKP 190 Score = 33.1 bits (72), Expect = 0.29 Identities = 19/55 (34%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP-XPPLXXXXXPPPPPPXPP 978 P PP PP P PP P PP PP P+ PP PP P Sbjct: 114 PPAKPPVKPPVYPPTKAPVKPP--TKPPVKPPVYPPTKAPVKPPTKPPVKPPVYP 166 Score = 32.3 bits (70), Expect = 0.51 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PP P PP P P P P P PP PP P Sbjct: 174 PPTKPPVKPPVSPPAKPPVKPPVYP-PTKAPVKPPVSPPTKPPVTPPVYP 222 Score = 31.9 bits (69), Expect = 0.67 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP-PPPPXPP 978 P P PP P A PP P P P PP PP PP PP Sbjct: 66 PPAKSPVKPPVKAPVSPPAKPPVKPPVYP-PTKAPVKPPTKPPVKPPVSPPAKPP 119 Score = 31.5 bits (68), Expect = 0.88 Identities = 16/54 (29%), Positives = 17/54 (31%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P P P P P P P P PP+ P PP P Sbjct: 53 PHHHHPHPHPHPHPPAKSPVKPPVKAPVSPPAKPPVKPPVYPPTKAPVKPPTKP 106 Score = 31.5 bits (68), Expect = 0.88 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 PP PP P PP P P P P P PP PP Sbjct: 102 PPTKPPVKPPVSPPAKPPVKPPVYP-PTKAPVKPPTKPPVKPPVYPP 147 Score = 31.5 bits (68), Expect = 0.88 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXP--PXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P P PP PP P P P P P P PP PP PP Sbjct: 115 PAKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPP 167 Score = 31.5 bits (68), Expect = 0.88 Identities = 18/53 (33%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPP-PPXXXXXRXPPXXXXXXPXPPPX--PPXPXPXXPXXPPPXPPXPP 977 PP PP PP + P P PP P P P PP PP P Sbjct: 138 PPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKP 190 Score = 31.5 bits (68), Expect = 0.88 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = +3 Query: 828 PPXXPP-PPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 PP PP PP + P P PP P P P PP PP Sbjct: 178 PPVKPPVSPPAKPPVKPPVYPPTKAPVKPPVSPPTKP--PVTPPVYPP 223 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP-XPPLXXXXXPPPPPPXPP 978 P PP P P PP P PP PP P+ PP PP P Sbjct: 62 PHPHPPAKSPVKPPVKAPVSPPA--KPPVKPPVYPPTKAPVKPPTKPPVKPPVSP 114 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = +3 Query: 828 PPXXPPP-PPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PP PP + P P PP P P P PP P P Sbjct: 86 PPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKP--PVYPPTKAPVKP 134 Score = 29.9 bits (64), Expect = 2.7 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 PP PP P PP PP PP P P PP P Sbjct: 118 PPVKPPVYPPTKAPVKPPTKPPV--KPPVYPPTKAPVKPPTKPPVKP 162 Score = 29.9 bits (64), Expect = 2.7 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPX--PPPXPPXPXPXXPXXP-PPXPPXPP 977 PP PP P PP P PP PP P P P PP P Sbjct: 158 PPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPPVSP 210 Score = 29.5 bits (63), Expect = 3.6 Identities = 17/60 (28%), Positives = 18/60 (30%), Gaps = 2/60 (3%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXP--XPXPSXPXXXPPXPPXXP 976 H + P P P PP P P PP P P P P PP P Sbjct: 51 HPPHHHHPHPHPHPHPPAKSPVKPPVKAPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKP 110 Score = 29.5 bits (63), Expect = 3.6 Identities = 16/51 (31%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP-XPPLXXXXXPPPPPPXPP 978 PP P P P P P P PP PP+ PP P P Sbjct: 52 PPHHHHPHPHPHPHPPAKSPVKPPVKAPVSPPAKPPVKPPVYPPTKAPVKP 102 Score = 29.1 bits (62), Expect = 4.7 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = +1 Query: 832 PXPPPPP-PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP P P P PP P P P PP PP PP Sbjct: 50 PHPPHHHHPHPHPHPHPP-AKSPVKPPVKAPVSPPAKPPVKPPVYPP 95 Score = 29.1 bits (62), Expect = 4.7 Identities = 18/63 (28%), Positives = 19/63 (30%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P A + P P PP P P PP P P P PP PP Sbjct: 66 PPAKSPVKPPVKAPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVSP--PAKPPVKPP 123 Query: 969 XPP 977 P Sbjct: 124 VYP 126 Score = 29.1 bits (62), Expect = 4.7 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 1/50 (2%) Frame = +3 Query: 831 PXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXP-XXPXXPPPXPPXPP 977 P PP P PP PP PP P P PP PP P Sbjct: 171 PVKPPTKPPVKPPVSPPAKPPV--KPPVYPPTKAPVKPPVSPPTKPPVTP 218 Score = 28.7 bits (61), Expect = 6.2 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 1/57 (1%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP-XPPXPP 977 P PP P P PP PP PP P P PP PP P Sbjct: 60 PHPHPHPPAKSPVKPPVKAPVSPPAKPPV--KPPVYPPTKAPVKPPTKPPVKPPVSP 114 Score = 28.3 bits (60), Expect = 8.2 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 7/57 (12%) Frame = +1 Query: 829 PPXPPPPPP--XPXPXAXPPXGXXPXPXPPXXPP-----XPPLXXXXXPPPPPPXPP 978 P P P P PP P P P PP PP+ PP PP P Sbjct: 34 PSLAPAPAPYHHGHHHPHPPHHHHPHPHPHPHPPAKSPVKPPVKAPVSPPAKPPVKP 90 >At5g43770.1 68418.m05353 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 187 Score = 39.5 bits (88), Expect = 0.003 Identities = 23/62 (37%), Positives = 24/62 (38%), Gaps = 8/62 (12%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPX----PXAXPPXGXXPXPXPPXXPP--XPPLXXXXXPPP--PPPX 972 P PP PP P P P PP P P P PP PP+ PP PP Sbjct: 112 PSDPPPLGPPQTPGPEFPVPPSPSPPMPDTPNPPTPKTPPDVVPPIWEPPRPPDIFPPES 171 Query: 973 PP 978 PP Sbjct: 172 PP 173 Score = 37.9 bits (84), Expect = 0.010 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 2/58 (3%) Frame = +1 Query: 811 QXPXXXPPXPPPP-PPXPXPXAXPPXGXXPXPXPPXX-PPXPPLXXXXXPPPPPPXPP 978 Q P P PP P PP P P P PP PP PP PPP PP Sbjct: 122 QTPGPEFPVPPSPSPPMPDTPNPPTPKTPPDVVPPIWEPPRPPDIFPPESPPPGIDPP 179 Score = 36.7 bits (81), Expect = 0.024 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P P PP P P PP P P P PP P PPP P Sbjct: 139 PDTPNPPTPKTPPDVVPPIWEPPRP-PDIFPPESPPPGIDPPPPLGP 184 Score = 31.9 bits (69), Expect = 0.67 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = +3 Query: 807 LPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 LP P PP PP P P P P P P P P P PP Sbjct: 93 LPNIPEISPSETPPEVTTVPSDPPPLG----PPQTPGPEFPVPPSPSPPMPDTPNPP 145 Score = 31.5 bits (68), Expect = 0.88 Identities = 17/55 (30%), Positives = 17/55 (30%), Gaps = 1/55 (1%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXX-PPXPPLXXXXXPPPPPPXPP 978 P PP P P P P P PP PP P P PP P Sbjct: 101 PSETPPEVTTVPSDPPPLGPPQTPGPEFPVPPSPSPPMPDTPNPPTPKTPPDVVP 155 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/62 (30%), Positives = 21/62 (33%), Gaps = 2/62 (3%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPP--PPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPX 962 P T+P+ PP PP P P P P PP P P PP Sbjct: 105 PPEVTTVPSDP--PPLGPPQTPGPEFPVPPSPSPPMPDTPNPPTPKTPPDVVPPIWEPPR 162 Query: 963 PP 968 PP Sbjct: 163 PP 164 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/53 (33%), Positives = 19/53 (35%), Gaps = 7/53 (13%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXP-PPXPPXPXPXXPXXPPPX------PPXPP 977 P PP + P P P PP P P P P PP PP PP Sbjct: 112 PSDPPPLGPPQTPGPEFPVPPSPSPPMPDTPNPPTPKTPPDVVPPIWEPPRPP 164 Score = 30.3 bits (65), Expect = 2.0 Identities = 20/62 (32%), Positives = 21/62 (33%), Gaps = 6/62 (9%) Frame = +1 Query: 811 QXPXXXPPXPPPPPP-XPXPXAXPPXGXXPXPXPP----XXPPXPPLXXXXXPPP-PPPX 972 + P P PPP P P P P PP PP P PP PP Sbjct: 103 ETPPEVTTVPSDPPPLGPPQTPGPEFPVPPSPSPPMPDTPNPPTPKTPPDVVPPIWEPPR 162 Query: 973 PP 978 PP Sbjct: 163 PP 164 Score = 29.9 bits (64), Expect = 2.7 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXP--XPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PP P P P PP PP P P PPP PP Sbjct: 131 PPSPSPPMPDTPNPPTPKTPPDVVPPIWEPPRPPDIFP--PESPPPGIDPPP 180 Score = 29.5 bits (63), Expect = 3.6 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P P P P P PP PP P P PP P PP Sbjct: 87 PLEVPELPNIPEISPSE-TPPEVTTVPSDPPPLGPPQTP--GPEFPVPPSPSPP 137 >At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative similar to SP|Q15427 Splicing factor 3B subunit 4 (Spliceosome associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA splicing factor SF3b 49 kDa subunit) {Homo sapiens}; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 363 Score = 39.5 bits (88), Expect = 0.003 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +1 Query: 802 SLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 S+ P P PPPPPP P P PP PPPPPP Sbjct: 245 SMQPVPIPAPRQPPPPPPQVYQTQPPSWPSQPQQHSMVPPPMQFRPPQGMPPPPPP 300 Score = 33.5 bits (73), Expect = 0.22 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 P P PPPP P P P P P PPPP P F Sbjct: 248 PVPIPAPRQPPPPPPQVYQTQPPSWPSQPQQHSMVPPPMQFRPPQGMPPPPPPQF 302 Score = 31.5 bits (68), Expect = 0.88 Identities = 17/60 (28%), Positives = 19/60 (31%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P A ++ P PPPPP PP PP P PP PP Sbjct: 240 PFANGSMQPVPIPAPRQPPPPPPQVYQTQPPSWPSQPQQHSMVPPPMQFRPPQGMPPPPP 299 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P P P A P P P PP PP PP P P Sbjct: 228 PSSAPQVNGLPRPFANGSMQPVPIPAPRQPPPPPPQVYQTQPPSWPSQP 276 Score = 28.3 bits (60), Expect = 8.2 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 3/49 (6%) Frame = +1 Query: 832 PXPPPPPPXPXPX---AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PPPPP PP PP P PPPPP Sbjct: 312 PRPPPPPQAMGMHQHGGWPPQHMQQQGGPPQQQQPPYQHHHMSMPPPPP 360 >At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin family protein contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 401 Score = 39.1 bits (87), Expect = 0.004 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PP PP P P P P P P P PP P + P PP P Sbjct: 295 PPSLPPIPLIPTPPTLPTIPLLPTPPTPTLPPIPTIPTLPPLPVLPPVP 343 Score = 37.5 bits (83), Expect = 0.013 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 1/58 (1%) Frame = +3 Query: 804 TLPTXXXXP-PXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 TLPT P P P PP PP P P PP P P P P PP P Sbjct: 309 TLPTIPLLPTPPTPTLPPIPTIPTLPPLPVLP-PVPIVNPPSLPPPPPSFPVPLPPVP 365 Score = 36.7 bits (81), Expect = 0.024 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXP--PLXXXXXPPPPPPXPP 978 P P PP P P P P P P PP P P PP PP PP Sbjct: 300 PIPLIPTPPTLPTIPLLPTPPTPTLPPIPTIPTLPPLPVLPPVPIVNPPSLPPPPP 355 Score = 36.7 bits (81), Expect = 0.024 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 3/52 (5%) Frame = +1 Query: 829 PPXPPPPP--PXPXPXAXPPXGXXPXPXP-PXXPPXPPLXXXXXPPPPPPXP 975 PP P P P P PP P P P PP P + PPPPP P Sbjct: 307 PPTLPTIPLLPTPPTPTLPPIPTIPTLPPLPVLPPVPIVNPPSLPPPPPSFP 358 Score = 36.7 bits (81), Expect = 0.024 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 4/54 (7%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXP--XPPXXPPXPPLXXXXXPPPP--PPXPP 978 PP P PP P P P P PP PP PP PP P P PP Sbjct: 319 PPTPTLPPIPTIPTLPPLPVLPPVPIVNPPSLPPPPPSFPVPLPPVPGLPGIPP 372 Score = 36.7 bits (81), Expect = 0.024 Identities = 23/62 (37%), Positives = 24/62 (38%), Gaps = 3/62 (4%) Frame = +1 Query: 805 LXQXPXXXPPXPPPPP---PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 L P PP PPPP P P P G P P P PP P + P PP P Sbjct: 339 LPPVPIVNPPSLPPPPPSFPVPLPPVPGLPGIPPVPLIPGIPPAPLI-----PGIPPLSP 393 Query: 976 PF 981 F Sbjct: 394 SF 395 Score = 36.3 bits (80), Expect = 0.031 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PP PP P P P P P PP+ PP P PP Sbjct: 288 PNPLIPSPPSLPPIPLIPTPPTLPTIPLLPTPPTPTLPPIPTIPTLPPLPVLPP 341 Score = 35.9 bits (79), Expect = 0.041 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 3/60 (5%) Frame = +3 Query: 804 TLPTXXXXP-PXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXP--PPXPPXP 974 T PT P P P PP P P PPP P P P P P PP P P Sbjct: 318 TPPTPTLPPIPTIPTLPPLPVLPPVPIVNPPSLPPPPPSFPVPLPPVPGLPGIPPVPLIP 377 Score = 35.9 bits (79), Expect = 0.041 Identities = 20/61 (32%), Positives = 21/61 (34%), Gaps = 1/61 (1%) Frame = +3 Query: 786 LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPP-XPXPXXPXXPPPX 962 LP + P PP PPPPP P P P P P P P PP Sbjct: 333 LPPLPVLPPVPIVNPPSLPPPPPSFPVPLPPVPGLPGIPPVPLIPGIPPAPLIPGIPPLS 392 Query: 963 P 965 P Sbjct: 393 P 393 Score = 34.7 bits (76), Expect = 0.095 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PP P P P PP P P P P PP+ PP P P Sbjct: 331 PTLPPLPVLPPVPIVNPP--SLPPPPPSFPVPLPPVPGLPGIPPVPLIP 377 Score = 34.3 bits (75), Expect = 0.13 Identities = 20/60 (33%), Positives = 21/60 (35%), Gaps = 7/60 (11%) Frame = +1 Query: 817 PXXXPPXP-----PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP--PPXP 975 P PP P P P P P P P P P P P + PP P PP P Sbjct: 269 PSIIPPNPLIPSIPTPTLPPNPLIPSPPSLPPIPLIPTPPTLPTIPLLPTPPTPTLPPIP 328 Score = 33.9 bits (74), Expect = 0.17 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +1 Query: 844 PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P P P PP P P P PP P L P P P P Sbjct: 181 PDPSFPPPLQDPP-NPSPLPNLPIVPPLPNLPVPKLPVPDLPLP 223 Score = 33.9 bits (74), Expect = 0.17 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXP-PXXP--PXPPLXXXXXPPPPPPXPP 978 P P PP P P P + PP P P P P P PP P P PP Sbjct: 279 PSIPTPTLPPNPLIPSPPSLPPIPLIPTPPTLPTIPLLPTPPTPTLPPIPTIPTLPP 335 Score = 33.5 bits (73), Expect = 0.22 Identities = 18/53 (33%), Positives = 20/53 (37%), Gaps = 4/53 (7%) Frame = +1 Query: 829 PPXPPPP----PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PP P P PP P + P P P P P PP+ PP P P Sbjct: 262 PPNPLNPPSIIPPNPLIPSIPTPTLPPNPLIPSPPSLPPIPLIPTPPTLPTIP 314 Score = 32.7 bits (71), Expect = 0.38 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 2/51 (3%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXP--PXXPPXPPLXXXXXPPPPPPXP 975 P PP P P P PP P P P P P PP+ PP P P Sbjct: 337 PVLPPVPIVNP-PSLPPPPPSFPVPLPPVPGLPGIPPVPLIPGIPPAPLIP 386 Score = 32.3 bits (70), Expect = 0.51 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +1 Query: 844 PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP--PXPP 978 PP P P PP P P PP P + PP P P PP Sbjct: 262 PPNPLNPPSIIPPNPLIPSIPTPTLPPNPLIPSPPSLPPIPLIPTPP 308 Score = 31.9 bits (69), Expect = 0.67 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Frame = +1 Query: 805 LXQXPXXXPPX--PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 L P PP PP P P P PP P P P PL PP P Sbjct: 179 LLPDPSFPPPLQDPPNPSPLPNLPIVPPLPNLPVPKLPVPDLPLPLVPPLLPPGP 233 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 3/52 (5%) Frame = +1 Query: 829 PPXPPP--PPPXPXPXAXPPXGXXPXPXPPXXP-PXPPLXXXXXPPPPPPXP 975 P PPP PP P P P P P P P P L PP PP P Sbjct: 183 PSFPPPLQDPPNPSPLPNLPI-VPPLPNLPVPKLPVPDLPLPLVPPLLPPGP 233 Score = 30.3 bits (65), Expect = 2.0 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 5/63 (7%) Frame = +1 Query: 805 LXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP-----PPP 969 L P PP P P P P P P P P P P L PP PP Sbjct: 291 LIPSPPSLPPIPLIPTPPTLP-TIPLLPTPPTPTLPPIPTIPTLPPLPVLPPVPIVNPPS 349 Query: 970 XPP 978 PP Sbjct: 350 LPP 352 Score = 29.5 bits (63), Expect = 3.6 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXP-XPXXPXXP--PPXPPXPP 977 PP PP P P P P PP P P P P PP P P Sbjct: 295 PPSLPPIPLIPTPPTLPTIPLLPTPPTPTLPPIPTIPTLPPLPVLPPVPIVNP 347 Score = 29.5 bits (63), Expect = 3.6 Identities = 22/63 (34%), Positives = 23/63 (36%), Gaps = 5/63 (7%) Frame = +3 Query: 804 TLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPP-PXPP--XPXPXXPXXPPP--XPP 968 T+PT P PP P PP P PP P P P P P PP P Sbjct: 329 TIPTLPPL-PVLPPVPIVNPPSLPPPPPSFPVPLPPVPGLPGIPPVPLIPGIPPAPLIPG 387 Query: 969 XPP 977 PP Sbjct: 388 IPP 390 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 2/47 (4%) Frame = +3 Query: 843 PPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXP--PXPP 977 PP P PP P PP P P PP P P PP Sbjct: 262 PPNPLNPPSIIPPNPLIPSIPTPTLPPNPLIPSPPSLPPIPLIPTPP 308 Score = 28.7 bits (61), Expect = 6.2 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXP--PPPPPXP 975 PP P P P P PP P P PP P+ P P PP P Sbjct: 325 PPIPTIPTLPPLP-VLPPVPIVNPPSLPPPPPSFPVPLPPVPGLPGIPPVP 374 >At5g14540.1 68418.m01704 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 547 Score = 39.1 bits (87), Expect = 0.004 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 3/56 (5%) Frame = +1 Query: 802 SLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXP---PXXPPXPPLXXXXXPPP 960 SL Q P PP P P P P P G P P PP PP PPP Sbjct: 322 SLHQPPYQPPPQQPQYPQQPPPQLQHPSGYNPEEPPYPQQSYPPNPPRQPPSHPPP 377 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PPP P PP P P PP P PP PP P Sbjct: 326 PPYQPPPQQPQYPQQPPPQLQHPSGYNPEEPPYPQQSYPPNPPRQPPSHP 375 Score = 37.9 bits (84), Expect = 0.010 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PPP + PP P PP P P PP PP P Sbjct: 326 PPYQPPPQQPQYPQQPPPQLQHPSGYNPEEPPYPQQSYPPNPPRQPPSHP 375 Score = 33.5 bits (73), Expect = 0.22 Identities = 18/59 (30%), Positives = 19/59 (32%) Frame = +1 Query: 799 YSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 +S Q P P PPP P PP PP PP PPP P Sbjct: 290 FSPQQEPYFPPSGQSQPPPTIQPPYQPPPPTQSLHQPPYQPPPQQPQYPQQPPPQLQHP 348 Score = 30.7 bits (66), Expect = 1.5 Identities = 24/93 (25%), Positives = 28/93 (30%) Frame = +3 Query: 696 SDHVRCPPPETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXXPPPPPXXXXXRX 875 S H PP +P S Q P + + P PP PP PP + Sbjct: 272 SQHGLSPPSLQLPQLPNQFSPQQEPY----FPPSGQSQPPPTIQPPYQPP-PPTQSLHQP 326 Query: 876 PPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P P P PP P PP P Sbjct: 327 PYQPPPQQPQYPQQPPPQLQHPSGYNPEEPPYP 359 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +1 Query: 829 PPXPP---PPPPXPXPXAXPPXGXXPXPXPPXXPPXPP 933 PP P PP P P + PP G P PP PP Sbjct: 356 PPYPQQSYPPNPPRQPPSHPPPGSAPSQQYYNAPPTPP 393 Score = 29.1 bits (62), Expect = 4.7 Identities = 21/68 (30%), Positives = 21/68 (30%), Gaps = 12/68 (17%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXP---XPXAXPPXGXXPXPXPP---------XXPPXPPLXXXXXP 954 Q P P PPPP P PP P P P PP P Sbjct: 305 QPPPTIQPPYQPPPPTQSLHQPPYQPPPQQPQYPQQPPPQLQHPSGYNPEEPPYPQQSYP 364 Query: 955 PPPPPXPP 978 P PP PP Sbjct: 365 PNPPRQPP 372 Score = 28.7 bits (61), Expect = 6.2 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXP---XPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P P PP G P PP PP P P PPP P Sbjct: 284 PQLPNQFSPQQEPY-FPPSGQSQPPPTIQPPYQPPPPTQSLHQPPYQPPPQQP 335 >At3g50140.1 68416.m05481 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 508 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPL 936 PPPPPP P PP P P PP P P L Sbjct: 10 PPPPPPPPRLLVLPPLPPPPPPPPPQLPFGPKL 42 Score = 37.5 bits (83), Expect = 0.013 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 900 PXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PPP PP P PPP PP PP Sbjct: 9 PPPPPPPPPRLLVLPPLPPPPPPPPP 34 Score = 36.3 bits (80), Expect = 0.031 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 2/26 (7%) Frame = +1 Query: 907 PPXXPPXPP--LXXXXXPPPPPPXPP 978 PP PP PP L PPPPPP PP Sbjct: 9 PPPPPPPPPRLLVLPPLPPPPPPPPP 34 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/53 (35%), Positives = 21/53 (39%) Frame = +3 Query: 801 LTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP 959 + P+ PP PPPP PP P PPP PP P P P P Sbjct: 1 MATPSKRRPPPPPPPPPRLLV---LPP-----LPPPPPPPPPQLPFGPKLPFP 45 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 895 PXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PP PP PP PPP PP Sbjct: 4 PSKRRPPPPPPPPPRLLVLPPLPPPPPP 31 Score = 32.7 bits (71), Expect = 0.38 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +1 Query: 895 PXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 P P PP PPL PPPPPP PF Sbjct: 12 PPPPPPRLLVLPPLPPP--PPPPPPQLPF 38 Score = 32.3 bits (70), Expect = 0.51 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 2/28 (7%) Frame = +3 Query: 900 PXPPPXPPX--PXPXXPXXPPPXPPXPP 977 P PPP PP P P PPP PP P Sbjct: 10 PPPPPPPPRLLVLPPLPPPPPPPPPQLP 37 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 880 PXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P P P PP P L PPPPPP Sbjct: 4 PSKRRPPPPPPPPPRLLVLPPLPPPPPPPP 33 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = +3 Query: 795 AXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXP 935 A +T P P PPPPP PP P PPP PP P Sbjct: 11 AVVTPPMRGRVPLPPPPPPPMRRSAPSPPPMSGRVPPPPPPPPMFDP 57 Score = 37.9 bits (84), Expect = 0.010 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 5/40 (12%) Frame = +1 Query: 877 PPXGXXPXPXPPXXP-----PXPPLXXXXXPPPPPPXPPF 981 P G P P PP P P PP PPPPPP P F Sbjct: 16 PMRGRVPLPPPPPPPMRRSAPSPPPMSGRVPPPPPPPPMF 55 Score = 32.3 bits (70), Expect = 0.51 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PPP P P P PP PP PPPPPP P Sbjct: 614 PAVNPPPRLVCGPYPLPRLVRVGSPSPP-----PPSMSGGAPPPPPPPP 657 Score = 31.9 bits (69), Expect = 0.67 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 12/62 (19%) Frame = +1 Query: 829 PPXPPPPPPXPX------PXAXPPXGXX--PXPXPPXX----PPXPPLXXXXXPPPPPPX 972 PP P PP P P PP P P P P PP PPPPP Sbjct: 596 PPSIPRPPSRPRYACCRIPAVNPPPRLVCGPYPLPRLVRVGSPSPPPPSMSGGAPPPPPP 655 Query: 973 PP 978 PP Sbjct: 656 PP 657 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 5/38 (13%) Frame = +3 Query: 879 PXXXXXXPXPPPXPPXPXPXXPXXPP-----PXPPXPP 977 P P PPP PP P PP P PP PP Sbjct: 15 PPMRGRVPLPPPPPPPMRRSAPSPPPMSGRVPPPPPPP 52 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PPPPPP P P P P PP PPPPP P Sbjct: 22 PLPPPPPP-------PMRRSAPSPPPMSGRVPPP------PPPPPMFDP 57 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +1 Query: 910 PXXPPXPPLXXXXXPPPPPPXPPF 981 P PP PP+ PPPPP F Sbjct: 148 PLPPPPPPMPRRSPPPPPPRFDAF 171 Score = 29.1 bits (62), Expect = 4.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPP 882 P PPPPPP P PP Sbjct: 148 PLPPPPPPMPRRSPPPP 164 Score = 28.3 bits (60), Expect = 8.2 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 900 PXPPPXPPXPXPXXPXXPP 956 P PPP PP P P PP Sbjct: 148 PLPPPPPPMPRRSPPPPPP 166 Score = 28.3 bits (60), Expect = 8.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 901 PXPPXXPPXPPLXXXXXPPPPPP 969 P PP PP P PPPPPP Sbjct: 148 PLPPPPPPMP----RRSPPPPPP 166 Score = 28.3 bits (60), Expect = 8.2 Identities = 18/61 (29%), Positives = 20/61 (32%), Gaps = 6/61 (9%) Frame = +1 Query: 799 YSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPX------PPXXPPXPPLXXXXXPPP 960 Y+ + P PP P P P P P PP PP P L PP Sbjct: 608 YACCRIPAVNPPPRLVCGPYPLPRLVRVGSPSPPPPSMSGGAPPPPPPPPMLVASRTAPP 667 Query: 961 P 963 P Sbjct: 668 P 668 >At4g13390.1 68417.m02092 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 429 Score = 38.7 bits (86), Expect = 0.006 Identities = 23/71 (32%), Positives = 26/71 (36%), Gaps = 9/71 (12%) Frame = +1 Query: 796 LYSLXQXPXXXPPXP-----PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP 960 +YS P P P PPPP PP P PP P P + PPP Sbjct: 310 VYSSPPPPTYYSPSPRVDYKSPPPPYVYNSLPPPYVYNSPPPPPYYSPSPTVNYKSPPPP 369 Query: 961 ----PPPXPPF 981 PP PP+ Sbjct: 370 YVYNSPPPPPY 380 Score = 37.1 bits (82), Expect = 0.018 Identities = 22/71 (30%), Positives = 25/71 (35%), Gaps = 9/71 (12%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPP-----PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP 960 +Y+ P P P PPPP PP P P P PP PPP Sbjct: 284 IYNSPPPPSYYSPSPKIDYKSPPPPYVYSSPPPPTYYSPSPRVDYKSPPPPYVYNSLPPP 343 Query: 961 ----PPPXPPF 981 PP PP+ Sbjct: 344 YVYNSPPPPPY 354 Score = 36.7 bits (81), Expect = 0.024 Identities = 22/71 (30%), Positives = 26/71 (36%), Gaps = 9/71 (12%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXA-----XPPXGXXPXPXPPXXPPXPPLXXXXXPPP 960 +Y+ P PPPP P P PP P PP P P + PPP Sbjct: 146 IYNSPPPPYIYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPP 205 Query: 961 P----PPXPPF 981 PP PP+ Sbjct: 206 YVYSFPPPPPY 216 Score = 35.5 bits (78), Expect = 0.054 Identities = 20/64 (31%), Positives = 22/64 (34%), Gaps = 3/64 (4%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPP---PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 +YS P P P PP P + PP P P PP PPPP Sbjct: 207 VYSFPPPPPYYSPSPKVGYKSPPAPYVYSSPPPPPYYSPSPKVNYKSPPPPYVYSSPPPP 266 Query: 967 PXPP 978 P P Sbjct: 267 PYSP 270 Score = 35.1 bits (77), Expect = 0.072 Identities = 20/58 (34%), Positives = 22/58 (37%), Gaps = 7/58 (12%) Frame = +1 Query: 829 PPXPPPPPPXP---XPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP----PPPXPPF 981 PP PP P P PP P PP P P + PPP PP PP+ Sbjct: 349 PPPPPYYSPSPTVNYKSPPPPYVYNSPPPPPYYSPFPKVEYKSPPPPYIYNSPPPPPY 406 Score = 34.7 bits (76), Expect = 0.095 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PPP P P PPP P PP Sbjct: 239 PPPYYSPSPKVNYKSPPPPYVYSSPPPPPYSPSPKVEFKSPPPPYIYNSPPPP 291 Score = 33.9 bits (74), Expect = 0.17 Identities = 20/57 (35%), Positives = 22/57 (38%), Gaps = 9/57 (15%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP-----PPXPPF 981 PPPPP P P + PP P PP P PPPP PP P + Sbjct: 263 PPPPPYSPSPKVEFKSPPPPYIYNSPPPPSYYSPSPKIDYKSPPPPYVYSSPPPPTY 319 Score = 33.5 bits (73), Expect = 0.22 Identities = 19/61 (31%), Positives = 21/61 (34%), Gaps = 3/61 (4%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPP---PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 +YS P P P PP P + PP P P PP PPPP Sbjct: 181 VYSSPPPPPYYSPSPKVEYKSPPPPYVYSFPPPPPYYSPSPKVGYKSPPAPYVYSSPPPP 240 Query: 967 P 969 P Sbjct: 241 P 241 Score = 33.5 bits (73), Expect = 0.22 Identities = 23/66 (34%), Positives = 26/66 (39%), Gaps = 15/66 (22%) Frame = +1 Query: 829 PPXP-----PPPPPX--PXP----XAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP----P 963 PP P PPPPP P P + PP P PP P P + PPP Sbjct: 228 PPAPYVYSSPPPPPYYSPSPKVNYKSPPPPYVYSSPPPPPYSPSPKVEFKSPPPPYIYNS 287 Query: 964 PPXPPF 981 PP P + Sbjct: 288 PPPPSY 293 Score = 32.7 bits (71), Expect = 0.38 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 812 NXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 N PPP P P P PPP PP P P PP P Sbjct: 347 NSPPPPPYYSPSP--TVNYKSPPPPYVYNSPPPPPYYSPFPKVEYKSPPPP 395 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/59 (30%), Positives = 19/59 (32%), Gaps = 5/59 (8%) Frame = +1 Query: 799 YSLXQXPXXXPPXPPPPPPXPXPXAX-----PPXGXXPXPXPPXXPPXPPLXXXXXPPP 960 Y P PPPP P P PP P PP P P + PPP Sbjct: 363 YKSPPPPYVYNSPPPPPYYSPFPKVEYKSPPPPYIYNSPPPPPYYSPSPKITYKSPPPP 421 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/61 (29%), Positives = 19/61 (31%), Gaps = 5/61 (8%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXP-----PXP 974 P PP P P + PP PPP P P PP P P P Sbjct: 257 PYVYSSPPPPPYSPSPKVEFKSPPPPYIYNSPPPPSYYSPSPKIDYKSPPPPYVYSSPPP 316 Query: 975 P 977 P Sbjct: 317 P 317 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 844 PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 PPPP P P P P PP PPPP Sbjct: 124 PPPPYVYSSLPPLTYYSPSPKVIYNSPPPPYIYSSPPPPP 163 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP 958 PP P P P PPP PP P P PP Sbjct: 237 PPPPPYYSPSPKVNYKSPPPPYVYSSPPPPPYSPSPKVEFKSPPPP 282 Score = 29.1 bits (62), Expect = 4.7 Identities = 23/77 (29%), Positives = 26/77 (33%), Gaps = 15/77 (19%) Frame = +1 Query: 796 LYSLXQXPXXXPPXP------PPPP-----PXPXPXAXPPXGXXPXPXPPXXPPXPPLXX 942 +YS P P P PPPP P P P + P P PP PP Sbjct: 233 VYSSPPPPPYYSPSPKVNYKSPPPPYVYSSPPPPPYSPSPKVEFKSPPPPYIYNSPPPPS 292 Query: 943 XXXPPP----PPPXPPF 981 P P P PP+ Sbjct: 293 YYSPSPKIDYKSPPPPY 309 >At3g44340.1 68416.m04764 sec23/sec24 transport family protein contains Pfam domains PF04811: Sec23/Sec24 trunk domain, PF04815: Sec23/Sec24 helical domain and PF04810: Sec23/Sec24 zinc finger Length = 1096 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PPPP P P PP G P P P P PPPP Sbjct: 48 PPPPMPGSGPRPSPPFGQSPQSFPQQQQQQPRPSPMARPGPPPP 91 Score = 35.9 bits (79), Expect = 0.041 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PPPP P A P G P PP PP P PP P Sbjct: 244 PMMAPPPPYGQPPNAGPFTGNSPLSSPPAHSIPPPTNFPGVPYGRPPMP 292 >At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to auxin down regulated GB:X69640 GI:296442 from [Glycine max]; contains Pfam profile PF00234: Protease inhibitor/seed storage/LTP family Length = 297 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP 958 PP PPP RPPP P PP P P + P PP Sbjct: 101 PPPIIRPPPVVYPPPIVRPPPITRPPIIIPPIQPPPVTTPPGLLPP 146 Score = 38.3 bits (85), Expect = 0.008 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 G GGGGG GG GG P GG G GGGGG GG Sbjct: 44 GGGGGGGSKPPPHHGGKGGGK------PPPHGGKGGGPPHHGGGGGGGG 86 Score = 33.5 bits (73), Expect = 0.22 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXP-PXPPLXXXXXPPPPPPXPP 978 PPP P P PP P P P PP+ PPP PP Sbjct: 94 PPPVVVRPPPIIRPPPVVYPPPIVRPPPITRPPIIIPPIQPPPVTTPP 141 Score = 33.5 bits (73), Expect = 0.22 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 5/59 (8%) Frame = +1 Query: 817 PXXXPPXPPPPPPX--PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP---PPPPXPP 978 P PP PPP P P PP P PP P L PP PP PP Sbjct: 103 PIIRPPPVVYPPPIVRPPPITRPPIIIPPIQPPPVTTPPGLLPPITTPPGLLPPVTTPP 161 Score = 32.7 bits (71), Expect = 0.38 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP P P PP P PP P L PPP PP Sbjct: 136 PVTTPPGLLPPITTP-PGLLPPVTTPPGLLPPVTTPPGLLPPIINPPPVTVPPP 188 Score = 31.9 bits (69), Expect = 0.67 Identities = 20/55 (36%), Positives = 22/55 (40%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 P PP PP P P PP P PP P PP+ PPP PP+ Sbjct: 146 PITTPPGLLPPVTTP-PGLLPPVTTPPGLLPPIINP-PPVTV---PPPSSGYPPY 195 Score = 31.5 bits (68), Expect = 0.88 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 3/61 (4%) Frame = +1 Query: 805 LXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP---PPPPXP 975 + + P PP PPP P PP P PP P L PP PP P Sbjct: 122 ITRPPIIIPPIQPPPVT-TPPGLLPPITTPPGLLPPVTTPPGLLPPVTTPPGLLPPIINP 180 Query: 976 P 978 P Sbjct: 181 P 181 Score = 31.5 bits (68), Expect = 0.88 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 4/58 (6%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP-XXPP---XPPLXXXXXPPPPPPXPP 978 P PP PP P PP P PP PP P L PPP PP Sbjct: 130 PPIQPPPVTTPPGLLPPITTPPGLLPPVTTPPGLLPPVTTPPGLLPPIINPPPVTVPP 187 Score = 29.5 bits (63), Expect = 3.6 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 5/55 (9%) Frame = +1 Query: 829 PPXPPPPP-PXPXPXA-XPPXGXXPXPXPPXXPPXPPLXXXXXPP---PPPPXPP 978 PP PPP P P PP P PP PP PP PP PP Sbjct: 102 PPIIRPPPVVYPPPIVRPPPITRPPIIIPPIQPPPVTTPPGLLPPITTPPGLLPP 156 Score = 29.1 bits (62), Expect = 4.7 Identities = 15/46 (32%), Positives = 16/46 (34%), Gaps = 3/46 (6%) Frame = +2 Query: 830 PXXPPP---PPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP 958 P PPP PP PP P PP P + P PP Sbjct: 131 PIQPPPVTTPPGLLPPITTPPGLLPPVTTPPGLLPPVTTPPGLLPP 176 Score = 28.7 bits (61), Expect = 6.2 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PP PP P P PP P PP PP PP PP Sbjct: 151 PGLLPPVTTPPGLLP-PVTTPPGLLPPIINPPPVTVPPP--SSGYPPYGPP 198 >At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putative similar to glycine-rich RNA-binding protein from {Sorghum bicolor} SP|Q99070, GI:1778373 from [Pisum sativum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 155 Score = 38.7 bits (86), Expect = 0.006 Identities = 23/47 (48%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGG-GGGGXG 831 GGGGGG RGG GG GG G G G GG GGGG G Sbjct: 115 GGGGGGGGFARRGGYGGGRGGYARG---------GFGRGGFGGGGYG 152 >At1g04800.1 68414.m00476 glycine-rich protein Length = 200 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GG GG GG GG G G G GG G G G G GG G Sbjct: 73 GWIGGSVGGFGGGIGGGFGGGGFGGGAGKGVDGGFGKGVDGGAGKGVDGGAGKG 126 Score = 37.9 bits (84), Expect = 0.010 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGG-GGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGG GGG GG G G G GG G G G G GG G Sbjct: 80 GGFGGGIGGGFGGGGFGGGAGKGVDGGFGKGVDGGAGKGVDGGAGKGFDGGVGKG 134 Score = 37.5 bits (83), Expect = 0.013 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGG-XGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GG GG GG GG GG G GG G G GG GGG G G Sbjct: 57 GGGGGISGGGGFGAGGGWIGGSVGGFG------GGIGGGFGGGGFGGGAGKGVDG 105 Score = 37.1 bits (82), Expect = 0.018 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG GGG G G G GG GGG G GG G G G GG Sbjct: 77 GSVGGFGGGIGG--GFGGGGFGGGAG--KGVDGGFGKGVDGGAGKGVDGG 122 Score = 36.3 bits (80), Expect = 0.031 Identities = 23/55 (41%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGG-GGGGXGGXXXG 816 G GGGGG G GG GG G GG G G GG GGG G G Sbjct: 54 GDLGGGGGISGGGGFGAGGGWIGGSVGGFG--GGIGGGFGGGGFGGGAGKGVDGG 106 Score = 35.9 bits (79), Expect = 0.041 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 6/56 (10%) Frame = -3 Query: 977 GGXGGGGG---GXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXG---GGGGGXGG 828 GG G GGG G GG GG GG G G G G G G G G G G Sbjct: 66 GGFGAGGGWIGGSVGGFGGGIGGGFGGGGFGGGAGKGVDGGFGKGVDGGAGKGVDG 121 Score = 33.1 bits (72), Expect = 0.29 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = -1 Query: 973 GXGGXGGGXXGXXGXGXGG--XGGGXGXXXXXXGGXRXXXXXGGGGG 839 G G GGG G G G GG GG G GG GGG G Sbjct: 54 GDLGGGGGISGGGGFGAGGGWIGGSVGGFGGGIGGGFGGGGFGGGAG 100 Score = 31.5 bits (68), Expect = 0.88 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 7/53 (13%) Frame = -3 Query: 977 GGXGGGG--GGXXXXXRGGXG-GXXGGXGXGXXPXGGXAX----GXGXGGGGG 840 GG GGGG GG GG G G GG G G G G G GG G Sbjct: 88 GGFGGGGFGGGAGKGVDGGFGKGVDGGAGKGVDGGAGKGFDGGVGKGVDGGAG 140 Score = 29.9 bits (64), Expect = 2.7 Identities = 24/53 (45%), Positives = 24/53 (45%), Gaps = 3/53 (5%) Frame = -3 Query: 977 GGXGGG-GGGXXXXXRGGXG-GXXGGXGXGXXPXGGXAXGXGXGGGG-GGXGG 828 GG G G GG GG G G GG G G GG G G GG GG GG Sbjct: 137 GGAGKGFDGGVGKGFEGGIGKGIEGGVGKGFD--GGA--GKGVDGGAIGGIGG 185 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXG 899 G G G GG G G GG GGG G Sbjct: 161 GGVGKGFDGGAGKGVDGGAIGGIGGGAG 188 >At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family protein Common family members: At5g26070, At5g19800, At1g72790 [Arabidopsis thaliana] Length = 575 Score = 36.7 bits (81), Expect = 0.024 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXPXPXAXPP 882 Q P PP PPPPPP P A PP Sbjct: 295 QPPPSPPPPPPPPPPQPLIAATPP 318 Score = 36.7 bits (81), Expect = 0.024 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PP PPPPPP P P + PPPPPP Sbjct: 382 PPSPPPPPPPPPPPLRSSQSVFYGLFKKGVKSNKKIHSVPAPPPPPP 428 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 919 PPXPPLXXXXXPPPPPPXPP 978 P PP PPPPPP PP Sbjct: 241 PSSPPQQPPATPPPPPPPPP 260 Score = 31.1 bits (67), Expect(2) = 0.008 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXP 879 P PP PPPPP P P P Sbjct: 244 PPQQPPATPPPPPPPPPVEVP 264 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 7/63 (11%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXPXPX-------AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 Q P PP PPPPPP P + PPPPPP Sbjct: 246 QQPPATPPPPPPPPPVEVPQKPRRTHRSVRNRDLQENAKRSETKFKRTFQPPPSPPPPPP 305 Query: 970 XPP 978 PP Sbjct: 306 PPP 308 Score = 31.1 bits (67), Expect = 1.2 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 10/61 (16%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPX----GXXPXPXPPXX------PPXPPLXXXXXPPPPPPXPP 978 PP PPPP PP G P P P PL PPPPP PP Sbjct: 423 PPPPPPPRYTQFDPQTPPRRVKSGRPPRPTKPKNFNEENNGQGSPLIQIT--PPPPPPPP 480 Query: 979 F 981 F Sbjct: 481 F 481 Score = 30.3 bits (65), Expect = 2.0 Identities = 21/65 (32%), Positives = 22/65 (33%), Gaps = 10/65 (15%) Frame = +1 Query: 802 SLXQXPXXXPPXPPPPPPXPXPXA----------XPPXGXXPXPXPPXXPPXPPLXXXXX 951 SL P PP PPPPPP + P PP PP PP Sbjct: 378 SLIPPPSPPPPPPPPPPPLRSSQSVFYGLFKKGVKSNKKIHSVPAPP--PPPPPRYTQFD 435 Query: 952 PPPPP 966 P PP Sbjct: 436 PQTPP 440 Score = 30.3 bits (65), Expect = 2.0 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 12/59 (20%) Frame = +1 Query: 829 PPXPPPPPP------XPXPXAXPPXGXXPXPXPP------XXPPXPPLXXXXXPPPPPP 969 P PPPPPP P G P P P PL PPPPPP Sbjct: 421 PAPPPPPPPRYTQFDPQTPPRRVKSGRPPRPTKPKNFNEENNGQGSPLIQITPPPPPPP 479 Score = 28.7 bits (61), Expect = 6.2 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 900 PXPPPXPPXPXPXXPXXPP 956 P PPP PP P P PP Sbjct: 300 PPPPPPPPPPQPLIAATPP 318 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +1 Query: 919 PPXPPLXXXXXPPPPPPXPP 978 PP PP PPPPPP PP Sbjct: 382 PPSPP------PPPPPPPPP 395 Score = 28.3 bits (60), Expect = 8.2 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 909 PPXPPXPXPXXPXXPPPXPP 968 P PP P P PPP PP Sbjct: 241 PSSPPQQPPATPPPPPPPPP 260 Score = 28.3 bits (60), Expect = 8.2 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 918 PPXPXPXXPXXPPPXPPXPP 977 P P P PPP PP PP Sbjct: 241 PSSPPQQPPATPPPPPPPPP 260 Score = 26.2 bits (55), Expect(2) = 0.008 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = +1 Query: 895 PXPXPPXXPPXPPLXXXXXPPPP 963 P P PP PP PP PP Sbjct: 296 PPPSPPPPPPPPPPQPLIAATPP 318 >At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibrillarin 2 GI:9965655 from [Arabidopsis thaliana] Length = 320 Score = 38.3 bits (85), Expect = 0.008 Identities = 25/55 (45%), Positives = 25/55 (45%), Gaps = 5/55 (9%) Frame = -3 Query: 977 GGXGGGG--GGXXXXXRGGXGG--XXGGXGXG-XXPXGGXAXGXGXGGGGGGXGG 828 GG G GG GG RGG G GG G G P GG G G G GG GG Sbjct: 23 GGRGDGGFSGGRGGGGRGGGRGFSDRGGRGRGRGPPRGGARGGRGPAGRGGMKGG 77 Score = 35.1 bits (77), Expect = 0.072 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GG G G RGG GG GG G G G GG GG G G Sbjct: 20 GYSGGRGDGGFSGGRGG-GGRGGGRGFSDRGGRGRGRGPPRGGARGGRGPAGRG 72 Score = 32.7 bits (71), Expect = 0.38 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXG 830 G GG G G G G GG GGG G G GG G G Sbjct: 17 GRGGYSGGRGDGGFSGGRGGGGRGGGRGFSDRGGRGRGRGPPRGGARGGRG 67 Score = 32.3 bits (70), Expect = 0.51 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 G GGG RGG G G GG + G G GG GGG G Sbjct: 7 GSGGGFSGGRGRGGYSGGRG--------DGGFSGGRGGGGRGGGRG 44 Score = 29.5 bits (63), Expect = 3.6 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 964 GXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXG 830 G GGG G G G GG GG G GG GG GG G Sbjct: 7 GSGGGFSG--GRGRGGYSGGRG-----DGGFSGGRGGGGRGGGRG 44 >At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containing protein similar to Hsc70-interacting protein (Hip) from {Homo sapiens} SP|P50502, {Rattus norvegicus} SP|P50503; contains Pfam profile PF00515: tetratricopeptide repeat (TPR) domain Length = 441 Score = 38.3 bits (85), Expect = 0.008 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 G GG GGG GG G GG G G G G GGGG GG Sbjct: 333 GFPGGMGGGMPAGMGGGMPGMGGGMPAGMGGGGMPGAGGGMPGGGGMPGG 382 Score = 35.1 bits (77), Expect = 0.072 Identities = 22/53 (41%), Positives = 22/53 (41%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG GG G G G G GG G GG G GGG G GGG Sbjct: 308 GFPGGMGGMPGGFPG-GMGGMGGMPGGFP---GGMGGGMPAGMGGGMPGMGGG 356 Score = 31.9 bits (69), Expect = 0.67 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXG-GGGGXXGXGGG 817 G GG GG G G GG G G G GGGG G GGG Sbjct: 319 GFPGGMGGMGGMPGGFPGGMGGGMPAGMGGGMPGMGGGMPAGMGGGGMPGAGGG 372 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Frame = -2 Query: 975 GXXGGX-GGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG GG G G G GG G GG GGG G GGG Sbjct: 296 GMPGGFPGGMPGGFPGGMGGMPGGFPGGMGGMGGMPGGFPGGMGGGMPAGMGGG 349 Score = 28.3 bits (60), Expect = 8.2 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G G GGG G G G GGG GG GGGG GG Sbjct: 339 GGGMPAGMGGGMPGMGGGMPAGMGGG---GMPGAGGGMP-----GGGGMPGG 382 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/48 (37%), Positives = 19/48 (39%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP 960 P PP P PP P P PP P P P PP P+ P P Sbjct: 58 PMMTPPPMPMTPP-PMPMTPPPMPMAPPPMPMASPPMMPMTPSTSPSP 104 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = +1 Query: 817 PXXXPPXPPPPP--PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P PPP P P P P A PP P P P P P PP P Sbjct: 62 PPPMPMTPPPMPMTPPPMPMAPPPMPMASPPMMPMTPSTSPSPLTVPDMPSPPMP 116 Score = 35.1 bits (77), Expect = 0.072 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PPP P P PP P P PP P+ P PP P Sbjct: 50 PPPVMSPMPMMTPPPMPMTPPPMPMTPPPMPMAPPPMPMASPPMMP 95 Score = 34.7 bits (76), Expect = 0.095 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P P PP P P PP P P P PP P P P P Sbjct: 51 PPVMSPMPMMTPP-PMPMTPPPMPMTPPPMPMAPPPMPMASPPMMPMTPSTSP 102 Score = 33.5 bits (73), Expect = 0.22 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +3 Query: 843 PPPPXXXXXRXPPXXXXXXPX--PPPXPPXPXPXXPXXPPPXPPXPP 977 PP PP P PPP P P P P PPP P PP Sbjct: 39 PPMSSGGGSSVPPPVMSPMPMMTPPPMPMTPPPM-PMTPPPMPMAPP 84 Score = 32.3 bits (70), Expect = 0.51 Identities = 22/64 (34%), Positives = 24/64 (37%), Gaps = 4/64 (6%) Frame = +1 Query: 799 YSLXQXPXXXPPXPPPPPPXPXPX--AXPPXGXXPXPX--PPXXPPXPPLXXXXXPPPPP 966 +SL Q P P PP + PP P P PP P PP PPP P Sbjct: 22 FSLAQAPMMAPSGSMSMPPMSSGGGSSVPPPVMSPMPMMTPPPMPMTPP-PMPMTPPPMP 80 Query: 967 PXPP 978 PP Sbjct: 81 MAPP 84 Score = 31.9 bits (69), Expect = 0.67 Identities = 17/55 (30%), Positives = 18/55 (32%), Gaps = 1/55 (1%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP-PXPP 978 P P PPP P P P P P PP+ P P P PP Sbjct: 76 PPPMPMAPPPMPMASPPMMPMTPSTSPSPLTVPDMPSPPMPSGMESSPSPGPMPP 130 Score = 30.3 bits (65), Expect = 2.0 Identities = 20/68 (29%), Positives = 21/68 (30%), Gaps = 5/68 (7%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXP--PXXXXXXPXP---PPXPPXPXPXXPXXP 953 P +T P PP P PP P P P P P P P P Sbjct: 63 PPMPMTPPPMPMTPPPMPMAPPPMPMASPPMMPMTPSTSPSPLTVPDMPSPPMPSGMESS 122 Query: 954 PPXPPXPP 977 P P PP Sbjct: 123 PSPGPMPP 130 Score = 29.9 bits (64), Expect = 2.7 Identities = 17/64 (26%), Positives = 20/64 (31%), Gaps = 1/64 (1%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXX-PPPXP 965 P +++P PPP P P P P P P P P P P Sbjct: 32 PSGSMSMPPMSSGGGSSVPPPVMSPMPMMTPPPMPMTPPPMPMTPPPMPMAPPPMPMASP 91 Query: 966 PXPP 977 P P Sbjct: 92 PMMP 95 Score = 29.1 bits (62), Expect = 4.7 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 PP P P P PPP P P P PP P P Sbjct: 50 PPPVMSPMPMMTPPPMPMTPPPMPMTPPPMPMAPPPMPMASPPMMPMTP 98 Score = 29.1 bits (62), Expect = 4.7 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 1/63 (1%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPP-PXP 965 P +T P PP P PP PP P P P P P P P Sbjct: 56 PMPMMTPPPMPMTPPPMPMTPP--PMPMAPPPMPMASPPMMPMTPSTSPSPLTVPDMPSP 113 Query: 966 PXP 974 P P Sbjct: 114 PMP 116 >At4g08380.1 68417.m01384 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 437 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/54 (37%), Positives = 23/54 (42%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 ++ + PPP P PPP PPP P PP P P PS PP P Sbjct: 387 YAYSPPPPCPDVYKPPP--YVYSSPPPYVYNP---PPSSPPPSPSYSYSSPPPP 435 Score = 33.9 bits (74), Expect = 0.17 Identities = 21/65 (32%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Frame = +1 Query: 790 LXLYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP---P 960 L LY++ P PP PP P + PP P P PP PP Sbjct: 15 LALYAVAAHTSAQYPYSPPSPP-PYVYSSPPPYTYSPPPSPYVYKSPPYVYSSPPPYAYS 73 Query: 961 PPPXP 975 PPP P Sbjct: 74 PPPSP 78 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXP 965 PP PPP + PP PPP P P PPP P Sbjct: 354 PPYAYSPPPSPYVYKSPP---YVYSSPPPYTYSPPPYAYSPPPPCP 396 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 3/51 (5%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPX---PXPPXXPPXPPLXXXXXPPPPPPXPPF 981 PPP P P A P P P P PP P PPP P + Sbjct: 377 PPPYTYSPPPYAYSPPPPCPDVYKPPPYVYSSPPPYVYNPPPSSPPPSPSY 427 Score = 29.9 bits (64), Expect = 2.7 Identities = 25/73 (34%), Positives = 25/73 (34%), Gaps = 14/73 (19%) Frame = +1 Query: 799 YSLXQXPXXXPPXPPP----PPPXPXPXAXPP-XGXXPXPXPPXXPPXP-----PLXXXX 948 YS P PPP PPP P PP P P PP P P Sbjct: 30 YSPPSPPPYVYSSPPPYTYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYS 89 Query: 949 XPPP----PPPXP 975 PPP PPP P Sbjct: 90 SPPPYAYSPPPSP 102 Score = 29.5 bits (63), Expect = 3.6 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 10/59 (16%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPP-XGXXPXPXPPXXPPXP-----PLXXXXXPPP----PPPXP 975 PP PPP P PP P P PP P P PPP PPP P Sbjct: 68 PPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSP 126 Score = 29.5 bits (63), Expect = 3.6 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 10/59 (16%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPP-XGXXPXPXPPXXPPXP-----PLXXXXXPPP----PPPXP 975 PP PPP P PP P P PP P P PPP PPP P Sbjct: 210 PPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSP 268 Score = 29.5 bits (63), Expect = 3.6 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 10/59 (16%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPP-XGXXPXPXPPXXPPXP-----PLXXXXXPPP----PPPXP 975 PP PPP P PP P P PP P P PPP PPP P Sbjct: 234 PPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSP 292 Score = 29.5 bits (63), Expect = 3.6 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 10/59 (16%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPP-XGXXPXPXPPXXPPXP-----PLXXXXXPPP----PPPXP 975 PP PPP P PP P P PP P P PPP PPP P Sbjct: 258 PPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSP 316 Score = 29.5 bits (63), Expect = 3.6 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 10/59 (16%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPP-XGXXPXPXPPXXPPXP-----PLXXXXXPPP----PPPXP 975 PP PPP P PP P P PP P P PPP PPP P Sbjct: 282 PPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSP 340 Score = 29.5 bits (63), Expect = 3.6 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 10/59 (16%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPP-XGXXPXPXPPXXPPXP-----PLXXXXXPPP----PPPXP 975 PP PPP P PP P P PP P P PPP PPP P Sbjct: 306 PPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSP 364 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PPP + PP PPP P PPP PP Sbjct: 116 PPYAYSPPPSPYVYKSPP---YVYSSPPPYVYSSPPPYAYSPPPYAYSPP 162 Score = 29.1 bits (62), Expect = 4.7 Identities = 17/56 (30%), Positives = 18/56 (32%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PPP + PP P P P P P PP PP Sbjct: 149 PYAYSPPPYAYSPPPSPYVYKSPP-YVYSSPPPYAYSPPPSPYVYKSPPYVYSSPP 203 Score = 29.1 bits (62), Expect = 4.7 Identities = 17/56 (30%), Positives = 18/56 (32%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP PPP + PP P P P P P PP PP Sbjct: 204 PYAYSPPPYAYSPPPSPYVYKSPP-YVYSSPPPYAYSPPPSPYVYKSPPYVYSSPP 258 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PPP + PP P P P P P PP PP Sbjct: 68 PPYAYSPPPSPYVYKSPP-YVYSSPPPYAYSPPPSPYVYKSPPYVYSSPP 116 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/51 (29%), Positives = 16/51 (31%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 PP PPP P PP P PP P P PP+ Sbjct: 92 PPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPY 142 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PPP + PP P P P P P PP PP Sbjct: 92 PPYAYSPPPSPYVYKSPP-YVYSSPPPYAYSPPPSPYVYKSPPYVYSSPP 140 Score = 28.7 bits (61), Expect = 6.2 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 3/52 (5%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP---PPPPXP 975 PP PPP P PP P PP PP PP PPP P Sbjct: 116 PPYAYSPPPSPYVYKSPPY-VYSSP-PPYVYSSPPPYAYSPPPYAYSPPPSP 165 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/51 (29%), Positives = 16/51 (31%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 PP PPP P PP P PP P P PP+ Sbjct: 155 PPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPY 205 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PPP + PP P P P P P PP PP Sbjct: 234 PPYAYSPPPSPYVYKSPP-YVYSSPPPYAYSPPPSPYVYKSPPYVYSSPP 282 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PPP + PP P P P P P PP PP Sbjct: 258 PPYAYSPPPSPYVYKSPP-YVYSSPPPYAYSPPPSPYVYKSPPYVYSSPP 306 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PPP + PP P P P P P PP PP Sbjct: 282 PPYAYSPPPSPYVYKSPP-YVYSSPPPYAYSPPPSPYVYKSPPYVYSSPP 330 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PPP + PP P P P P P PP PP Sbjct: 306 PPYAYSPPPSPYVYKSPP-YVYSSPPPYAYSPPPSPYVYKSPPYVYSSPP 354 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/51 (29%), Positives = 16/51 (31%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 PP PPP P PP P PP P P PP+ Sbjct: 330 PPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPY 380 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PPP + PP P P P P P PP PP Sbjct: 330 PPYAYSPPPSPYVYKSPP-YVYSSPPPYAYSPPPSPYVYKSPPYVYSSPP 378 Score = 28.7 bits (61), Expect = 6.2 Identities = 18/63 (28%), Positives = 19/63 (30%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P + P PP PP PP P PP P P PP PP Sbjct: 364 PYVYKSPPYVYSSPPPYTYSPPPYAYSPPPPCPDVYKP-PPYVYSSPPPYVYNPPPSSPP 422 Query: 969 XPP 977 P Sbjct: 423 PSP 425 Score = 28.7 bits (61), Expect = 6.2 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 4/54 (7%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP----PPPXPP 978 PP PP P + PP P P P PP PPP PPP P Sbjct: 370 PPYVYSSPP-PYTYSPPPYAYSPPPPCPDVYKPPPYVY-SSPPPYVYNPPPSSP 421 Score = 28.3 bits (60), Expect = 8.2 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 PP PPP P PP PP PP PPP P Sbjct: 354 PPYAYSPPPSPYVYKSPP---YVYSSPPPYTYSPPPYAYSPPPPCP 396 Score = 28.3 bits (60), Expect = 8.2 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP P PP PPP P PP P P P P P Sbjct: 360 PPPSPYVYKSPP--YVYSSPPPYTYSP---PPYAYSPPPPCPDVYKPPP 403 >At4g08370.1 68417.m01382 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 350 Score = 38.3 bits (85), Expect = 0.008 Identities = 24/64 (37%), Positives = 25/64 (39%), Gaps = 9/64 (14%) Frame = +1 Query: 817 PXXXPPXP---PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP------PP 969 P PP P PP P P PP P P PP PP PPPP PP Sbjct: 32 PQSPPPQPYVYSPPLPSPYVYKSPP----PSPYLYSSPPPPPYVYNSPPPPPPYIYNSPP 87 Query: 970 XPPF 981 PP+ Sbjct: 88 RPPY 91 Score = 38.3 bits (85), Expect = 0.008 Identities = 22/63 (34%), Positives = 23/63 (36%), Gaps = 8/63 (12%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPP---XXPPXPPLXXXXXPPP-----PPPX 972 P PPPP P PP P PP PP PP PPP PP Sbjct: 59 PYLYSSPPPPPYVYNSPPPPPPYIYNSPPRPPYVYKSPPPPPFVYSSPPPPTYIYNSPPP 118 Query: 973 PPF 981 PP+ Sbjct: 119 PPY 121 Score = 38.3 bits (85), Expect = 0.008 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 2/60 (3%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPX--PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 LYS P PPPPPP P P P P P PP PPPPP Sbjct: 61 LYSSPPPPPYVYNSPPPPPPYIYNSPPRPPYVYKSPPPPPFVYSSPPPPTYIYNSPPPPP 120 Score = 37.1 bits (82), Expect = 0.018 Identities = 25/68 (36%), Positives = 27/68 (39%), Gaps = 17/68 (25%) Frame = +1 Query: 829 PPXPPP-----PPPXPXPXAXPPXGXX----PXPXPPXX---PPXPPLXXXXXPPPP--- 963 PP P P PPP P + PP P P PP PP PP PPPP Sbjct: 44 PPLPSPYVYKSPPPSPYLYSSPPPPPYVYNSPPPPPPYIYNSPPRPPYVYKSPPPPPFVY 103 Query: 964 --PPXPPF 981 PP P + Sbjct: 104 SSPPPPTY 111 Score = 33.5 bits (73), Expect = 0.22 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PPP P PP P PPP P P PP PP Sbjct: 55 PPPSPYLYSSPPPPPYVYNSPPPPPPYIYNSPPRPPYVYKSPPPPP 100 Score = 33.1 bits (72), Expect = 0.29 Identities = 21/67 (31%), Positives = 23/67 (34%), Gaps = 6/67 (8%) Frame = +2 Query: 785 TTXXXTHSXNXPPPXPX-XPPPPPXXXXXXRPPPXXXXPXXXPP-----XXPXPXPSXPX 946 T+ +S PPP P PP P PPP PP P P P Sbjct: 24 TSAQCKYSPQSPPPQPYVYSPPLPSPYVYKSPPPSPYLYSSPPPPPYVYNSPPPPPPYIY 83 Query: 947 XXPPXPP 967 PP PP Sbjct: 84 NSPPRPP 90 Score = 31.9 bits (69), Expect = 0.67 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 PPPPP PP P PPP P PP P Sbjct: 96 PPPPPFVYSSPPPPTYIYNSPPPPPYVYKSVPRITFIYSSPPPPP 140 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/61 (31%), Positives = 21/61 (34%), Gaps = 1/61 (1%) Frame = +1 Query: 790 LXLYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXX-PPXPPLXXXXXPPPPP 966 L +YS P PPPPP P P PP P + PPPP Sbjct: 170 LFIYSSPPPPPYVYNSPPPPPYVYESVPRIPFIYSSPPPPPYVYNSAPRIPFIYSSPPPP 229 Query: 967 P 969 P Sbjct: 230 P 230 Score = 29.9 bits (64), Expect = 2.7 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = +2 Query: 818 PPPXPXX---PPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PPP P PPPPP PPP PP P S PP PP Sbjct: 55 PPPSPYLYSSPPPPPY--VYNSPPPPPPYIYNSPPRPPYVYKS-----PPPPP 100 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 841 PPPPPXPXPXAX--PPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PPPPP A P P P P P + PPPPP Sbjct: 226 PPPPPYVYNSAPRVPFIYSSPPPPPYVYKSVPRIPFIYSSPPPPP 270 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/51 (29%), Positives = 16/51 (31%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PPPP P P P P P + PPPPP Sbjct: 90 PYVYKSPPPPPFVYSSPPPPTYIYNSPPPPPYVYKSVPRITFIYSSPPPPP 140 Score = 28.3 bits (60), Expect = 8.2 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 5/55 (9%) Frame = +2 Query: 818 PPPXPX---XPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXP--XXXPPXPP 967 PPP P PPPPP P PP P P PP PP Sbjct: 176 PPPPPYVYNSPPPPPYVYESVPRIPFIYSSPPPPPYVYNSAPRIPFIYSSPPPPP 230 Score = 28.3 bits (60), Expect = 8.2 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 PPPPP P PPP P P PP P Sbjct: 226 PPPPPYVYNSAPRVPFIYSSPPPPPYVYKSVPRIPFIYSSPPPPP 270 >At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 434 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/54 (37%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPL---XXXXXPPPPPPXPPF 981 PP PPP PP P P P PP PP+ PPPP P P+ Sbjct: 25 PPYPPPHPPVEVEENQPKTS--PTPPPPHWMRYPPVLMPQMMYAPPPPMPFSPY 76 >At1g31290.1 68414.m03829 PAZ domain-containing protein / piwi domain-containing protein contains Pfam profiles PF02170: PAZ domain, PF02171: Piwi domain Length = 1194 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 G G GGGG G G G G G G G G G GGGG G Sbjct: 49 GHGRGGGGDRGRGYSGRGDGRGRGGGGDRGRGYSGRGDGHGRGGGGDRG 97 Score = 36.7 bits (81), Expect = 0.024 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGG 843 G G GGGG G G G G G G G G GGGG Sbjct: 13 GRGRGGGGDRGRGYSGRGDGRGRGGDGDRGYSGRGDGHGRGGGG 56 Score = 29.5 bits (63), Expect = 3.6 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G G GGG G G G G G G G G R G G G GG Sbjct: 9 GRGDGRGRGGG--GDRGRGYSGRGDGRG---RGGDGDRGYSGRGDGHGRGGG 55 Score = 29.1 bits (62), Expect = 4.7 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 1/57 (1%) Frame = -1 Query: 973 GXGGXGGGXXGXXGXGXG-GXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGR 806 G G GGG G G G G G G G R GGGG G GR Sbjct: 49 GHGRGGGGDRGRGYSGRGDGRGRGGGGDRGRGYSGRGDGHGRGGGGDRGRGYSGRGR 105 >At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 302 Score = 37.9 bits (84), Expect = 0.010 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +1 Query: 895 PXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 P P PP PP PL PPPPPP PF Sbjct: 98 PPPQPP--PPPQPLNLFSPPPPPPPPDPF 124 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +1 Query: 802 SLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXP 903 S+ Q PP PPPPP + PP P P Sbjct: 90 SMRQATRIPPPQPPPPPQPLNLFSPPPPPPPPDP 123 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 847 PPPXPXPXAXPPXGXXPXPXPPXXPPXP 930 PPP P P P P P PP PP P Sbjct: 98 PPPQPPPPPQPLNLFSPPPPPP--PPDP 123 >At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identical to gi_3883126_gb_AAC77826 Length = 135 Score = 37.9 bits (84), Expect = 0.010 Identities = 20/56 (35%), Positives = 21/56 (37%) Frame = +1 Query: 802 SLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 +L Q P P PPP P P A PP P P P PP P PP Sbjct: 19 ALAQAPAPTPTATPPPAT-PPPVATPPPVATPPPAATPAPATPPPAATPAPATTPP 73 Score = 33.5 bits (73), Expect = 0.22 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXP--XPPXXPPXPPLXXXXXPPPP 963 PP PPP A PP P P PP P P PP P Sbjct: 44 PPVATPPPAATPAPATPPPAATPAPATTPPSVAPSPADVPTASPPAP 90 Score = 32.7 bits (71), Expect = 0.38 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 1/58 (1%) Frame = +3 Query: 804 TLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXX-PXXPPPXPPXP 974 T P PP PPP PP P P P P P PP P P Sbjct: 36 TPPPVATPPPVATPPPAATPAPATPPPAATPAPATTPPSVAPSPADVPTASPPAPEGP 93 Score = 31.9 bits (69), Expect = 0.67 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXP--XPPXXPPXPPLXXXXXPPPPPPXP 975 P PPP P P A PP P P PP P P P P P Sbjct: 34 PATPPP-VATPPPVATPPPAATPAPATPPPAATPAPATTPPSVAPSPADVP 83 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 1/43 (2%) Frame = +1 Query: 853 PXPXPXAXPPXGXXPX-PXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P A PP P PP PP PPP P Sbjct: 24 PAPTPTATPPPATPPPVATPPPVATPPPAATPAPATPPPAATP 66 Score = 28.3 bits (60), Expect = 8.2 Identities = 18/63 (28%), Positives = 18/63 (28%) Frame = +3 Query: 786 LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXP 965 L A PT P PP PP P P PP P PP Sbjct: 20 LAQAPAPTPTATPPPATPPPVATPPPVATPPP---AATPAPATPPPAATPAPATTPPSVA 76 Query: 966 PXP 974 P P Sbjct: 77 PSP 79 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 37.9 bits (84), Expect = 0.010 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -3 Query: 929 GXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXW 810 G GG GG G G GG G G GGG GG G G W Sbjct: 69 GSGGGGGGRGYGG---GGRREGGGYGGGDGGSYGGGGGGW 105 Score = 33.5 bits (73), Expect = 0.22 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = -3 Query: 932 GGXGGXXGGXGXGXXPXGGXAXGXGX--GGGGGG 837 GG GG G G G GG G G GGGGGG Sbjct: 71 GGGGGGRGYGGGGRREGGGYGGGDGGSYGGGGGG 104 Score = 33.1 bits (72), Expect = 0.29 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = -3 Query: 974 GXGGGGGGXXXXXRG-GXGGXXGGXGXGXXPXGGXAXGXGXGGGG 843 G GGGGGG RG G GG G G G GG G GGGG Sbjct: 69 GSGGGGGG-----RGYGGGGRREGGGYG----GGDGGSYGGGGGG 104 Score = 28.7 bits (61), Expect = 6.2 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = -1 Query: 982 GXGGXGGX-GGGXXGXXGXGXGGXGGG 905 G GG G GGG G G GG GGG Sbjct: 78 GYGGGGRREGGGYGGGDGGSYGGGGGG 104 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXG 899 G GG G GGG G GG GG G Sbjct: 72 GGGGGRGYGGGGRREGGGYGGGDGGSYG 99 >At3g20850.1 68416.m02636 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 37.9 bits (84), Expect = 0.010 Identities = 23/80 (28%), Positives = 29/80 (36%) Frame = +1 Query: 739 LADSYHXINLXVXXTDYLXLYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXX 918 L ++ + L +Y +S P P PPPP P + PP P P P Sbjct: 20 LGEANNNRKLLYTYNNYQPQHSPLPSPVYSSPADLPPPPTPV-YSPPPADLPPPPTPYYS 78 Query: 919 PPXPPLXXXXXPPPPPPXPP 978 PP PPP PP Sbjct: 79 PPADLPPPTPIYPPPVAFPP 98 Score = 35.5 bits (78), Expect = 0.054 Identities = 21/57 (36%), Positives = 22/57 (38%), Gaps = 2/57 (3%) Frame = +1 Query: 817 PXXXPPX--PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 P PP PPP P P P A PP PP PP PPP P P+ Sbjct: 75 PYYSPPADLPPPTPIYPPPVAFPPPQAYQAYYYRKSPPPPPSKYGKVYPPP-PAKPW 130 Score = 33.1 bits (72), Expect = 0.29 Identities = 20/58 (34%), Positives = 21/58 (36%), Gaps = 1/58 (1%) Frame = +3 Query: 807 LPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXP-XPXXPXXPPPXPPXPP 977 LP+ P PPPP PP P P PP P P PPP PP Sbjct: 43 LPSPVYSSPADLPPPPTP-VYSPPPADLPPPPTPYYSPPADLPPPTPIYPPPVAFPPP 99 Score = 33.1 bits (72), Expect = 0.29 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +1 Query: 817 PXXXPPX---PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PP PPPP P P A P P P PP PPP P Sbjct: 60 PVYSPPPADLPPPPTPYYSPPADLPPPTPIYPPPVAFPPPQAYQAYYYRKSPPPPP 115 Score = 31.9 bits (69), Expect = 0.67 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 P PP PP P P P PP P PP P+ PPP Sbjct: 51 PADLPP-PPTPVYSPPPADLPPPPTPYYSPPADLPPPTPIYPPPVAFPPP 99 >At2g40820.1 68415.m05038 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 903 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/60 (35%), Positives = 22/60 (36%), Gaps = 4/60 (6%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXP---XPXAXP-PXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 Q P PP PPPPP P P P PP P + PPP P PP Sbjct: 756 QQPYYPPPMQPPPPPMNSGYMPTYIPKSVNDSSMPNPPMNNTNPQMQQPYYPPPMQPAPP 815 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 4/54 (7%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXP----PXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PPPPP P PP P P PPP P PP Sbjct: 762 PPMQPPPPPMNSGYMPTYIPKSVNDSSMPNPPMNNTNPQMQQPYYPPPMQPAPP 815 >At1g70620.2 68414.m08137 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 884 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 6/56 (10%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPP------LXXXXXPPPPPPXPP 978 PP PPPP P P P PP P PP P PPPP PP Sbjct: 13 PPSGPPPPTDPYHQYYQHQARPPVP-PPTQPGGPPAWYSNQFHHPHSPSPPPPPPP 67 Score = 33.1 bits (72), Expect = 0.29 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPP 933 P P PPP P P PP P P P PP Sbjct: 56 PHSPSPPPPPPPQWGPPSPHYPQGQPYSSPAYPP 89 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/60 (33%), Positives = 21/60 (35%), Gaps = 11/60 (18%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPL-----XXXXXPPP------PPPXP 975 P PPPPPP P + P P P PP PPP PPP P Sbjct: 59 PSPPPPPPPQWGPPSPHYPQGQPYSSPAYPPHQPPFNAGANGNSQFPPPSTGAPIPPPYP 118 Score = 29.9 bits (64), Expect = 2.7 Identities = 17/59 (28%), Positives = 17/59 (28%), Gaps = 1/59 (1%) Frame = +2 Query: 803 HSXNXPPPXPXXPP-PPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 H P P P P PP P P PP P P P P P P Sbjct: 30 HQARPPVPPPTQPGGPPAWYSNQFHHPHSPSPPPPPPPQWGPPSPHYPQGQPYSSPAYP 88 Score = 29.9 bits (64), Expect = 2.7 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 10/61 (16%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXP-----PXGXXPXPXPPXX--PPXP--PLXXXXXPPP-PPPXPP 978 PP PPP P P P P P PP PP P P P PP PP Sbjct: 34 PPVPPPTQPGGPPAWYSNQFHHPHSPSPPPPPPPQWGPPSPHYPQGQPYSSPAYPPHQPP 93 Query: 979 F 981 F Sbjct: 94 F 94 >At1g70620.1 68414.m08138 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 897 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 6/56 (10%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPP------LXXXXXPPPPPPXPP 978 PP PPPP P P P PP P PP P PPPP PP Sbjct: 13 PPSGPPPPTDPYHQYYQHQARPPVP-PPTQPGGPPAWYSNQFHHPHSPSPPPPPPP 67 Score = 33.1 bits (72), Expect = 0.29 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPP 933 P P PPP P P PP P P P PP Sbjct: 56 PHSPSPPPPPPPQWGPPSPHYPQGQPYSSPAYPP 89 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/60 (33%), Positives = 21/60 (35%), Gaps = 11/60 (18%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPL-----XXXXXPPP------PPPXP 975 P PPPPPP P + P P P PP PPP PPP P Sbjct: 59 PSPPPPPPPQWGPPSPHYPQGQPYSSPAYPPHQPPFNAGANGNSQFPPPSTGAPIPPPYP 118 Score = 29.9 bits (64), Expect = 2.7 Identities = 17/59 (28%), Positives = 17/59 (28%), Gaps = 1/59 (1%) Frame = +2 Query: 803 HSXNXPPPXPXXPP-PPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 H P P P P PP P P PP P P P P P P Sbjct: 30 HQARPPVPPPTQPGGPPAWYSNQFHHPHSPSPPPPPPPQWGPPSPHYPQGQPYSSPAYP 88 Score = 29.9 bits (64), Expect = 2.7 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 10/61 (16%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXP-----PXGXXPXPXPPXX--PPXP--PLXXXXXPPP-PPPXPP 978 PP PPP P P P P P PP PP P P P PP PP Sbjct: 34 PPVPPPTQPGGPPAWYSNQFHHPHSPSPPPPPPPQWGPPSPHYPQGQPYSSPAYPPHQPP 93 Query: 979 F 981 F Sbjct: 94 F 94 >At1g49270.1 68414.m05524 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 699 Score = 37.9 bits (84), Expect = 0.010 Identities = 22/64 (34%), Positives = 23/64 (35%), Gaps = 9/64 (14%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXPXPXA------XPPXG---XXPXPXPPXXPPXPPLXXXXXPPPP 963 Q P PP PPPP P P + PP P PP P P PP Sbjct: 5 QSPENSPPAPPPPSPPSPPSSNDQQTTSPPPSDNQETTSPPPPSSPDIAPPPQQQQESPP 64 Query: 964 PPXP 975 PP P Sbjct: 65 PPLP 68 Score = 28.7 bits (61), Expect = 6.2 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 843 PPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXP 965 PPPP PP P PPP P PP P Sbjct: 44 PPPPSSPDIAPPPQQQQESP-PPPLPENSSDGSSSSSPPPP 83 Score = 28.3 bits (60), Expect = 8.2 Identities = 15/58 (25%), Positives = 17/58 (29%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 +S PPP PP PPP PP P + P P P Sbjct: 9 NSPPAPPPPSPPSPPSSNDQQTTSPPPSDNQETTSPPPPSSPDIAPPPQQQQESPPPP 66 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +1 Query: 847 PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 PPP P PP PP P PPPP Sbjct: 44 PPPPSSPDIAPPPQQQQESPPPPLPENSSDGSSSSSPPPP 83 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 37.9 bits (84), Expect = 0.010 Identities = 22/68 (32%), Positives = 25/68 (36%), Gaps = 6/68 (8%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPP---PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP-- 960 +Y P PPP P P P + PP P PP P P L PPP Sbjct: 403 VYKSPPPPYIYNSPPPPYYSPSPKPSYKSPPPPYVYSSPPPPYYSPSPKLTYKSSPPPYV 462 Query: 961 -PPPXPPF 981 P PP+ Sbjct: 463 YSSPPPPY 470 Score = 37.9 bits (84), Expect = 0.010 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 P P PPPP PP P P P P PP PPPP Sbjct: 700 PAPKPTYKSPPPPYVYSSPPPPY-YSPSPKPTYKSPPPPYVYSSPPPPP 747 Score = 37.1 bits (82), Expect = 0.018 Identities = 26/76 (34%), Positives = 27/76 (35%), Gaps = 15/76 (19%) Frame = +1 Query: 799 YSLXQXPXXXPPXPP-----PPPPXPXPXAXPPXGXXPXPXPPXXPPXP-----PLXXXX 948 YS P P PP PPPP P P P P PP P P Sbjct: 673 YSPSPKPTYKSPPPPYVYSSPPPPYYSPAPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYK 732 Query: 949 XPPPP-----PPXPPF 981 PPPP PP PP+ Sbjct: 733 SPPPPYVYSSPPPPPY 748 Score = 36.7 bits (81), Expect = 0.024 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 4/54 (7%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP----XPPXPP 977 PP P P PP P PP P P P PPP PP PP Sbjct: 694 PPPYYSPAPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPP 747 Score = 36.3 bits (80), Expect = 0.031 Identities = 21/67 (31%), Positives = 24/67 (35%), Gaps = 6/67 (8%) Frame = +1 Query: 799 YSLXQXPXXXPPXPPP---PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP--- 960 Y P PPP P P P + PP P PP P P + PPP Sbjct: 104 YKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPPYVY 163 Query: 961 PPPXPPF 981 P PP+ Sbjct: 164 SSPPPPY 170 Score = 36.3 bits (80), Expect = 0.031 Identities = 20/57 (35%), Positives = 23/57 (40%), Gaps = 6/57 (10%) Frame = +1 Query: 829 PPXPPP--PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP----PPPXPPF 981 PP PP P P + PP P PP P P + PPP PP PP+ Sbjct: 743 PPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPPY 799 Score = 35.1 bits (77), Expect = 0.072 Identities = 21/66 (31%), Positives = 22/66 (33%), Gaps = 5/66 (7%) Frame = +1 Query: 799 YSLXQXPXXXPPXPP-----PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 YS P P PP PPPP P P P P PP P P Sbjct: 321 YSPSPKPVYKSPPPPYVYNSPPPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPTYK 380 Query: 964 PPXPPF 981 P PP+ Sbjct: 381 SPPPPY 386 Score = 35.1 bits (77), Expect = 0.072 Identities = 21/66 (31%), Positives = 22/66 (33%), Gaps = 5/66 (7%) Frame = +1 Query: 799 YSLXQXPXXXPPXPP-----PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 YS P P PP PPPP P P P P PP P P Sbjct: 598 YSPAPKPVYKSPPPPYVYNSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPTPKPTYK 657 Query: 964 PPXPPF 981 P PP+ Sbjct: 658 SPPPPY 663 Score = 35.1 bits (77), Expect = 0.072 Identities = 21/66 (31%), Positives = 22/66 (33%), Gaps = 5/66 (7%) Frame = +1 Query: 799 YSLXQXPXXXPPXPP-----PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 YS P P PP PPPP P P P P PP P P Sbjct: 623 YSPSPKPTYKSPPPPYVYSSPPPPYYSPTPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYK 682 Query: 964 PPXPPF 981 P PP+ Sbjct: 683 SPPPPY 688 Score = 35.1 bits (77), Expect = 0.072 Identities = 21/66 (31%), Positives = 22/66 (33%), Gaps = 5/66 (7%) Frame = +1 Query: 799 YSLXQXPXXXPPXPP-----PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 YS P P PP PPPP P P P P PP P P Sbjct: 648 YSPTPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPAPKPTYK 707 Query: 964 PPXPPF 981 P PP+ Sbjct: 708 SPPPPY 713 Score = 34.7 bits (76), Expect = 0.095 Identities = 21/66 (31%), Positives = 22/66 (33%), Gaps = 5/66 (7%) Frame = +1 Query: 799 YSLXQXPXXXPPXPP-----PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 YS P P PP PPPP P P P P PP P P Sbjct: 196 YSPSPKPTYKSPPPPYIYSSPPPPYYSPSPKPVYKSPPPPYVYSSPPPPYYSPSPKPAYK 255 Query: 964 PPXPPF 981 P PP+ Sbjct: 256 SPPPPY 261 Score = 34.7 bits (76), Expect = 0.095 Identities = 25/75 (33%), Positives = 26/75 (34%), Gaps = 14/75 (18%) Frame = +1 Query: 799 YSLXQXPXXXPPXPP-----PPPPXPXPXAXPPXGXXPXPXPPXXPPXP-----PLXXXX 948 YS P P PP PPPP P P P P PP P P Sbjct: 221 YSPSPKPVYKSPPPPYVYSSPPPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPIYK 280 Query: 949 XPPPP----PPXPPF 981 PPPP P PP+ Sbjct: 281 SPPPPYVYNSPPPPY 295 Score = 34.7 bits (76), Expect = 0.095 Identities = 21/66 (31%), Positives = 22/66 (33%), Gaps = 5/66 (7%) Frame = +1 Query: 799 YSLXQXPXXXPPXPP-----PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 YS P P PP PPPP P P P P PP P P Sbjct: 271 YSPSPKPIYKSPPPPYVYNSPPPPYYSPSPKPAYKSPPPPYVYSFPPPPYYSPSPKPVYK 330 Query: 964 PPXPPF 981 P PP+ Sbjct: 331 SPPPPY 336 Score = 34.7 bits (76), Expect = 0.095 Identities = 21/66 (31%), Positives = 22/66 (33%), Gaps = 5/66 (7%) Frame = +1 Query: 799 YSLXQXPXXXPPXPP-----PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 YS P P PP PPPP P P P P PP P P Sbjct: 296 YSPSPKPAYKSPPPPYVYSFPPPPYYSPSPKPVYKSPPPPYVYNSPPPPYYSPSPKPAYK 355 Query: 964 PPXPPF 981 P PP+ Sbjct: 356 SPPPPY 361 Score = 34.7 bits (76), Expect = 0.095 Identities = 21/66 (31%), Positives = 22/66 (33%), Gaps = 5/66 (7%) Frame = +1 Query: 799 YSLXQXPXXXPPXPP-----PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 YS P P PP PPPP P P P P PP P P Sbjct: 346 YSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPSPKPVYK 405 Query: 964 PPXPPF 981 P PP+ Sbjct: 406 SPPPPY 411 Score = 34.7 bits (76), Expect = 0.095 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP 960 P P PPPP PP P P P PP PPP Sbjct: 725 PSPKPTYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSSPPPP 772 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P P PPP P PP Sbjct: 92 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYNSPPPP 144 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P P PPP P PP Sbjct: 167 PPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKPTYKSPPPPYIYSSPPPP 219 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P P PPP P PP Sbjct: 192 PPPYYSPSPKPTYKSPPPPYIYSSPPPPYYSPSPKPVYKSPPPPYVYSSPPPP 244 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P P PPP P PP Sbjct: 217 PPPYYSPSPKPVYKSPPPPYVYSSPPPPYYSPSPKPAYKSPPPPYVYSSPPPP 269 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P P PPP P PP Sbjct: 242 PPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPIYKSPPPPYVYNSPPPP 294 Score = 34.3 bits (75), Expect = 0.13 Identities = 21/66 (31%), Positives = 22/66 (33%), Gaps = 5/66 (7%) Frame = +1 Query: 799 YSLXQXPXXXPPXPP-----PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 YS P P PP PPPP P P P P PP P P Sbjct: 246 YSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPIYKSPPPPYVYNSPPPPYYSPSPKPAYK 305 Query: 964 PPXPPF 981 P PP+ Sbjct: 306 SPPPPY 311 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P P PPP P PP Sbjct: 292 PPPYYSPSPKPAYKSPPPPYVYSFPPPPYYSPSPKPVYKSPPPPYVYNSPPPP 344 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P P PPP P PP Sbjct: 317 PPPYYSPSPKPVYKSPPPPYVYNSPPPPYYSPSPKPAYKSPPPPYVYSSPPPP 369 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P P PPP P PP Sbjct: 342 PPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPP 394 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P P PPP P PP Sbjct: 367 PPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPSPKPVYKSPPPPYIYNSPPPP 419 Score = 34.3 bits (75), Expect = 0.13 Identities = 21/66 (31%), Positives = 22/66 (33%), Gaps = 5/66 (7%) Frame = +1 Query: 799 YSLXQXPXXXPPXPP-----PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 YS P P PP PPPP P P P P PP P P Sbjct: 371 YSPSPKPTYKSPPPPYVYSSPPPPYYSPSPKPVYKSPPPPYIYNSPPPPYYSPSPKPSYK 430 Query: 964 PPXPPF 981 P PP+ Sbjct: 431 SPPPPY 436 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P P PPP P PP Sbjct: 392 PPPYYSPSPKPVYKSPPPPYIYNSPPPPYYSPSPKPSYKSPPPPYVYSSPPPP 444 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P P PPP P PP Sbjct: 467 PPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKPSYKSPPPPYVYNSPPPP 519 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/56 (33%), Positives = 20/56 (35%), Gaps = 5/56 (8%) Frame = +1 Query: 829 PPXP-----PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 PP P PPPPP P P P P PP P P P PP+ Sbjct: 558 PPTPYVYHSPPPPPYYSPSPKPAYKSSPPPYVYSSPPPPYYSPAPKPVYKSPPPPY 613 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P P PPP P PP Sbjct: 569 PPPYYSPSPKPAYKSSPPPYVYSSPPPPYYSPAPKPVYKSPPPPYVYNSPPPP 621 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P P PPP P PP Sbjct: 594 PPPYYSPAPKPVYKSPPPPYVYNSPPPPYYSPSPKPTYKSPPPPYVYSSPPPP 646 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P P PPP P PP Sbjct: 619 PPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPTPKPTYKSPPPPYVYSSPPPP 671 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P P PPP P PP Sbjct: 644 PPPYYSPTPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPP 696 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P P PPP P PP Sbjct: 669 PPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPAPKPTYKSPPPPYVYSSPPPP 721 Score = 34.3 bits (75), Expect = 0.13 Identities = 25/76 (32%), Positives = 26/76 (34%), Gaps = 15/76 (19%) Frame = +1 Query: 799 YSLXQXPXXXPPXPP-----PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXX----- 948 YS P P PP PPPP P P P P PP PP Sbjct: 698 YSPAPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPPYYSPSPKVEY 757 Query: 949 -XPPPP----PPXPPF 981 PPPP P PP+ Sbjct: 758 KSPPPPYVYSSPPPPY 773 Score = 33.9 bits (74), Expect = 0.17 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 5/59 (8%) Frame = +1 Query: 799 YSLXQXPXXXPPXPP-----PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP 960 YS P P P PPPP PP P P P PP PPP Sbjct: 11 YSSPPPPLYDSPTPKVDYKSPPPPYVYSSPPPPLSYSPSPKVDYKSPPPPYVYSSPPPP 69 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 4/53 (7%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP----XPPXP 974 PP P P PP P PP P P P PPP PP P Sbjct: 267 PPPYYSPSPKPIYKSPPPPYVYNSPPPPYYSPSPKPAYKSPPPPYVYSFPPPP 319 Score = 33.9 bits (74), Expect = 0.17 Identities = 21/68 (30%), Positives = 24/68 (35%), Gaps = 8/68 (11%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPP---PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP-- 960 +Y P PPP P P P + PP P PP P P + P P Sbjct: 478 VYKSPPPPYVYSSPPPPYYSPSPKPSYKSPPPPYVYNSPPPPYYSPSPKVIYKSPPHPHV 537 Query: 961 ---PPPXP 975 PPP P Sbjct: 538 CVCPPPPP 545 Score = 33.5 bits (73), Expect = 0.22 Identities = 21/64 (32%), Positives = 23/64 (35%), Gaps = 3/64 (4%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPP---PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 +YS P P P PPP + PP P P P P PP PPPP Sbjct: 387 VYSSPPPPYYSPSPKPVYKSPPPPYIYNSPPPPYYSPSPKPSYKSPPPPYVYSS--PPPP 444 Query: 967 PXPP 978 P Sbjct: 445 YYSP 448 Score = 33.1 bits (72), Expect = 0.29 Identities = 26/76 (34%), Positives = 29/76 (38%), Gaps = 15/76 (19%) Frame = +1 Query: 799 YSLXQXPXXXPPXPP-----PPPPX--PXPX----AXPPXGXXPXPXPPXXPPXPPLXXX 945 YS P P PP PPPP P P + PP P PP P P + Sbjct: 121 YSPSPKPTYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYK 180 Query: 946 XXPPPP----PPXPPF 981 PPPP P PP+ Sbjct: 181 -SPPPPYVYNSPPPPY 195 Score = 33.1 bits (72), Expect = 0.29 Identities = 19/60 (31%), Positives = 21/60 (35%), Gaps = 4/60 (6%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPP----PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 +YS P P P PPP + PP P P P PP PPPP Sbjct: 739 VYSSPPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPP 798 Score = 33.1 bits (72), Expect = 0.29 Identities = 19/60 (31%), Positives = 20/60 (33%), Gaps = 5/60 (8%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPP-----PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP 960 +YS P P P PPPP PP P P P PP PPP Sbjct: 790 VYSSPPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYYSPSPKVEYKSPPPPYVYNSPPPP 849 Score = 32.7 bits (71), Expect = 0.38 Identities = 17/54 (31%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXPPF 981 PP P P + PP P PP P P + PPP P PP+ Sbjct: 42 PPLSYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPY 95 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 66 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYK-SPPPPYVYSSPPPPY 120 Score = 32.3 bits (70), Expect = 0.51 Identities = 17/55 (30%), Positives = 19/55 (34%), Gaps = 4/55 (7%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP----PPPXPPF 981 PP P P PP P PP P P + PPP PP P + Sbjct: 771 PPYYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTY 825 Score = 32.3 bits (70), Expect = 0.51 Identities = 19/60 (31%), Positives = 20/60 (33%), Gaps = 5/60 (8%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPP-----PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP 960 +YS P P P PPPP PP P P P PP PPP Sbjct: 816 VYSSPPPPTYYSPSPKVEYKSPPPPYVYNSPPPPAYYSPSPKIEYKSPPPPYVYSSPPPP 875 Score = 31.5 bits (68), Expect = 0.88 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 4/55 (7%) Frame = +1 Query: 829 PPXP----PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 PP P PPPP P P P P PP P P P PP+ Sbjct: 182 PPPPYVYNSPPPPYYSPSPKPTYKSPPPPYIYSSPPPPYYSPSPKPVYKSPPPPY 236 Score = 31.5 bits (68), Expect = 0.88 Identities = 17/53 (32%), Positives = 18/53 (33%), Gaps = 4/53 (7%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRP----PPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP +P PP PP P P PP P Sbjct: 183 PPPYVYNSPPPPYYSPSPKPTYKSPPPPYIYSSPPPPYYSPSPKPVYKSPPPP 235 Score = 31.5 bits (68), Expect = 0.88 Identities = 20/57 (35%), Positives = 22/57 (38%), Gaps = 6/57 (10%) Frame = +1 Query: 829 PPXPP---PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXPPF 981 PP PP P P P + PP P PP P P PPP P PP+ Sbjct: 567 PPPPPYYSP-SPKPAYKSSPPPYVYSSPPPPYYSPAPKPVYKSPPPPYVYNSPPPPY 622 Score = 31.5 bits (68), Expect = 0.88 Identities = 20/66 (30%), Positives = 21/66 (31%), Gaps = 5/66 (7%) Frame = +1 Query: 799 YSLXQXPXXXPPXPP-----PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 YS P PP PPPP P P P P PP P P Sbjct: 573 YSPSPKPAYKSSPPPYVYSSPPPPYYSPAPKPVYKSPPPPYVYNSPPPPYYSPSPKPTYK 632 Query: 964 PPXPPF 981 P PP+ Sbjct: 633 SPPPPY 638 Score = 31.5 bits (68), Expect = 0.88 Identities = 19/63 (30%), Positives = 21/63 (33%), Gaps = 2/63 (3%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPP--PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 +YS P P P PP P + PP P P PP PPPP Sbjct: 714 VYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSSPPPPY 773 Query: 970 XPP 978 P Sbjct: 774 YSP 776 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +1 Query: 847 PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PPP + PP P P P P PP PPPP P Sbjct: 482 PPPPYVYSSPPPPYYSPSPKPSYKSPPPPYVYNS--PPPPYYSP 523 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/62 (32%), Positives = 22/62 (35%), Gaps = 11/62 (17%) Frame = +1 Query: 829 PPXPPP--------PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXP 975 PP P PPP + PP P P P P PP PPP P P P Sbjct: 620 PPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPTPKPTYKSPPPPYVYSSPPPPYYSPSPKP 679 Query: 976 PF 981 + Sbjct: 680 TY 681 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/62 (32%), Positives = 22/62 (35%), Gaps = 11/62 (17%) Frame = +1 Query: 829 PPXPPP--------PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXP 975 PP P PPP + PP P P P P PP PPP P P P Sbjct: 645 PPYYSPTPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPAPKP 704 Query: 976 PF 981 + Sbjct: 705 TY 706 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/62 (32%), Positives = 22/62 (35%), Gaps = 11/62 (17%) Frame = +1 Query: 829 PPXPPP--------PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXP 975 PP P PPP + PP P P P P PP PPP P P P Sbjct: 670 PPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPAPKPTYKSPPPPYVYSSPPPPYYSPSPKP 729 Query: 976 PF 981 + Sbjct: 730 TY 731 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 771 PPYYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSSPPPP 823 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 42 PPLSYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPP 94 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 67 PPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 119 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 142 PPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPP 194 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/54 (33%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXPPF 981 PP P P P + PP P PP P P PPP P PP+ Sbjct: 193 PPYYSP-SPKPTYKSPPPPYIYSSPPPPYYSPSPKPVYKSPPPPYVYSSPPPPY 245 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/54 (33%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXPPF 981 PP P P P + PP P PP P P PPP P PP+ Sbjct: 343 PPYYSP-SPKPAYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPY 395 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/62 (32%), Positives = 22/62 (35%), Gaps = 11/62 (17%) Frame = +1 Query: 829 PPXPPP--------PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXP 975 PP P PPP + PP P P P P PP PPP P P P Sbjct: 368 PPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPSPKPVYKSPPPPYIYNSPPPPYYSPSPKP 427 Query: 976 PF 981 + Sbjct: 428 SY 429 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 442 PPPYYSPSPKLTYKSSPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPP 494 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/54 (31%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXPPF 981 PP P P + PP P PP P P + PPP P PP+ Sbjct: 443 PPYYSPSPKLTYKSSPPPY-VYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPY 495 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/53 (33%), Positives = 19/53 (35%), Gaps = 6/53 (11%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXX-PXPXPSXPXXXPP 958 PPP PPPP + PPP PP P P PS PP Sbjct: 458 PPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKPSYKSPPPP 510 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP 959 PP P P PP P PP P P PPP Sbjct: 848 PPAYYSPSPKIEYKSPPPPYVYSSPPPPSYSPSPKAEYKSPPPP 891 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/54 (33%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXPPF 981 PP P P P + PP P PP P P PPP P PP+ Sbjct: 293 PPYYSP-SPKPAYKSPPPPYVYSFPPPPYYSPSPKPVYKSPPPPYVYNSPPPPY 345 Score = 30.3 bits (65), Expect = 2.0 Identities = 19/58 (32%), Positives = 21/58 (36%), Gaps = 7/58 (12%) Frame = +1 Query: 829 PPXPPP--PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP-----PPXPPF 981 PP PP P P + PP P PP P PPPP PP P + Sbjct: 794 PPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYYSPSPKVEYKSPPPPYVYNSPPPPAY 851 Score = 29.5 bits (63), Expect = 3.6 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 5/55 (9%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXP-----PXPP 977 PP P P PP P PPP P P PP P P PP Sbjct: 16 PPLYDSPTPKVDYKSPPPPYVYSSP-PPPLSYSPSPKVDYKSPPPPYVYSSPPPP 69 Score = 29.5 bits (63), Expect = 3.6 Identities = 21/64 (32%), Positives = 23/64 (35%), Gaps = 13/64 (20%) Frame = +1 Query: 829 PPXP----PPPPPXPXP------XAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPP 969 PP P PPPP P + PP P PP P P PPP P Sbjct: 82 PPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYNSP 141 Query: 970 XPPF 981 PP+ Sbjct: 142 PPPY 145 Score = 29.5 bits (63), Expect = 3.6 Identities = 17/53 (32%), Positives = 19/53 (35%), Gaps = 6/53 (11%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXX-PXPXPSXPXXXPP 958 PPP PPPP + PPP PP P P P+ PP Sbjct: 83 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPP 135 Score = 29.5 bits (63), Expect = 3.6 Identities = 21/64 (32%), Positives = 23/64 (35%), Gaps = 13/64 (20%) Frame = +1 Query: 829 PPXP----PPPPPXPXP------XAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPP 969 PP P PPPP P + PP P PP P P PPP P Sbjct: 157 PPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKPTYKSPPPPYIYSSP 216 Query: 970 XPPF 981 PP+ Sbjct: 217 PPPY 220 Score = 29.1 bits (62), Expect = 4.7 Identities = 20/65 (30%), Positives = 22/65 (33%), Gaps = 4/65 (6%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPP----PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 +YS P P P PPP + PP P P P PP PPP Sbjct: 36 VYSSPPPPLSYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSS--PPP 93 Query: 964 PPXPP 978 P P Sbjct: 94 PYYSP 98 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/53 (30%), Positives = 18/53 (33%), Gaps = 6/53 (11%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR------PPPXXXXPXXXPPXXPXPXPSXPXXXPP 958 PPP PPPP + PPP P P P P+ PP Sbjct: 158 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKPTYKSPPPP 210 Score = 29.1 bits (62), Expect = 4.7 Identities = 21/66 (31%), Positives = 22/66 (33%), Gaps = 9/66 (13%) Frame = +1 Query: 799 YSLXQXPXXXPPXPPP---PPPXPXPXAXPPXGXXPXPXPPXX-PPXPPLXXXXXPP--- 957 Y P PPP P P P + PP P PP P P PP Sbjct: 379 YKSPPPPYVYSSPPPPYYSPSPKPVYKSPPPPYIYNSPPPPYYSPSPKPSYKSPPPPYVY 438 Query: 958 --PPPP 969 PPPP Sbjct: 439 SSPPPP 444 Score = 29.1 bits (62), Expect = 4.7 Identities = 19/56 (33%), Positives = 20/56 (35%), Gaps = 10/56 (17%) Frame = +3 Query: 840 PPPPPXXXXX-----RXPPXXXXXXPXPPPX--PPXPXPXXPXXPPP---XPPXPP 977 PPPPP + PP PPP P P P PPP P PP Sbjct: 541 PPPPPCYSHSPKIEYKSPPTPYVYHSPPPPPYYSPSPKPAYKSSPPPYVYSSPPPP 596 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 58 PPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYS-PSPKVDYKSPPPP 110 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +2 Query: 812 NXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP 958 N PPP P P P PPP P P P P PP Sbjct: 189 NSPPPPYYSPSPKPTYK--SPPPPYIYSSPPPPYYSPSPKPVYKSPPPP 235 Score = 28.7 bits (61), Expect = 6.2 Identities = 18/55 (32%), Positives = 20/55 (36%), Gaps = 9/55 (16%) Frame = +1 Query: 844 PPPPXPXP------XAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXPPF 981 PPPP P + PP P PP P P PPP P PP+ Sbjct: 466 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKPSYKSPPPPYVYNSPPPPY 520 Score = 28.7 bits (61), Expect = 6.2 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP 958 PP P P P PPP P P P P PP Sbjct: 567 PPPPPYYSPSPKPAYKSSPPPYVYSSPPPPYYSPAPKPVYKSPPPP 612 Score = 28.3 bits (60), Expect = 8.2 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP 958 P P P PPP PPP P P P P PP Sbjct: 398 PSPKPVYKSPPP-PYIYNSPPPPYYSPSPKPSYKSPPPPYVYSSPPP 443 Score = 28.3 bits (60), Expect = 8.2 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PP P P P PPP PP P P PP P Sbjct: 769 PPPPYYSPSP--KVEYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPP 814 Score = 28.3 bits (60), Expect = 8.2 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP 960 PP P P + PP P PP P P PPP Sbjct: 848 PPAYYSPSPKIEYKSPPPPYVYSSPPPPSYSPSPKAEYKSPPPP 891 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 37.5 bits (83), Expect = 0.013 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 2/57 (3%) Frame = +2 Query: 818 PPPXPX--XPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXPXS 982 PPP PPPPP P PP P P P P PP PP P S Sbjct: 348 PPPGMLRFPPPPPPLDMHPPHPGMFVGHLIPRPPYGPPPGP-PPMMRPPLPPGPPPS 403 Score = 37.1 bits (82), Expect = 0.018 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP P P P P PP PP P PPPP P Sbjct: 198 PLPPLPPLPPTTGLTLPHS--PFPPPPPGPPPKEQDFVRPPLPPPPQLP 244 Score = 36.7 bits (81), Expect = 0.024 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PPPPP P PP P P P P PP PP PP Sbjct: 357 PPPPPLDMHPPHPGMFVGHLIPRPPYGPPPGP-PPMMRPPLPPGPP 401 Score = 35.9 bits (79), Expect = 0.041 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 9/54 (16%) Frame = +1 Query: 829 PPXPPPPP---------PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 PP PP PP P P P PP PP PP P L PPPP Sbjct: 200 PPLPPLPPTTGLTLPHSPFPPPPPGPPPKEQDFVRPP-LPPPPQLPQSSQPPPP 252 Score = 35.1 bits (77), Expect = 0.072 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP--XPPLXXXXXPPPPPP 969 P PPPP P G P PP PP PP+ PP PPP Sbjct: 356 PPPPPPLDMHPPHPGMFVGHL-IPRPPYGPPPGPPPMMRPPLPPGPPP 402 Score = 31.9 bits (69), Expect = 0.67 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPL 936 PP PP PPP PP P PP P L Sbjct: 219 PPPPPGPPPKEQDFVRPPLPPPPQLPQSSQPPPPGL 254 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXP 944 P LTLP PP PPP R P P PP P P P Sbjct: 207 PTTGLTLPHSPFPPPPPGPPPKEQDFVRPP------LPPPPQLPQSSQPPPP 252 Score = 30.3 bits (65), Expect = 2.0 Identities = 22/72 (30%), Positives = 22/72 (30%), Gaps = 8/72 (11%) Frame = +3 Query: 786 LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPX--------PXPXX 941 LP L PP P PP P P PPP PP P P Sbjct: 186 LPDGDNALSASLPLPPLPPLPPTTGLTLPHSPF-----PPPPPGPPPKEQDFVRPPLPPP 240 Query: 942 PXXPPPXPPXPP 977 P P P PP Sbjct: 241 PQLPQSSQPPPP 252 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 831 PXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P PPP PP P P P P PPP PP Sbjct: 344 PDVHPPPGMLRFPPPPPPLDMHPPHPGMFVGHLIPRPPYGPPPGPP 389 >At5g58540.1 68418.m07330 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 484 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PPPPP PP P P P PL P P P P Sbjct: 83 PLLPPPPPEGNETPSPPRSGVPTQTPETPPAITPLPVPLAPAPSPSPP 130 Score = 35.1 bits (77), Expect = 0.072 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 3/52 (5%) Frame = +3 Query: 831 PXXPPPPPXXXXXRXPP---XXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PPPPP PP PP P P P P P P PP P Sbjct: 83 PLLPPPPPEGNETPSPPRSGVPTQTPETPPAITPLPVPLAP-APSPSPPVSP 133 >At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ boundaries domain protein 13 (LBD13) identical to LOB DOMAIN 13 [Arabidopsis thaliana] GI:17227158 SP|Q9AT61 Length = 268 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPL 936 P PPPPPP P P P P PP P P + Sbjct: 193 PPPPPPPPTPRPPRLLSSQPAPPPTPPVSLPSPSM 227 Score = 33.1 bits (72), Expect = 0.29 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 831 PXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXP 935 P PPPPP PP P PPP PP P Sbjct: 193 PPPPPPPPTP----RPPRLLSSQPAPPPTPPVSLP 223 Score = 31.5 bits (68), Expect = 0.88 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 895 PXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P PP P PP P PPP P Sbjct: 193 PPPPPPPPTPRPPRLLSSQPAPPPTPP 219 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 37.5 bits (83), Expect = 0.013 Identities = 21/62 (33%), Positives = 22/62 (35%), Gaps = 12/62 (19%) Frame = +1 Query: 829 PPXPPPPPP------------XPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPX 972 P PPPPPP P P + P P P PP L PPPPP Sbjct: 65 PSSPPPPPPSSSPLSSLSPSLSPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPPSS 124 Query: 973 PP 978 P Sbjct: 125 SP 126 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P P + P P P PP L PPPPP P Sbjct: 29 PSSSSPSLSPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPPSSSP 77 Score = 33.5 bits (73), Expect = 0.22 Identities = 21/74 (28%), Positives = 27/74 (36%), Gaps = 2/74 (2%) Frame = +1 Query: 760 INLXVXXTDYLXLYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXX--PPXPP 933 ++L + ++ S P P P PP P + PP P PP P PP Sbjct: 10 LHLSIAILLFITTSSSSLSPSSSSPSLSPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPP 69 Query: 934 LXXXXXPPPPPPXP 975 PPPP P Sbjct: 70 ------PPPPSSSP 77 Score = 31.5 bits (68), Expect = 0.88 Identities = 17/57 (29%), Positives = 18/57 (31%), Gaps = 2/57 (3%) Frame = +3 Query: 810 PTXXXXPPXXPPP--PPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P+ PP P PP PP PPP PP P P P P Sbjct: 34 PSLSPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPPSSSPLSSLSPSLSPSPP 90 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/59 (30%), Positives = 19/59 (32%), Gaps = 5/59 (8%) Frame = +2 Query: 806 SXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXP-----PXXPXPXPSXPXXXPPXPP 967 S + PPP P P P P P P P P P P PP PP Sbjct: 64 SPSSPPPPPPSSSPLSSLSPSLSPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPP 122 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/56 (30%), Positives = 18/56 (32%), Gaps = 2/56 (3%) Frame = +2 Query: 806 SXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXP--XPXPSXPXXXPPXPP 967 S + PP PP PPP P PP P P S P PP Sbjct: 35 SLSPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPPSSSPLSSLSPSLSPSPP 90 Score = 29.9 bits (64), Expect = 2.7 Identities = 19/63 (30%), Positives = 19/63 (30%), Gaps = 7/63 (11%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRX-PPXXXXXXPXPPPXPPXPXPXXPXXPPPX------PP 968 P P PPPPP P P P P P PPP PP Sbjct: 59 PPLSLSPSSPPPPPPSSSPLSSLSPSLSPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPP 118 Query: 969 XPP 977 PP Sbjct: 119 PPP 121 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/50 (30%), Positives = 16/50 (32%), Gaps = 2/50 (4%) Frame = +3 Query: 810 PTXXXXPPXXPPP--PPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXP 953 P+ PP P PP PP PPP PP P P Sbjct: 83 PSLSPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPPSSSPLSSLSP 132 Score = 28.3 bits (60), Expect = 8.2 Identities = 18/53 (33%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Frame = +2 Query: 806 SXNXPPPXPXXP--PPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPP 958 S + PPP P PPPP PP P P P S P PP Sbjct: 54 SPSSPPPLSLSPSSPPPP-------PPSSSPLSSLSPSLSPSPPSSSPSSAPP 99 Score = 28.3 bits (60), Expect = 8.2 Identities = 17/50 (34%), Positives = 18/50 (36%), Gaps = 3/50 (6%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPP---PPPXPXPXAXPPXGXXPXPXPPXXPPXPPL 936 L SL PP P PP P + PP P PP P PL Sbjct: 78 LSSLSPSLSPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPPSSSPL 127 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/43 (30%), Positives = 14/43 (32%) Frame = +2 Query: 806 SXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXP 934 S + PP PP PPP P PP P P Sbjct: 84 SLSPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPPSSSP 126 >At1g53625.1 68414.m06096 expressed protein Length = 89 Score = 37.5 bits (83), Expect = 0.013 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = -3 Query: 923 GGXXGGXGXGXXPXGGXAXGXGXGGGGGG 837 GG GG G G GG G G GGGGGG Sbjct: 60 GGDGGGDGGGDGGGGGCGGGGGCGGGGGG 88 Score = 32.7 bits (71), Expect = 0.38 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -1 Query: 967 GGXGGGXXGXXGXGXGGXGGGXGXXXXXXGG 875 GG GGG G G G GG GGG G GG Sbjct: 60 GGDGGGDGGGDG-GGGGCGGGGGCGGGGGGG 89 Score = 32.3 bits (70), Expect = 0.51 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGG 905 G G GG GGG G G GG GGG Sbjct: 63 GGGDGGGDGGGGGCGGGGGCGGGGGG 88 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGG 905 G G G GGG G G GG GGG Sbjct: 64 GGDGGGDGGGGGCGGGGGCGGGGGGG 89 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 921 GXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG G GGG GGGGG G GGG Sbjct: 60 GGDGGGDGGGDGGGGG------CGGGGGCGGGGGG 88 >At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family protein Length = 558 Score = 37.5 bits (83), Expect = 0.013 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPX--GXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P P PP PP P P G P PP PP PPPPPP P Sbjct: 222 PSPSPSRLPPTPPLPKFLVSPASSLGKRDENSSPFAPPTPP----PPPPPPPPRP 272 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXA 873 P PP PPPPPP P A Sbjct: 258 PPTPPPPPPPPPPRPLAKA 276 >At1g07135.1 68414.m00759 glycine-rich protein Length = 155 Score = 37.5 bits (83), Expect = 0.013 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXX--GGXRXXXXXGGGGGXXGG 827 G GG GG GGG G GG GG GG GGG G GG Sbjct: 66 GGGGGGGRGGGGARSGGRSRGGGGGSSSSRSRDWKRGGGVVPIHTGGGNGSLGG 119 Score = 37.1 bits (82), Expect = 0.018 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXWXSEX 798 GG GGGG RGG GG GG GGG G GG G S Sbjct: 71 GGRGGGGARSGGRSRGGGGGSSSSRSRDWKRGGGVVP-IHTGGGNGSLGGGSAGSHRSSG 129 Query: 797 S 795 S Sbjct: 130 S 130 >At5g66400.1 68418.m08374 dehydrin (RAB18) nearly identical to SP|P30185 Dehydrin Rab18 {Arabidopsis thaliana} Length = 186 Score = 37.1 bits (82), Expect = 0.018 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 2/51 (3%) Frame = -3 Query: 974 GXGGGGG--GXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 G GGGGG G GG G GG G G GG G G G G G GG Sbjct: 37 GTGGGGGATGGQGYGTGGQGYGSGGQGYG---TGGQGYGTGTGTEGFGTGG 84 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 37.1 bits (82), Expect = 0.018 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +1 Query: 853 PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P P P PP P PP PPPPPP PP Sbjct: 9 PYPAPGNYPQGPPPPVGVPPQYYPPPP------PPPPPPPPP 44 Score = 33.5 bits (73), Expect = 0.22 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPP 933 P P P P P P P P PP PP PP Sbjct: 11 PAPGNYPQGPPPPVGVPPQYYPPPPPPPPPPPPP 44 Score = 32.7 bits (71), Expect = 0.38 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXP 867 P PP PPPPPP P P Sbjct: 28 PQYYPPPPPPPPPPPPP 44 Score = 31.9 bits (69), Expect = 0.67 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 6/39 (15%) Frame = +1 Query: 880 PXGXXPXPXP---PXXPPXP---PLXXXXXPPPPPPXPP 978 P P P P P PP P P PPPPPP PP Sbjct: 4 PKYAYPYPAPGNYPQGPPPPVGVPPQYYPPPPPPPPPPP 42 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +2 Query: 824 PXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXP 943 P P P P PPP P PP P P P P Sbjct: 4 PKYAYPYPAPGNYPQGPPPPVGVPPQYYPPPPPPPPPPPP 43 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 37.1 bits (82), Expect = 0.018 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGG 875 G GG GGG G G G GG GGG G GG Sbjct: 122 GGGGGYSGGGGGYGGGGGGYGGGGGGYGGGGDGGGG 157 Score = 35.5 bits (78), Expect = 0.054 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -3 Query: 932 GGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GG GG G G G G GGGGGG GG G Sbjct: 122 GGGGGYSGGGG------GYGGGGGGYGGGGGGYGGGGDG 154 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 921 GXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG G GGG GGG G G GGG Sbjct: 122 GGGGGYSGGGGGYGGGGGGYGGGGGGYGGGGDGGG 156 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 964 GXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GGG G G GG GGG G GG GGGG GG Sbjct: 122 GGGGGYSG----GGGGYGGGGGGYGGGGGG------YGGGGDGGGG 157 >At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 646 Score = 37.1 bits (82), Expect = 0.018 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GG GG GG G GG G G P GG A GG G GG Sbjct: 580 GGYGGVPGGGYGAMPGGYGPVPGG-GYGNVPGGGYAPYGRGGGAYYGPGG 628 Score = 34.7 bits (76), Expect = 0.095 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = -3 Query: 965 GGGGGXXXXXRGGXGGXXGGXGXGXXPXG-GXAXGXGXGGGGGG 837 GGGG GG GG GG G G P G G G G G GG Sbjct: 569 GGGGADYYGGGGGYGGVPGG-GYGAMPGGYGPVPGGGYGNVPGG 611 Score = 33.1 bits (72), Expect = 0.29 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 965 GGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GGGGG GG G GG G P GG G G G GG Sbjct: 577 GGGGGYGGVPGGGYGAMPGGYGP--VPGGGYGNVPGGGYAPYGRGG 620 Score = 32.3 bits (70), Expect = 0.51 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 935 RGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXW 810 RGG GG G G GG G G GG G G W Sbjct: 55 RGGYGGANSGYGGRGQGYGGRGSGYGGRGGPVGGWNARSGGW 96 >At3g50130.1 68416.m05480 expressed protein ; expression supported by MPSS Length = 564 Score = 37.1 bits (82), Expect = 0.018 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP--PXPPF 981 PP PPPPPP PP PP PPPPP P PF Sbjct: 9 PPPPPPPPPSFRSIPRPPPPPSFRSIPPRRHFFKKKSKSLPPPPPPLPPARPF 61 Score = 35.1 bits (77), Expect = 0.072 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXP--PXXPXPXPSXPXXXPPXPPXXP 976 PP P PPPPP RPPP P S P PP PP P Sbjct: 9 PPPP--PPPPPSFRSIPRPPPPPSFRSIPPRRHFFKKKSKSLPPPPPPLPPARP 60 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 37.1 bits (82), Expect = 0.018 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PPP PP P P P P PP PP P P Sbjct: 539 PRPPLPPPARARPLPPPARARPMPPPARARPLPPPARSYDRRPPVPLYP 587 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 831 PXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P P PPP PP P PPP P P PP P Sbjct: 539 PRPPLPPPARARPLPPP--ARARPMPPPARARPLPPPARSYDRRPPVP 584 >At2g28670.1 68415.m03485 disease resistance-responsive family protein / fibroin-related contains similarity to silk fibroin heavy chain [Bombyx mori] gi|765323|gb|AAB31861; contains disease resistance response protien domain Pfam:FP03018 Length = 447 Score = 37.1 bits (82), Expect = 0.018 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G G G G G GG G G GG G GGGG G G G Sbjct: 134 GGGPGAGSALGGGAGAGPALGGGAGAGPALGGGAGAGSALGGGGAGAGPALGG 186 Score = 36.3 bits (80), Expect = 0.031 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPX---GGXAXGXGXGGGGGGXGGXXXG 816 GG G G G G GG G G P GG G GGG G G G Sbjct: 155 GGAGAGPALGGGAGAGSALGGGGAGAGPALGGGGAGAGPALGGGVAGSGSALGG 208 Score = 35.1 bits (77), Expect = 0.072 Identities = 23/58 (39%), Positives = 23/58 (39%), Gaps = 4/58 (6%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXX---GGXGXGXXPXGGXAX-GXGXGGGGGGXGGXXXG 816 G GGG G GG G GG G G GG A G GGGG G G G Sbjct: 140 GSALGGGAGAGPALGGGAGAGPALGGGAGAGSALGGGGAGAGPALGGGGAGAGPALGG 197 Score = 35.1 bits (77), Expect = 0.072 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPX-GGXAXGXGXGGGGGGXGG 828 G G G G G G GG G G P GG G G GGG G Sbjct: 164 GGGAGAGSALGGGGAGAGPALGGGGAGAGPALGGGVAGSGSALGGGASAG 213 Score = 34.7 bits (76), Expect = 0.095 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXG--XGGG 817 G G G G G G GG G GGG GGGG G GGG Sbjct: 144 GGGAGAGPALGGGAGAGPALGGGAGAGSALGGGGAGAGPALGGGGAGAGPALGGG 198 Score = 33.5 bits (73), Expect = 0.22 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G G G G G GG G G GG G GGG G G Sbjct: 124 GAGAGTGSALGGGPGAGSALGGGAGAGPALGGGAGAGPALGGGAGAGSALGGG 176 Score = 33.1 bits (72), Expect = 0.29 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 4/53 (7%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXG-GXGXGXXPXGGXAXGXGXGGG---GGGXG 831 G GGG G G G G G P G A G G G G GGG G Sbjct: 106 GSLAGGGSGSLPTTGSATGAGAGTGSALGGGPGAGSALGGGAGAGPALGGGAG 158 Score = 33.1 bits (72), Expect = 0.29 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 4/54 (7%) Frame = -3 Query: 977 GGXGGG---GGGXXXXXRGGXGGXXGGXGXGXXPXG-GXAXGXGXGGGGGGXGG 828 GG G G GGG G GG G G G G A G G G G GG Sbjct: 155 GGAGAGPALGGGAGAGSALGGGGAGAGPALGGGGAGAGPALGGGVAGSGSALGG 208 Score = 31.5 bits (68), Expect = 0.88 Identities = 25/88 (28%), Positives = 29/88 (32%), Gaps = 3/88 (3%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRVSX 797 GG G G G G G GGG G GG GGG G G + Sbjct: 154 GGGAGAGPALGGGAGAGSALGGGGAGAGPALGGGGAGAGPALGGGVAGSGSALGGGASAG 213 Query: 796 AXGSQXFXQXD---*SNDXNRQELGIVS 722 + F D SN R G+V+ Sbjct: 214 PDNTLVFFMHDILGGSNPTARAVTGVVA 241 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = -1 Query: 967 GGXGGGXXGXXGXGXG-GXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 GG G G G G G GGG G GG GGGG G Sbjct: 145 GGAGAGPALGGGAGAGPALGGGAGAGSALGGGGAGAGPALGGGGAGAG 192 >At2g05530.1 68415.m00585 glycine-rich protein Length = 115 Score = 37.1 bits (82), Expect = 0.018 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -3 Query: 932 GGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GG G G G GG G G GGGG GG G Sbjct: 43 GGHGGNGGYNGGGGYNGGGGHNGGGYNGGGGYNGGGHGG 81 Score = 33.1 bits (72), Expect = 0.29 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = -1 Query: 982 GXGGXGGX--GGGXXGXXGXGXGGXGGGXGXXXXXXGG 875 G GG GG GGG G G GG GG G GG Sbjct: 44 GHGGNGGYNGGGGYNGGGGHNGGGYNGGGGYNGGGHGG 81 Score = 29.9 bits (64), Expect = 2.7 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGG 837 GG GG GG GG G GG G GG G G GGG G Sbjct: 43 GGHGGNGG-----YNGGGGYNGGGGHNG----GGYNGGGGYNGGGHG 80 >At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / heat shock transcription factor 7 (HSTF7) identical to heat shock factor protein 7 (HSF7) SP:Q9T0D3 from [Arabidopsis thaliana] Length = 377 Score = 36.7 bits (81), Expect = 0.024 Identities = 21/45 (46%), Positives = 23/45 (51%) Frame = -3 Query: 929 GXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXWXSEXS 795 G GG GG G GG + G G GGGGGG GG G S+ S Sbjct: 14 GVGG--GGAGCSAGNSGGSS-GCGAGGGGGGSGGGGGGGGDSQRS 55 Score = 35.9 bits (79), Expect = 0.041 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGG 837 G GGGG G GG G G G G G G GGGGGG Sbjct: 14 GVGGGGAGCSAGNSGGSSGCGAGGGGG---------GSGGGGGGGG 50 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 932 GGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 GG G G G G G G GGGGGG G Sbjct: 17 GGGAGCSAGNSGGSSGCGAGGGGGGSGGGGGGGG 50 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -3 Query: 932 GGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG G G G G G GGGGG GG Sbjct: 16 GGGGAGCSAGNSGGSSGCGAGGGGGGSGGGGGGGG 50 >At3g02670.1 68416.m00258 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 217 Score = 36.7 bits (81), Expect = 0.024 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P P PP G P PP PP+ P P PP PP Sbjct: 147 PGIPGSPGFRLPFPFPPSGGGIPGLPLPFPPLPPVTIPGLPLPFPPLPP 195 Score = 35.5 bits (78), Expect = 0.054 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 831 PXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P P P PP P P PP P P P P PP PP Sbjct: 147 PGIPGSPGFRLPFPFPPSGGGIPGLPLPFPPLPPVTIPGLPLPFPPLPP 195 >At2g04170.1 68415.m00402 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to NtN2 [Medicago truncatula] GI:3776084; contains Pfam profile PF00917: MATH domain Length = 420 Score = 36.7 bits (81), Expect = 0.024 Identities = 23/65 (35%), Positives = 23/65 (35%), Gaps = 7/65 (10%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXX-------PXGGXAXGXGXGGGGGGXGGXXXG 816 G G G G RG G GG G G P GG G G G G GG G Sbjct: 63 GFGPRGPGPWSGPRGPRPGGGGGPGPGPWSGPRGPRPGGGGGPGSGCGSGTGGGNQGQGG 122 Query: 815 XWXSE 801 W E Sbjct: 123 MWRDE 127 Score = 35.9 bits (79), Expect = 0.041 Identities = 21/63 (33%), Positives = 21/63 (33%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXWXSEX 798 GG G G GG G G G G G P G G GG GG G W Sbjct: 36 GGPGFGPGGPGFGPGGPGFGGRGPRGPGFGPRGPGPWSGPRGPRPGGGGGPGPGPWSGPR 95 Query: 797 SXR 789 R Sbjct: 96 GPR 98 Score = 33.5 bits (73), Expect = 0.22 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 GG GGG G RGG G G G G P G G G G GG G Sbjct: 4 GGCGGGPG------RGGRGFGGRGGGPGFGPGGPGFGPGGPGFGPGGPG 46 >At1g70140.1 68414.m08071 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 760 Score = 36.7 bits (81), Expect = 0.024 Identities = 19/56 (33%), Positives = 20/56 (35%), Gaps = 7/56 (12%) Frame = +1 Query: 832 PXPPPPPPX-------PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PPPPPP P P PP P PP PP + PP P Sbjct: 236 PTPPPPPPSIAVKQSAPTPSPPPPIKKGSSPSPPPPPPVKKVGALSSSASKPPPAP 291 Score = 36.3 bits (80), Expect = 0.031 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 Q P P PPP P A P P PP P PPPPPP Sbjct: 226 QPPPQVKQSEPTPPPPPPSIAVKQSAPTPSPPPPIKKGSSP-----SPPPPPP 273 Score = 31.9 bits (69), Expect = 0.67 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PPP P PP P PP P PPP PP Sbjct: 227 PPPQVKQSEPTPPPPPPSIAVKQSAPTPSPPPPIKKGSSPSPPPPPP 273 Score = 31.9 bits (69), Expect = 0.67 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXP 965 P P PPPPP + P P P PP P PPP P Sbjct: 229 PQVKQSEPTPPPPPPSIAVKQ-------SAPTPSPPPPIKKGSSPSPPPPPP 273 >At5g61660.1 68418.m07736 glycine-rich protein Length = 134 Score = 36.3 bits (80), Expect = 0.031 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 G G G G G G G G G GG G G G GGG GG Sbjct: 68 GWGRGSGYGYGSGSGSGTGYGYGSGGGGARGGGYGYGSGNGRSGGGGGG 116 Score = 35.5 bits (78), Expect = 0.054 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G G G G G G G G GGG G GGGGG G Sbjct: 70 GRGSGYGYGSGSGSGTGYGYGSGGGGARGGGYGYGSGNGRSGGGGGGGGFNG 121 Score = 32.7 bits (71), Expect = 0.38 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G G G G G G G G G G G G GGGG G G Sbjct: 49 GSAPGSGWGYGAGSGRSPTGWGRGSGYGYGSGSGSGTGYGYGSGGGGARGGGYG 102 Score = 32.7 bits (71), Expect = 0.38 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXG 830 G G G G G G G G GG G G GGGGG G Sbjct: 68 GWGRGSGYGYGSGSGSGTGYGYGSGGGGARGGGYGYGSGNGRSGGGGGGGG 118 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G G G G G G G G G G G G GG GG G G Sbjct: 53 GSGWGYGAGSGRSPTGWGRGSGYGYGSGSGSGTGYGYGSGGGGARGGGYGYGSG 106 >At5g59170.1 68418.m07416 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 288 Score = 36.3 bits (80), Expect = 0.031 Identities = 21/56 (37%), Positives = 22/56 (39%), Gaps = 6/56 (10%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP---XPPLXXXXXPP---PPPPXPP 978 PP PPP P P PP P P PP PP+ PP PPP P Sbjct: 53 PPKPPPIEKYPPPVQYPPPIKKYPPPPYEHPPVKYPPPIKTYPHPPVKYPPPEQYP 108 Score = 36.3 bits (80), Expect = 0.031 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 7/63 (11%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP----PPP---P 969 Q P PPP P P PP P PP P PP PP PPP P Sbjct: 197 QYPPPIKKYPPPIKKYPPPEEYPPP-IKTYPHPPVKYPPPPYKTYPHPPIKTYPPPKECP 255 Query: 970 XPP 978 PP Sbjct: 256 PPP 258 Score = 34.3 bits (75), Expect = 0.13 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 5/60 (8%) Frame = +1 Query: 817 PXXXPPXPPPPP----PXPXPXAXPPXGXXPXPXPPXXPPXP-PLXXXXXPPPPPPXPPF 981 P PP PPP P P P PP P P PP P PPP PPF Sbjct: 79 PYEHPPVKYPPPIKTYPHP-PVKYPPPEQYPPPIKKYPPPEQYPPPIKKYPPPEQYSPPF 137 Score = 33.5 bits (73), Expect = 0.22 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXP-PLXXXXXPPPPPPXPP 978 Q P PPPP P PP P P PP P PPP PP Sbjct: 67 QYPPPIKKYPPPPYEHPPVKYPPPIKTYPHPPVKYPPPEQYPPPIKKYPPPEQYPPP 123 Score = 33.5 bits (73), Expect = 0.22 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 7/53 (13%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXP-PXPPLXXXXXP---PPPP---PXPP 978 PPP P P P P PP P PP+ P PPPP P PP Sbjct: 213 PPPEEYPPPIKTYPHPPVKYPPPPYKTYPHPPIKTYPPPKECPPPPEHYPWPP 265 Score = 33.1 bits (72), Expect = 0.29 Identities = 22/67 (32%), Positives = 24/67 (35%), Gaps = 10/67 (14%) Frame = +1 Query: 811 QXPXXXPPXPPP---PPP----XPXPXAXPPXGXXPXPXPPXXPP---XPPLXXXXXPPP 960 Q P PPP PPP P PP P P PP PP+ PP Sbjct: 171 QYPPPIKKYPPPEKYPPPIKKYPPPEQYPPPIKKYPPPIKKYPPPEEYPPPIKTYPHPPV 230 Query: 961 PPPXPPF 981 P PP+ Sbjct: 231 KYPPPPY 237 Score = 33.1 bits (72), Expect = 0.29 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXP--XXPPPXP-PXPP 977 PP PPPP PP P P PP P P PPP P PP Sbjct: 228 PPVKYPPPPYKTYPH-PPIKTYPPPKECPPPPEHYPWPPKKKYPPPVEYPSPP 279 Score = 32.7 bits (71), Expect = 0.38 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PPP PPPP PPP P PP P P PP Sbjct: 69 PPPIKKYPPPPYEHPPVKYPPPIKTYP--HPPVKYPPPEQYPPPIKKYPP 116 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P PP PPP PP PPP P P PP P P Sbjct: 57 PPIEKYPPPVQYPPPIKKYP-PPPYEHPPVKYPPPIKTYPHPPVKYPPPEQYPPP 110 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAX-PPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PPP P P PP P P PP PPP PP Sbjct: 98 PVKYPPPEQYPPPIKKYPPPEQYPPPIKKYPPPEQYSPPFKKYPPPEQYPP 148 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 Q P PPP P PP P P PP PPP PP Sbjct: 145 QYPPPIKKYPPPEHYPPPIKKYPPQEQYPPPIKKYPPPEKYPPPIKKYPPPEQYPP 200 Score = 29.9 bits (64), Expect = 2.7 Identities = 17/59 (28%), Positives = 19/59 (32%), Gaps = 1/59 (1%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXR-PPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 +S PPP PPP + PPP P P P P PP P Sbjct: 51 YSPPKPPPIEKYPPPVQYPPPIKKYPPPPYEHPPVKYPPPIKTYPHPPVKYPPPEQYPP 109 Score = 29.1 bits (62), Expect = 4.7 Identities = 17/58 (29%), Positives = 18/58 (31%), Gaps = 2/58 (3%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPP--XPXPXXPXXPPPXPPXPP 977 P PP PP + PP P P PP P P PP PP Sbjct: 47 PKFPYSPPKPPPIEKYPPPVQYPPPIKKYPPPPYEHPPVKYPPPIKTYPHPPVKYPPP 104 Score = 29.1 bits (62), Expect = 4.7 Identities = 20/61 (32%), Positives = 21/61 (34%), Gaps = 5/61 (8%) Frame = +3 Query: 810 PTXXXXPPXX--PPPPPXXXXXRXPPXXXXXXPXPPPXPPXP---XPXXPXXPPPXPPXP 974 P PP PPPP + PP P PP P P P PPP P Sbjct: 64 PPVQYPPPIKKYPPPPYEHPPVKYPPPIKTY-PHPPVKYPPPEQYPPPIKKYPPPEQYPP 122 Query: 975 P 977 P Sbjct: 123 P 123 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 2/52 (3%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP--PPPXPP 978 P P PP P PP P P PP PPP P PP Sbjct: 47 PKFPYSPPKPPPIEKYPPPVQYPPPIKKYPPPPYEHPPVKYPPPIKTYPHPP 98 Score = 28.3 bits (60), Expect = 8.2 Identities = 24/93 (25%), Positives = 27/93 (29%), Gaps = 5/93 (5%) Frame = +3 Query: 714 PPPETMPSSCR-FXSXDQSXCXXX*LPXAXLTLPTXXXXPPXX--PPPPPXXXXXRXPPX 884 PPPE P + + +Q P P PP PPP P Sbjct: 115 PPPEQYPPPIKKYPPPEQYSPPFKKYPPPEQYPPPIKKYPPPEHYPPPIKKYPPQEQYPP 174 Query: 885 XXXXXPXPPPXPP--XPXPXXPXXPPPXPPXPP 977 P P PP P PPP PP Sbjct: 175 PIKKYPPPEKYPPPIKKYPPPEQYPPPIKKYPP 207 Score = 28.3 bits (60), Expect = 8.2 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 4/50 (8%) Frame = +1 Query: 841 PPPPPXPXP-XAXPPXGXXPXP---XPPXXPPXPPLXXXXXPPPPPPXPP 978 PPP P P PP P P PP PP+ PPP PP Sbjct: 141 PPPEQYPPPIKKYPPPEHYPPPIKKYPPQEQYPPPIKKY---PPPEKYPP 187 >At4g38770.1 68417.m05490 proline-rich family protein (PRP4) similar to proline-rich protein [Arabidopsis thaliana] gi|6782442|gb|AAF28388; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 448 Score = 36.3 bits (80), Expect = 0.031 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PP P P P P PP P PP P P P PP P Sbjct: 365 PIYIPPIVKKPCPPPVPIYKPPVVIPKKPCPPPVPVYKPPVVVIPKKPCPPLP 417 Score = 35.5 bits (78), Expect = 0.054 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 8/54 (14%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPX----PPLXXXXXPPP----PPPXP 975 PPP P P P PP P P P PP PP PPP PPP P Sbjct: 238 PPPIPKKPCPPK-PPKIEHPPPVPVYKPPPKIEKPPPVPVYKPPPKIEHPPPVP 290 Score = 35.1 bits (77), Expect = 0.072 Identities = 19/55 (34%), Positives = 20/55 (36%), Gaps = 4/55 (7%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP----PPPXPPF 981 PP P P P PP P P P PP PPP PPP P + Sbjct: 223 PPPVPVYKPPPKVELPPPIPKKPCPPKPPKIEHPPPVPVYKPPPKIEKPPPVPVY 277 Score = 35.1 bits (77), Expect = 0.072 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 2/57 (3%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP--PPXPPF 981 P P PPP P P P P P P PP + PP P PP P F Sbjct: 370 PIVKKPCPPPVPIYKPPVVIPKK-PCPPPVPVYKPPVVVIPKKPCPPLPQLPPLPKF 425 Score = 34.7 bits (76), Expect = 0.095 Identities = 22/87 (25%), Positives = 25/87 (28%), Gaps = 1/87 (1%) Frame = +3 Query: 720 PETMPSSCRFXSXDQSXCXXX*LPXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXX 899 P +P + C P + P PP PP PP Sbjct: 165 PFPLPPPLELPPFLKKPCPPKYSPPVEVPPPVPVYEPPPKKEIPPPVPVYDPPPKKEVPP 224 Query: 900 PXPPPXPPXPXPXXPXXP-PPXPPXPP 977 P P PP P P P PP PP Sbjct: 225 PVPVYKPPPKVELPPPIPKKPCPPKPP 251 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 5/51 (9%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP-----XPPLXXXXXPPPPP 966 PP PPP P PP P P P PP PP+ PP PP Sbjct: 202 PPKKEIPPPVPV-YDPPPKKEVPPPVPVYKPPPKVELPPPIPKKPCPPKPP 251 Score = 33.9 bits (74), Expect = 0.17 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 5/59 (8%) Frame = +1 Query: 817 PXXXPPXPPPPP-PXPXPXAXPPXGXXPXPXPPXXPPX----PPLXXXXXPPPPPPXPP 978 P PP PPP P P PP P P P PP PP PPP PP Sbjct: 184 PKYSPPVEVPPPVPVYEP---PPKKEIPPPVPVYDPPPKKEVPPPVPVYKPPPKVELPP 239 Score = 33.9 bits (74), Expect = 0.17 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = +1 Query: 811 QXPXXXPPXPPPPP---PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 + P P PPP P P P PP P P P PP P P P PP Sbjct: 191 EVPPPVPVYEPPPKKEIPPPVPVYDPPPKKEVPPPVPVYKP-PPKVELPPPIPKKPCPP 248 Score = 33.9 bits (74), Expect = 0.17 Identities = 21/70 (30%), Positives = 23/70 (32%), Gaps = 7/70 (10%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXP----PPXPPX---PXPXXPX 947 P + P PP PP + PP P P PP PP P P Sbjct: 203 PKKEIPPPVPVYDPPPKKEVPPPVPVYKPPPKVELPPPIPKKPCPPKPPKIEHPPPVPVY 262 Query: 948 XPPPXPPXPP 977 PPP PP Sbjct: 263 KPPPKIEKPP 272 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/52 (34%), Positives = 20/52 (38%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 + P P PPP P PP P P PP PP+ P PPP Sbjct: 347 EHPPPVPVYKPPPKIEHPPIYIPPIVKKPCP-PPVPIYKPPVVIPKKPCPPP 397 Score = 33.9 bits (74), Expect = 0.17 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = +1 Query: 817 PXXXPPX--PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 P PP P P P P P PP P P P PPL PP PP Sbjct: 381 PIYKPPVVIPKKPCPPPVPVYKPPVVVIPKKPCPPLPQLPPL--PKFPPLPP 430 Score = 33.5 bits (73), Expect = 0.22 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXP-PXXPPXPPLXXXXXPPPPPPXPP 978 PP PPP P PP P P P PP PP PPP P P Sbjct: 217 PPKKEVPPPVPV-YKPPPKVELPPPIPKKPCPPKPP--KIEHPPPVPVYKP 264 Score = 33.1 bits (72), Expect = 0.29 Identities = 19/57 (33%), Positives = 20/57 (35%), Gaps = 4/57 (7%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRP-PPXXXXPXXXP---PXXPXPXPSXPXXXPPXPPXXP 976 PPP PPP P +P PP P P P P P PP P P Sbjct: 279 PPPKIEHPPPVPVHKLPKKPCPPKKVDPPPVPVHKPPTKKPCPPKKVDPPPVPVHKP 335 Score = 33.1 bits (72), Expect = 0.29 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 4/54 (7%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP----XPPLXXXXXPPPPPPXPP 978 PP P PP P PP P P P PP PP PP P PP Sbjct: 307 PPVPVHKPPTKKPC--PPKKVDPPPVPVHKPPPKIVIPPPKIEHPPPVPVYKPP 358 Score = 32.7 bits (71), Expect = 0.38 Identities = 19/59 (32%), Positives = 20/59 (33%), Gaps = 6/59 (10%) Frame = +2 Query: 818 PPPXPXXPPPP----PXXXXXXRPPPXXXXPXXXP--PXXPXPXPSXPXXXPPXPPXXP 976 PPP P PPP P +PPP P P P P PP P P Sbjct: 256 PPPVPVYKPPPKIEKPPPVPVYKPPPKIEHPPPVPVHKLPKKPCPPKKVDPPPVPVHKP 314 Score = 32.3 bits (70), Expect = 0.51 Identities = 23/63 (36%), Positives = 24/63 (38%), Gaps = 13/63 (20%) Frame = +1 Query: 832 PXPPP---PP--PXPXPXAXPPXGXXPXPXPPXXPPX----PPLXXXXXPPP----PPPX 972 P PPP PP P P P P P P PP PP PPP PPP Sbjct: 167 PLPPPLELPPFLKKPCPPKYSPPVEVPPPVPVYEPPPKKEIPPPVPVYDPPPKKEVPPPV 226 Query: 973 PPF 981 P + Sbjct: 227 PVY 229 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 4/57 (7%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP----PPPXP 975 P PP P P P PP P PP PP PPP PPP P Sbjct: 189 PVEVPPPVPVYEPPPKKEIPPP---VPVYDPPPKKEVPPPVPVYKPPPKVELPPPIP 242 Score = 32.3 bits (70), Expect = 0.51 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PP PPP P PP P P P P P PPP P Sbjct: 265 PPKIEKPPPVPV-YKPPPKIEHPPPVPVHKLPKKPCPPKKVDPPPVP 310 Score = 32.3 bits (70), Expect = 0.51 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +1 Query: 829 PPXP--PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP P PPP P P P PP PP+ PP P PP Sbjct: 272 PPVPVYKPPPKIEHPPPVPVHKLPKKPCPPKKVDPPPV-PVHKPPTKKPCPP 322 Score = 31.5 bits (68), Expect = 0.88 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 3/52 (5%) Frame = +1 Query: 832 PXPPPPP---PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PPP P PP P PP P P PPP P P Sbjct: 165 PFPLPPPLELPPFLKKPCPPKYSPPVEVPPPVPVYEPPPKKEIPPPVPVYDP 216 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 7/63 (11%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXP----XPPPXPPXPXPXXP---XXPPPXPP 968 P PP P P PP P PPP P P P P PPP P Sbjct: 202 PPKKEIPPPVPVYDPPPKKEVPPPVPVYKPPPKVELPPPIPKKPCPPKPPKIEHPPPVPV 261 Query: 969 XPP 977 P Sbjct: 262 YKP 264 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PPP PPP P + PP P P P P P PP P P Sbjct: 231 PPPKVELPPPIPKKPCPPK-PPKIEHPPPVPVYKPPPKIEKP---PPVPVYKP 279 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/58 (31%), Positives = 19/58 (32%), Gaps = 3/58 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXP---PLXXXXXPPPPPPXPPF 981 P P P P P PP P P PP P P P PPP P + Sbjct: 344 PKIEHPPPVPVYKPPPKIEHPPIYIPPIVKKPCPPPVPIYKPPVVIPKKPCPPPVPVY 401 Score = 29.5 bits (63), Expect = 3.6 Identities = 17/58 (29%), Positives = 17/58 (29%), Gaps = 2/58 (3%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXP--PPXPPXPXPXXPXXPPPXPPXPP 977 P PP P P PP P PP P P PP P PP Sbjct: 265 PPKIEKPPPVPVYKPPPKIEHPPPVPVHKLPKKPCPPKKVDPPPVPVHKPPTKKPCPP 322 Score = 29.5 bits (63), Expect = 3.6 Identities = 19/59 (32%), Positives = 20/59 (33%), Gaps = 5/59 (8%) Frame = +1 Query: 817 PXXXPPXPPPPP---PXPXPXAXPPXGXXPXPXPPXXPP--XPPLXXXXXPPPPPPXPP 978 P P PPP P P PP P PP PP+ PPP P P Sbjct: 327 PPPVPVHKPPPKIVIPPPKIEHPPPVPVYKPPPKIEHPPIYIPPIVKKPCPPPVPIYKP 385 Score = 29.1 bits (62), Expect = 4.7 Identities = 19/62 (30%), Positives = 20/62 (32%), Gaps = 5/62 (8%) Frame = +3 Query: 807 LPTXXXXPPX-XPPPPPXXXXXRXPPXXXXXXP----XPPPXPPXPXPXXPXXPPPXPPX 971 +P P PPP P PP P PPP P P PPP Sbjct: 226 VPVYKPPPKVELPPPIPKKPCPPKPPKIEHPPPVPVYKPPPKIEKPPPVPVYKPPPKIEH 285 Query: 972 PP 977 PP Sbjct: 286 PP 287 Score = 29.1 bits (62), Expect = 4.7 Identities = 20/60 (33%), Positives = 21/60 (35%), Gaps = 10/60 (16%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPX---------PPLXXXXXPPP-PPPXPP 978 PP P P P PP P P P PP PP+ PPP P PP Sbjct: 327 PPPVPVHKPPPKIVIPPPKIEHPPPVPVYKPPPKIEHPPIYIPPIVKKPCPPPVPIYKPP 386 Score = 28.7 bits (61), Expect = 6.2 Identities = 20/71 (28%), Positives = 22/71 (30%), Gaps = 8/71 (11%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPP-----PXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXP 953 P + LP P P PP P + PP P P PP P P Sbjct: 231 PPPKVELPPPIPKKPCPPKPPKIEHPPPVPVYKPPPKIEKPPPVPVYKPPPKIEHPPPVP 290 Query: 954 P---PXPPXPP 977 P P PP Sbjct: 291 VHKLPKKPCPP 301 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PP PPP P +PPP P P P P P PP P Sbjct: 250 PPKIEHPPPVP----VYKPPPKIEKPPPVPVYKPPPKIEHP---PPVP 290 Score = 28.3 bits (60), Expect = 8.2 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = +1 Query: 829 PPXPPPPP---PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PP P P P PP P PP PP+ PPP PP Sbjct: 295 PKKPCPPKKVDPPPVPVHKPPT---KKPCPPKKVDPPPVPV-HKPPPKIVIPP 343 >At4g34440.1 68417.m04894 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 670 Score = 36.3 bits (80), Expect = 0.031 Identities = 19/60 (31%), Positives = 21/60 (35%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 P + T P+ PP P PP PP PPP PP P P PP Sbjct: 19 PPSNGTSPSNESSPPTPPSSPPPSSISAPPPDISASFS-PPPAPPTQETSPPTSPSSSPP 77 Score = 34.7 bits (76), Expect = 0.095 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = +1 Query: 829 PPXPPPPPPXPX--PXAXPPXGXXPXPXPPXXPPXP-PLXXXXXPPPPPPXPP 978 PP PP P P + PP P P P P P P PP PP P Sbjct: 58 PPAPPTQETSPPTSPSSSPPVVANPSPQTPENPSPPAPEGSTPVTPPAPPQTP 110 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/52 (28%), Positives = 15/52 (28%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PP PPP PPP PP P P P P P Sbjct: 39 PPPSSISAPPPDISASFSPPPAPPTQETSPPTSPSSSPPVVANPSPQTPENP 90 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P P + PP P PP PP P P PP Sbjct: 32 PPTPPSSPPPSSISAPPPDISASFSP---PPAPPTQETSPPTSPSSSPP 77 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 P PP P P PP P P PP P P PP Sbjct: 72 PSSSPPVVANPSPQTPENPSPPAPEGSTPVTPPAPPQTPSNQSPERPTPP 121 Score = 29.5 bits (63), Expect = 3.6 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXP--PXXPXPXPSXPXXXPPXPPXXP 976 PPP P P PP P P P P S P PP PP P Sbjct: 57 PPPAPPTQETSPPTSPSSSPPVVANPSPQTPENPSPPAPEGSTPVT-PPAPPQTP 110 Score = 29.5 bits (63), Expect = 3.6 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 3/56 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXP-PXGXXPXPXPPXXPPXPPLXXXXXPP--PPPPXP 975 P P PP P P P P P PP PP P P PP P Sbjct: 68 PPTSPSSSPPVVANPSPQTPENPSPPAPEGSTPVTPPAPPQTPSNQSPERPTPPSP 123 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/44 (29%), Positives = 15/44 (34%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PP P + PP P P P + PPP PP Sbjct: 19 PPSNGTSPSNESSPPTPPSSPPPSSISAPPPDISASFSPPPAPP 62 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 36.3 bits (80), Expect = 0.031 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 5/55 (9%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPX-GXXPXPXPPXX----PPXPPLXXXXXPPPPPPXPP 978 PP PPP PP G P PP PP PP PPP P PP Sbjct: 184 PPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPHGMQGPPPPRPGMPP 238 Score = 34.7 bits (76), Expect = 0.095 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 9/55 (16%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPX-----PPXPXPXXPXXP----PPXPPXPP 977 PPPP PP PPP PP P P P P PP P PP Sbjct: 198 PPPPQYGQRPMIPPPGGMMRGPPPPPHGMQGPPPPRPGMPPAPGGFAPPRPGMPP 252 Score = 32.3 bits (70), Expect = 0.51 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 4/56 (7%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPP----XXPXPXPSXPXXXPPXPPXXP 976 PP P PPP PP P PP P P P PP P P Sbjct: 182 PPPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPHGMQGPPPPRPGMP 237 Score = 29.5 bits (63), Expect = 3.6 Identities = 22/68 (32%), Positives = 24/68 (35%), Gaps = 10/68 (14%) Frame = +1 Query: 805 LXQXPXXXPPXPP----PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP--- 963 + + P P PP PP P PP G P P PP P PPP Sbjct: 158 IIRPPGQMLPPPPFGGQGPPMGRGP--PPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGM 215 Query: 964 ---PPXPP 978 PP PP Sbjct: 216 MRGPPPPP 223 Score = 29.1 bits (62), Expect = 4.7 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PP PPPP PPP PP P P P P Sbjct: 191 PPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPHGMQGPPPPRPGMPPAP 240 Score = 28.7 bits (61), Expect = 6.2 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 7/57 (12%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPX-------PPXPXPXXPXXPPPXPPXPP 977 PP PPP PP PPP PP P PPP P PP Sbjct: 184 PPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPHGMQGP--PPPRPGMPP 238 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 36.3 bits (80), Expect = 0.031 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 5/55 (9%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPX-GXXPXPXPPXX----PPXPPLXXXXXPPPPPPXPP 978 PP PPP PP G P PP PP PP PPP P PP Sbjct: 184 PPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPHGMQGPPPPRPGMPP 238 Score = 34.7 bits (76), Expect = 0.095 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 9/55 (16%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPX-----PPXPXPXXPXXP----PPXPPXPP 977 PPPP PP PPP PP P P P P PP P PP Sbjct: 198 PPPPQYGQRPMIPPPGGMMRGPPPPPHGMQGPPPPRPGMPPAPGGFAPPRPGMPP 252 Score = 32.3 bits (70), Expect = 0.51 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 4/56 (7%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPP----XXPXPXPSXPXXXPPXPPXXP 976 PP P PPP PP P PP P P P PP P P Sbjct: 182 PPPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPHGMQGPPPPRPGMP 237 Score = 29.5 bits (63), Expect = 3.6 Identities = 22/68 (32%), Positives = 24/68 (35%), Gaps = 10/68 (14%) Frame = +1 Query: 805 LXQXPXXXPPXPP----PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP--- 963 + + P P PP PP P PP G P P PP P PPP Sbjct: 158 IIRPPGQMLPPPPFGGQGPPMGRGP--PPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGM 215 Query: 964 ---PPXPP 978 PP PP Sbjct: 216 MRGPPPPP 223 Score = 29.1 bits (62), Expect = 4.7 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PP PPPP PPP PP P P P P Sbjct: 191 PPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPHGMQGPPPPRPGMPPAP 240 Score = 28.7 bits (61), Expect = 6.2 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 7/57 (12%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPX-------PPXPXPXXPXXPPPXPPXPP 977 PP PPP PP PPP PP P PPP P PP Sbjct: 184 PPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPHGMQGP--PPPRPGMPP 238 >At3g26120.1 68416.m03257 RNA-binding protein, putative similar to GB:AAC39463 from [Zea mays], PF00076 RNA recognition motif (2 copies) Length = 615 Score = 36.3 bits (80), Expect = 0.031 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 5/54 (9%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXX-----PPXPPLXXXXXPPPPPPXPP 978 P PPPP P P PP P P P P+ PP PPP PP Sbjct: 33 PYTPPPPQLPPPL--PPSSYGLSPTEPRVFTFFNIPPHPMMFSPPPPQPPPPPP 84 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +2 Query: 821 PPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PP P PPP P P P P P PP PP Sbjct: 36 PPPPQLPPPLPPSSYGLSPTEPRVFTFFNIPPHPMMFSPPPPQPPPPPP 84 Score = 29.9 bits (64), Expect = 2.7 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 H PPP PP PP P PP P P PP PP P Sbjct: 31 HFPYTPPPPQLPPPLPPSSYGLSPTEPRVFTFFNIPPHPMMFSP--PPPQPPPPPPRP 86 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXP 921 PP P PPPP P P P P P Sbjct: 74 PPPPQPPPPPPRPCFNGVSAAQRLPLPSNTP 104 >At3g11402.1 68416.m01388 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 708 Score = 36.3 bits (80), Expect = 0.031 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 4/50 (8%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXP----PXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 PP PPPPPP P P P PP PP PPPPP Sbjct: 32 PPPPPPPPPPVLPHIRSRKKMDIKEVHLPLPRHYPPPPP----PLPPPPP 77 Score = 36.3 bits (80), Expect = 0.031 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PPPPPP P P P P PPPPPP PP Sbjct: 32 PPPPPPPPPPVLPHIRSRKKMDIKEVHLPLP----RHYPPPPPPLPP 74 Score = 32.3 bits (70), Expect = 0.51 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PPPPP R P P P PPP PP PP Sbjct: 33 PPPPPPPPPVLPHIRSRKKMDIKEVHLPLPRHYPPP-----PPPLPPPPP 77 Score = 28.3 bits (60), Expect = 8.2 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 818 PPPXPXXPPPPP 853 PPP P PPPPP Sbjct: 66 PPPPPPLPPPPP 77 >At3g06130.1 68416.m00704 heavy-metal-associated domain-containing protein contains Pfam heavy metal associated domain PF00403 Length = 473 Score = 36.3 bits (80), Expect = 0.031 Identities = 20/54 (37%), Positives = 21/54 (38%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG GGG G +GG G G G GG GGGGGG G Sbjct: 265 GGGAGGGKGAGGGAKGGPGNQNQGGGKNGG--GGHPQDGKNGGGGGGPNAGKKG 316 Score = 35.1 bits (77), Expect = 0.072 Identities = 20/50 (40%), Positives = 21/50 (42%), Gaps = 4/50 (8%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXG----GXGXGXXPXGGXAXGXGXGGGGG 840 GG GGGG GG GG G G G GG + G GGGG Sbjct: 289 GGKNGGGGHPQDGKNGGGGGGPNAGKKGNGGGGPMAGGVSGGFRPMGGGG 338 Score = 33.1 bits (72), Expect = 0.29 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGG 840 G GG G GG GG G G G G G GGGG Sbjct: 251 GPAKNGGKGAPAAGGGGAGGGKGAGGGAKGGPGNQNQGGGKNGGGG 296 Score = 33.1 bits (72), Expect = 0.29 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = -3 Query: 977 GGXGGGGG--GXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 GG G GGG G G G GG GG G G G G GG G Sbjct: 270 GGKGAGGGAKGGPGNQNQGGGKNGGGGHPQDGKNGGGGGGPNAGKKGNGGGGPMAG 325 Score = 31.9 bits (69), Expect = 0.67 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 923 GGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG G G GG G G G GGG GG Sbjct: 250 GGPAKNGGKGAPAAGGGGAGGGKGAGGGAKGG 281 Score = 31.9 bits (69), Expect = 0.67 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = -1 Query: 973 GXGGXGGGXXGXXGXGXGGXGG-GXGXXXXXXGGXRXXXXXGGGGG 839 G GG GGG G G GG G G GG GGGGG Sbjct: 264 GGGGAGGG-KGAGGGAKGGPGNQNQGGGKNGGGGHPQDGKNGGGGG 308 Score = 31.9 bits (69), Expect = 0.67 Identities = 21/65 (32%), Positives = 22/65 (33%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRV 803 G G GG G G G G GGG G + GGGGG G G Sbjct: 265 GGGAGGGKGAGGGAKGGPGNQNQGGGKN---GGGGHPQDGKNGGGGGGPNAGKKGNGGGG 321 Query: 802 SXAXG 788 A G Sbjct: 322 PMAGG 326 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 920 GXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 G GG G G G GGGGGG GG Sbjct: 100 GKAGGGGGGNNNNNKKGQKNGGGGGGGGGGG 130 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = -3 Query: 959 GGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG +G GG G G GG G G GGG G Sbjct: 250 GGPAKNGGKGAPAAGGGGAGGGKGAGGGAKGGPGNQNQGGGKNG 293 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/53 (33%), Positives = 20/53 (37%) Frame = -2 Query: 975 GXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG G +G G G GG G GGG+ G G GGG Sbjct: 259 GAPAAGGGGAGGGKGAGGGAKGGP--GNQNQGGGKNGGGGHPQDGKNGGGGGG 309 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = -2 Query: 966 GGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGG 820 G GG +G G GG G GGG GG G GG Sbjct: 290 GKNGGGGHPQDGKNGGGGGGPNAGKKGNGGGGPMAGGVSGGFRPMGGGG 338 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 5/39 (12%) Frame = -3 Query: 977 GGXGGGGGGXXXXXR-----GGXGGXXGGXGXGXXPXGG 876 G GGGGGG + GG GG GG G P G Sbjct: 100 GKAGGGGGGNNNNNKKGQKNGGGGGGGGGGGNSNAPKMG 138 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 929 GXGGXXGGXGXGXXPXGGXAXGXGXGGGGGG 837 G G GG G G G GGGGGG Sbjct: 100 GKAGGGGGGNNNNNKKGQKNGGGGGGGGGGG 130 Score = 28.7 bits (61), Expect = 6.2 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAX-GXGXGGGGGG 837 G GG GG GG GG G G GG G G GGG Sbjct: 250 GGPAKNGGKGAPAAGG-GGAGGGKGAGGGAKGGPGNQNQGGGKNGGG 295 >At3g04640.1 68416.m00497 glycine-rich protein predicted proteins, Arabidopsis thaliana Length = 159 Score = 36.3 bits (80), Expect = 0.031 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 GGGGGG GG G GG G GG + G G G G Sbjct: 73 GGGGGGRGGGGFGGGGRSFGGGGSSSRGGGGSSSRGGGGSSSRGGG 118 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 964 GXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GGG G G G GG G G GG GG GG Sbjct: 73 GGGGGGRGGGGFGGGGRSFGGGGSSSRGGGGSSSRGGGGSSSRGGG 118 Score = 31.5 bits (68), Expect = 0.88 Identities = 16/40 (40%), Positives = 18/40 (45%) Frame = -3 Query: 935 RGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 +GG GG GG G G GG + G G GG G G Sbjct: 72 KGGGGGGRGGGGFG---GGGRSFGGGGSSSRGGGGSSSRG 108 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 6/52 (11%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGG------GXGXXXXXXGGXRXXXXXGGG 845 G G GG GGG G G GG G G GG R GGG Sbjct: 77 GGRGGGGFGGGGRSFGGGGSSSRGGGGSSSRGGGGSSSRGGGLRPIPIYGGG 128 Score = 28.3 bits (60), Expect = 8.2 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 G GG G GGG G G GG G GG GGG GG Sbjct: 73 GGGGGG-RGGGGFGGGGRSFGGGGSS------SRGGGGSSSRGGGGSSSRGG 117 >At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 839 Score = 36.3 bits (80), Expect = 0.031 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGG 875 G G GG GGG G G G GG GGG GG Sbjct: 780 GHHGGGGCGGGHHGGGGGGCGGCGGGGCGGGGDGGG 815 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGG 846 G GGGG GG GG GG G GG G G GGG Sbjct: 779 GGHHGGGGCGGGHHGGGGGGCGGCG------GGGCGGGGDGGG 815 Score = 31.9 bits (69), Expect = 0.67 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -3 Query: 929 GXGGXXGGXGXGXXPXGGXAXGXGXGG-GGGGXGG 828 G GG GG G GG G G GG GGGG GG Sbjct: 783 GGGGCGGGHHGGG---GGGCGGCGGGGCGGGGDGG 814 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 908 GXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G G GG G GGGGGG GG G Sbjct: 775 GYHHGGHHGGGGCGGGHHGGGGGGCGGCGGG 805 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 955 GGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGG 845 GG G G G G GGG G GG GGG Sbjct: 779 GGHHGGGGCGGGHHGGGGGGCGGCGGGGCGGGGDGGG 815 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = -2 Query: 921 GXXGGXXXGXXXXGGGRXXXXXXGGGG-GXXGXGGG 817 G GG G GGG GGGG G G GGG Sbjct: 780 GHHGGGGCGGGHHGGGGGGCGGCGGGGCGGGGDGGG 815 >At4g23140.2 68417.m03338 receptor-like protein kinase 5 (RLK5) identical to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam domain PF00069: Protein kinase domain; identical to cDNA receptor-like protein kinase 5 (RLK5) GI:13506746 Length = 680 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXP 903 PP PPPPPP + PP P Sbjct: 257 PPPPPPPPPRESLVSTPPISSSSLP 281 Score = 28.7 bits (61), Expect(2) = 0.037 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +1 Query: 829 PPXPPPPPPXP 861 PP PPPPPP P Sbjct: 254 PPLPPPPPPPP 264 Score = 26.2 bits (55), Expect(2) = 0.037 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 952 PPPPPPXPP 978 PPPPPP PP Sbjct: 257 PPPPPPPPP 265 >At4g23140.1 68417.m03337 receptor-like protein kinase 5 (RLK5) identical to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam domain PF00069: Protein kinase domain; identical to cDNA receptor-like protein kinase 5 (RLK5) GI:13506746 Length = 674 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXP 903 PP PPPPPP + PP P Sbjct: 257 PPPPPPPPPRESLVSTPPISSSSLP 281 Score = 28.7 bits (61), Expect(2) = 0.037 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +1 Query: 829 PPXPPPPPPXP 861 PP PPPPPP P Sbjct: 254 PPLPPPPPPPP 264 Score = 26.2 bits (55), Expect(2) = 0.037 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 952 PPPPPPXPP 978 PPPPPP PP Sbjct: 257 PPPPPPPPP 265 >At2g39250.1 68415.m04820 AP2 domain-containing transcription factor, putative AP2_ARATH Floral homeotic protein APETALA2.(SP:P47927){Arabidopsis thaliana} Length = 222 Score = 28.7 bits (61), Expect(2) = 0.040 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +1 Query: 829 PPXPPPPPPXP 861 PP PPPPPP P Sbjct: 55 PPPPPPPPPPP 65 Score = 28.7 bits (61), Expect = 6.2 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +1 Query: 829 PPXPPPPPPXP 861 PP PPPPPP P Sbjct: 56 PPPPPPPPPPP 66 Score = 28.3 bits (60), Expect = 8.2 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 818 PPPXPXXPPPPP 853 PPP P PPPPP Sbjct: 55 PPPPPPPPPPPP 66 Score = 28.3 bits (60), Expect = 8.2 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 832 PXPPPPPPXPXP 867 P PPPPPP P P Sbjct: 55 PPPPPPPPPPPP 66 Score = 26.2 bits (55), Expect(2) = 0.040 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 952 PPPPPPXPP 978 PPPPPP PP Sbjct: 58 PPPPPPPPP 66 >At4g34150.1 68417.m04846 C2 domain-containing protein similar to calcium-dependent protein kinase [Dunaliella tertiolecta] GI:6644464; contains Pfam profile PF00168: C2 domain Length = 247 Score = 35.9 bits (79), Expect = 0.041 Identities = 20/62 (32%), Positives = 21/62 (33%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 LY Q PP P P A PP P P P PP P P PP P Sbjct: 171 LYPQVQQYPQPSGYPPASGYPPQPSAYPPPSTSGYPPIPSAYPPPPPSSAYPPQPYPPQP 230 Query: 976 PF 981 + Sbjct: 231 SY 232 Score = 32.7 bits (71), Expect = 0.38 Identities = 21/61 (34%), Positives = 22/61 (36%), Gaps = 8/61 (13%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPP-XGXXPXP---XPPXXPPXPPLXXXXXPPPP----PPX 972 P P P P P PP G P P PP PP+ PPPP PP Sbjct: 165 PYSGPSLYPQVQQYPQPSGYPPASGYPPQPSAYPPPSTSGYPPIPSAYPPPPPSSAYPPQ 224 Query: 973 P 975 P Sbjct: 225 P 225 Score = 29.9 bits (64), Expect = 2.7 Identities = 19/57 (33%), Positives = 20/57 (35%), Gaps = 6/57 (10%) Frame = +1 Query: 829 PPXPPP-PPPX-----PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 PP P PPP P P A PP P PP P P P PP+ Sbjct: 191 PPQPSAYPPPSTSGYPPIPSAYPPPPPSSAYPPQPYPPQPSYYPQGPYPGQYPPPPY 247 Score = 29.5 bits (63), Expect = 3.6 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 4/40 (10%) Frame = +1 Query: 817 PXXXPPXPP----PPPPXPXPXAXPPXGXXPXPXPPXXPP 924 P PP PP PP P P + P G P PP PP Sbjct: 209 PSAYPPPPPSSAYPPQPYPPQPSYYPQGPYPGQYPP--PP 246 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/55 (30%), Positives = 17/55 (30%), Gaps = 5/55 (9%) Frame = +2 Query: 818 PPPXPXXPPP-----PPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PP PPP PP PPP P P P P P PP Sbjct: 191 PPQPSAYPPPSTSGYPPIPSAYPPPPPSSAYPPQPYPPQPSYYPQGPYPGQYPPP 245 >At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 35.9 bits (79), Expect = 0.041 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Frame = -3 Query: 974 GXGGG-GGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXW 810 G GG G G GG GG G G G GGGGGG G W Sbjct: 46 GYGGQPAGSRWAPPSSGGGGASGGGYRNDGGRTGYGYGAGGGGGGGGGWNNRSGGW 101 Score = 35.9 bits (79), Expect = 0.041 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXG 864 G GGGGGG GG G GG G G P GG G Sbjct: 572 GGGGGGGGGGSDYYGGGG--YGGGGYGGAPSGGYGAG 606 Score = 32.7 bits (71), Expect = 0.38 Identities = 20/53 (37%), Positives = 21/53 (39%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXW 810 GG GG G GG G G GG G G GGGG GG G + Sbjct: 555 GGRFGGRDFRREGSYSRGGGGGGGG----GGSDYYGGGGYGGGGYGGAPSGGY 603 Score = 31.5 bits (68), Expect = 0.88 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = -3 Query: 935 RGGXGGXXGGXGXGXXPXGGXAXGXGXGGG-GGGXGGXXXGXW 810 RGG GG GG G GG G G GG GG G W Sbjct: 571 RGGGGG--GGGGGSDYYGGGGYGGGGYGGAPSGGYGAGVTSAW 611 >At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 35.9 bits (79), Expect = 0.041 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Frame = -3 Query: 974 GXGGG-GGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXW 810 G GG G G GG GG G G G GGGGGG G W Sbjct: 46 GYGGQPAGSRWAPPSSGGGGASGGGYRNDGGRTGYGYGAGGGGGGGGGWNNRSGGW 101 Score = 35.9 bits (79), Expect = 0.041 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXG 864 G GGGGGG GG G GG G G P GG G Sbjct: 572 GGGGGGGGGGSDYYGGGG--YGGGGYGGAPSGGYGAG 606 Score = 32.7 bits (71), Expect = 0.38 Identities = 20/53 (37%), Positives = 21/53 (39%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXGXW 810 GG GG G GG G G GG G G GGGG GG G + Sbjct: 555 GGRFGGRDFRREGSYSRGGGGGGGG----GGSDYYGGGGYGGGGYGGAPSGGY 603 Score = 31.5 bits (68), Expect = 0.88 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = -3 Query: 935 RGGXGGXXGGXGXGXXPXGGXAXGXGXGGG-GGGXGGXXXGXW 810 RGG GG GG G GG G G GG GG G W Sbjct: 571 RGGGGG--GGGGGSDYYGGGGYGGGGYGGAPSGGYGAGVTSAW 611 >At3g24540.1 68416.m03082 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 509 Score = 35.9 bits (79), Expect = 0.041 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PPPPP PP P PP P P P P PP Sbjct: 71 PPPPPRSPSTSTPPRLGNRNPPPPASPSGQEPTTPTMTPGFSLSPP 116 Score = 29.9 bits (64), Expect = 2.7 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PPPPP P + P P P P P L PPPP P Sbjct: 57 PPPPPKAPVNVSLSPP---PPPRSPSTSTPPRLGNRN--PPPPASP 97 >At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) similar to RNA helicases GI:3775995, GI:3775987 [Arabidopsis thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 610 Score = 35.9 bits (79), Expect = 0.041 Identities = 29/82 (35%), Positives = 30/82 (36%), Gaps = 2/82 (2%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXG--GGGGXXGGXXXXVG 809 G G GG GG G G G G GG G GG G G GG GG Sbjct: 531 GGGSYGGYGGS-SGRSGGGGGSYGGSGGSSSRYSGGSDRSSGFGSFGSGGSSGGFGS--D 587 Query: 808 RVSXAXGSQXFXQXD*SNDXNR 743 R S + G F SND R Sbjct: 588 RSSQSSGRSSFGGFG-SNDGKR 608 Score = 34.3 bits (75), Expect = 0.13 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVGRV 803 G G GGG G G G G G G GGGGG GG R Sbjct: 503 GARSGGSFGGGRSGGGGYGSYGSSSGRSGGGSYGGYGGSSGRSGGGGGSYGGSGGSSSRY 562 Query: 802 S 800 S Sbjct: 563 S 563 Score = 34.3 bits (75), Expect = 0.13 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXG--GGGGGXGG 828 GG GG GG GG G G G GG G G G GG GG Sbjct: 532 GGSYGGYGGSSGRSGGGGGSYGGSGGSSSRYSGGSDRSSGFGSFGSGGSSGG 583 Score = 32.7 bits (71), Expect = 0.38 Identities = 21/52 (40%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGG--GGXGG 828 GG GGGG G G G G G G + G GGGG GG GG Sbjct: 511 GGGRSGGGGY-----GSYGSSSGRSGGGSYGGYGGSSGRSGGGGGSYGGSGG 557 >At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to glycine-rich protein; atGRP (GI:259447) [Arabidopsis thaliana] Length = 145 Score = 35.9 bits (79), Expect = 0.041 Identities = 25/59 (42%), Positives = 26/59 (44%), Gaps = 9/59 (15%) Frame = -3 Query: 977 GGXGGGGG---GXXXXXRGGXGGXXGG----XGXGXXPXGGXAXGXGXGG--GGGGXGG 828 GG GGGG G +GG G GG G G GG G GG GGGG GG Sbjct: 55 GGYQGGGGNYQGGGGNYQGGGGNYQGGGGRYQGGGGRYQGGGGRYQGGGGRQGGGGSGG 113 Score = 31.9 bits (69), Expect = 0.67 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 5/59 (8%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRG---GXGGXXGGXGXGXXPXGGXAXGXG--XGGGGGGXGGXXXG 816 GG GGGG G G GG G G GG G G GGGG GG G Sbjct: 54 GGGYQGGGGNYQGGGGNYQGGGGNYQGGGGRYQGGGGRYQGGGGRYQGGGGRQGGGGSG 112 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGG 837 G GG +GG G GG G G G G GGGG Sbjct: 45 GDNGGNYNNGGGYQGGGGNYQGGGGNYQGGGGNYQGGGGRYQGGGG 90 Score = 29.9 bits (64), Expect = 2.7 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 3/55 (5%) Frame = -1 Query: 982 GXGGXG-GXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGG--GGGXXGG 827 G GG G GG G G GG G G GG GG GGG GG Sbjct: 59 GGGGNYQGGGGNYQGGGGNYQGGGGRYQGGGGRYQGGGGRYQGGGGRQGGGGSGG 113 >At5g28480.1 68418.m03462 hypothetical protein Length = 1230 Score = 35.5 bits (78), Expect = 0.054 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGG-GGXGG 828 GG GG G G GG GG G G P GG G G G GG G Sbjct: 419 GGPSGGDGEGGPSGGDGEGGPSGGDGEGG-PSGGDGEGGPNGADGEGGPNG 468 >At4g21720.1 68417.m03145 expressed protein Length = 139 Score = 35.5 bits (78), Expect = 0.054 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXP 909 P PPPPPP P P PP P P Sbjct: 104 PKRPPPPPPKPQPPPPPPRSQKPMQPP 130 Score = 31.9 bits (69), Expect = 0.67 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPP 880 PPP P PPPPP +PP Sbjct: 110 PPPKPQPPPPPPRSQKPMQPP 130 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 906 PPPXPPXPXPXXPXXPPPXPPXPP 977 PPP PP P P P P PP Sbjct: 107 PPPPPPKPQPPPPPPRSQKPMQPP 130 >At3g52460.1 68416.m05769 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 300 Score = 35.5 bits (78), Expect = 0.054 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 1/58 (1%) Frame = +2 Query: 812 NXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXP-XPSXPXXXPPXPPXXPXS 982 N PPP P PPP PP P P P P P+ P P P S Sbjct: 26 NQPPPPPPQSQPPPPQTQQQTYPPVMGYPGYHQPPPPYPNYPNAPYQQYPYAQAPPAS 83 >At3g28550.1 68416.m03565 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1018 Score = 35.5 bits (78), Expect = 0.054 Identities = 22/69 (31%), Positives = 25/69 (36%), Gaps = 7/69 (10%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXP----XAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP- 960 LY P PPPP P P + PP P PP P P + PPP Sbjct: 625 LYKSPPHPHVCVCPPPPPCYSPSPKVVYKSSPPPYVYSSPPPPYHSPSPKVHYKSPPPPY 684 Query: 961 --PPPXPPF 981 P PP+ Sbjct: 685 VYSSPPPPY 693 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/55 (34%), Positives = 22/55 (40%), Gaps = 7/55 (12%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXPPF 981 PPPP P P + PP P PP P P + PPP P PP+ Sbjct: 222 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKIVYKSPPPPYVYSSPPPPY 276 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/55 (34%), Positives = 22/55 (40%), Gaps = 7/55 (12%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXPPF 981 PPPP P P + PP P PP P P + PPP P PP+ Sbjct: 347 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKIVYKSPPPPYVYSSPPPPY 401 Score = 33.1 bits (72), Expect = 0.29 Identities = 22/69 (31%), Positives = 25/69 (36%), Gaps = 7/69 (10%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPP---PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP- 963 LY P PPP P P + PP P PP P P + PPPP Sbjct: 509 LYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYK-SPPPPY 567 Query: 964 ---PPXPPF 981 P PP+ Sbjct: 568 VYSSPPPPY 576 Score = 32.7 bits (71), Expect = 0.38 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 664 PPPPYHSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYK-SPPPPYVYSSPPPPY 718 Score = 32.3 bits (70), Expect = 0.51 Identities = 18/56 (32%), Positives = 21/56 (37%), Gaps = 5/56 (8%) Frame = +1 Query: 829 PPXPP--PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXPPF 981 PP P PP P + P P PP P P + PPP P PP+ Sbjct: 46 PPLPDVYSSPPPPLEYSPAPKVDYKSPPPPYYSPSPKVEYKSPPPPYVYNSPPPPY 101 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 97 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPIYSPSPKVDYK-SPPPPYVYSSPPPPY 151 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 197 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYK-SPPPPYVYSSPPPPY 251 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 247 PPPPYYSPSPKIVYKSPPPPYVYSSPPPPYYSPSPKVDYK-SPPPPYVYSSPPPPY 301 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 272 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYK-SPPPPYVYSSPPPPY 326 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 297 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPTPKVDYK-SPPPPYVYSSPPPPY 351 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 322 PPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYK-SPPPPYVYSSPPPPY 376 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 372 PPPPYYSPSPKIVYKSPPPPYVYSSPPPPYYTPSPKVVYK-SPPPPYVYSSPPPPY 426 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 397 PPPPYYTPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYK-SPPPPYVYSSPPPPY 451 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 422 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYK-SPPPPYVYSSPPPPY 476 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 447 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYK-SPPPPYVYSSPPPPY 501 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 472 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVLYK-SPPPPYVYSSPPPPY 526 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 497 PPPPYYSPSPKVLYKSPPPPYVYSSPPPPYYSPSPKVVYK-SPPPPYVYSSPPPPY 551 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 547 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYK-SPPPPYVYSSPPPPY 601 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 714 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYK-SPPPPYVYSSPPPPY 768 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 739 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYK-SPPPPYVYSSPPPPY 793 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 764 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYK-SPPPPYVYSSPPPPY 818 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 789 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYK-SPPPPYVYSSPPPPY 843 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 814 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYK-SPPPPYVYSSPPPPY 868 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 839 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYK-SPPPPYVYSSPPPPY 893 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 864 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYK-SPPPPYVYSSPPPPY 918 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 889 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYK-SPPPPYVYSSPPPPY 943 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 914 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPAPKVDYK-SPPPPYVYSSPPPPY 968 Score = 31.5 bits (68), Expect = 0.88 Identities = 19/55 (34%), Positives = 22/55 (40%), Gaps = 7/55 (12%) Frame = +1 Query: 838 PPPP--PPXPXP--XAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXPPF 981 PPPP P P + PP P PP P P + PPP P PP+ Sbjct: 689 PPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPY 743 Score = 31.5 bits (68), Expect = 0.88 Identities = 16/45 (35%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPP 960 PPPP P P + PP P PP P P + PPP Sbjct: 939 PPPPYYSPAPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 983 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 665 PPPYHSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPP 717 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/55 (36%), Positives = 22/55 (40%), Gaps = 8/55 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPP 978 PPPP P P + PP P PP P P + PPPP P PP Sbjct: 72 PPPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKVDYK-SPPPPYVYSSPPPP 125 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 73 PPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 125 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 98 PPPYYSPSPKVDYKSPPPPYVYSSPPPPIYSPSPKVDYKSPPPPYVYSSPPPP 150 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 173 PPSYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPP 225 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 198 PPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 250 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 248 PPPYYSPSPKIVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 300 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 273 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPP 325 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 298 PPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPP 350 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 323 PPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 375 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 373 PPPYYSPSPKIVYKSPPPPYVYSSPPPPYYTPSPKVVYKSPPPPYVYSSPPPP 425 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 398 PPPYYTPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 450 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 423 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPP 475 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 448 PPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 500 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 473 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVLYKSPPPPYVYSSPPPP 525 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 498 PPPYYSPSPKVLYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPP 550 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 523 PPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPP 575 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 548 PPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPP 600 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 640 PPPCYSPSPKVVYKSSPPPYVYSSPPPPYHSPSPKVHYKSPPPPYVYSSPPPP 692 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 690 PPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPP 742 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 715 PPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPP 767 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 740 PPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPP 792 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 765 PPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPP 817 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 790 PPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPP 842 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 815 PPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPP 867 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 840 PPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 892 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 865 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 917 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 890 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 942 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 915 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPAPKVDYKSPPPPYVYSSPPPP 967 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/56 (32%), Positives = 21/56 (37%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPP----PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP----PPPXPPF 981 PPPP P P + P P PP P P + PPP PP P + Sbjct: 955 PPPPYVYSSPPPPYYSPSPKVDYKSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPSY 1010 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 223 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKIVYKSPPPPYVYSSPPPP 275 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 348 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKIVYKSPPPPYVYSSPPPP 400 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/58 (29%), Positives = 19/58 (32%), Gaps = 4/58 (6%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPP----PXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 H + PPP PPP P + PP PP P P PP P Sbjct: 676 HYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPP 733 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/59 (30%), Positives = 20/59 (33%), Gaps = 5/59 (8%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 H + PPP PPPP + PPP PP P P PP P Sbjct: 701 HYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYS-PSPKVVYKSPPPP 758 Score = 29.9 bits (64), Expect = 2.7 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 H PPP P P P PP P PP P P PP P Sbjct: 633 HVCVCPPPPPCYSPSPKVVYKSSPPPYVYSSP---PPPYHSPSPKVHYKSPPPP 683 Score = 29.5 bits (63), Expect = 3.6 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 2/46 (4%) Frame = +1 Query: 838 PPPP--PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PPPP P P P P P PP PPPPP Sbjct: 597 PPPPYYSPSPKVYYKSPPSPYHAPSPKVLYKSPPHPHVCVCPPPPP 642 Score = 29.5 bits (63), Expect = 3.6 Identities = 18/58 (31%), Positives = 19/58 (32%), Gaps = 5/58 (8%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PPP PPPP + PPP PP P P PP P P Sbjct: 931 PPPYVYSSPPPPYYSPAPKVDYKSPPPPYVYSSPPPPYYS-PSPKVDYKSPPPPYYSP 987 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP 959 PP P P PP P PP P P PPP Sbjct: 940 PPPYYSPAPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 983 Score = 29.1 bits (62), Expect = 4.7 Identities = 18/53 (33%), Positives = 20/53 (37%), Gaps = 9/53 (16%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPP-----PPP 969 PPPP P P + PP P PP P P + P P PPP Sbjct: 122 PPPPIYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPSPYVYNSPPP 174 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 89 PPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPIYS-PSPKVDYKSPPPP 141 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 114 PPPYVYSSPPPPIYSPSPKVDYKSPPPPYVYSSPPPPYYS-PSPKVEYKSPPSP 166 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/53 (30%), Positives = 17/53 (32%), Gaps = 4/53 (7%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PP PP P P PP P Sbjct: 139 PPPYVYSSPPPPYYSPSPKVEYKSPPSPYVYNSPPPSYYSPSPKVDYKSPPPP 191 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 189 PPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYS-PSPKVDYKSPPPP 241 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 239 PPPYVYSSPPPPYYSPSPKIVYKSPPPPYVYSSPPPPYYS-PSPKVDYKSPPPP 291 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 289 PPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYS-PTPKVDYKSPPPP 341 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 314 PPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYS-PSPKVDYKSPPPP 366 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 389 PPPYVYSSPPPPYYTPSPKVVYKSPPPPYVYSSPPPPYYS-PSPKVDYKSPPPP 441 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 439 PPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYS-PSPKVDYKSPPPP 491 Score = 28.7 bits (61), Expect = 6.2 Identities = 18/58 (31%), Positives = 19/58 (32%), Gaps = 5/58 (8%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PPP PPPP + PPP PP P P PP P P Sbjct: 564 PPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYY-SPSPKVYYKSPPSPYHAP 620 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 831 PPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYS-PSPKVDYKSPPPP 883 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 856 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYS-PSPKVDYKSPPPP 908 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 881 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYS-PSPKVDYKSPPPP 933 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 906 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYS-PAPKVDYKSPPPP 958 Score = 28.3 bits (60), Expect = 8.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 214 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYS-PSPKIVYKSPPPP 266 Score = 28.3 bits (60), Expect = 8.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 264 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYS-PSPKVVYKSPPPP 316 Score = 28.3 bits (60), Expect = 8.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 339 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYS-PSPKIVYKSPPPP 391 Score = 28.3 bits (60), Expect = 8.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 364 PPPYVYSSPPPPYYSPSPKIVYKSPPPPYVYSSPPPPYYT-PSPKVVYKSPPPP 416 Score = 28.3 bits (60), Expect = 8.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 414 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYS-PSPKVVYKSPPPP 466 Score = 28.3 bits (60), Expect = 8.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 489 PPPYVYSSPPPPYYSPSPKVLYKSPPPPYVYSSPPPPYYS-PSPKVVYKSPPPP 541 Score = 28.3 bits (60), Expect = 8.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 539 PPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYS-PSPKVVYKSPPPP 591 Score = 28.3 bits (60), Expect = 8.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 656 PPPYVYSSPPPPYHSPSPKVHYKSPPPPYVYSSPPPPYYS-PSPKVHYKSPPPP 708 Score = 28.3 bits (60), Expect = 8.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 731 PPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYS-PSPKVVYKSPPPP 783 Score = 28.3 bits (60), Expect = 8.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 756 PPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYS-PSPKVVYKSPPPP 808 Score = 28.3 bits (60), Expect = 8.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 781 PPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYS-PSPKVVYKSPPPP 833 Score = 28.3 bits (60), Expect = 8.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 806 PPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYS-PSPKVVYKSPPPP 858 >At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PLDBETA1) identical to SP|P93733 Phospholipase D beta 1 (EC 3.1.4.4) (AtPLDbeta1) (PLD beta 1) (PLDbeta) {Arabidopsis thaliana}; contains Pfam profiles: PF00614 phospholipase D.active site motif, PF00168 C2 domain Length = 1083 Score = 35.5 bits (78), Expect = 0.054 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +1 Query: 799 YSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 Y Q P P P PP P PP P P PP PPPP Sbjct: 10 YPYGQYPYPYPYPAPYRPPSSEPYPPPPTNQYSAPYYPYPPPPYATPPPYASPPPP 65 Score = 31.5 bits (68), Expect = 0.88 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P P P P P P P PP P PPPP PP Sbjct: 6 PRYPYPYGQYPYPYPYPAPYRPPSSEPYPPPPTNQYSAP--YYPYPPPPYATPP 57 >At2g12100.1 68415.m01300 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain; similar to At5g28270, At2g05450, At1g45090, At2g16180, At2g06750 Length = 1224 Score = 35.5 bits (78), Expect = 0.054 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGG-GGXGG 828 GG GG G G GG GG G G P GG G G G GG G Sbjct: 432 GGPSGGDGEGGPSGGDGEGGPSGGDGEGG-PSGGDGEGGPNGADGEGGPNG 481 >At1g60200.1 68414.m06781 splicing factor PWI domain-containing protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF01480: PWI domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 899 Score = 35.5 bits (78), Expect = 0.054 Identities = 20/55 (36%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPS--XPXXXPPXPPXXP 976 P P P PPPP +PP P P P PS P PP PP P Sbjct: 29 PNPNPSLTPPPPQQ--HSQPPVAPLVPPGPPYAPPAQIPSSLLPTNLPPPPPFRP 81 Score = 35.1 bits (77), Expect = 0.072 Identities = 19/59 (32%), Positives = 22/59 (37%) Frame = +3 Query: 801 LTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 +++P P PPPP PP P PP PP P P PP PP Sbjct: 24 ISIPNPNPNPSLTPPPPQQHSQ---PPVAPLVPPGPPYAPPAQIPSS-LLPTNLPPPPP 78 Score = 32.7 bits (71), Expect = 0.38 Identities = 21/64 (32%), Positives = 22/64 (34%), Gaps = 7/64 (10%) Frame = +1 Query: 811 QXPXXXPPXP-PPPPPXPXPXAXPPXGXXPXPXPPXXPPXPP------LXXXXXPPPPPP 969 Q P P P P P P PP P P PP PP + P PP Sbjct: 16 QKPESTTPISIPNPNPNPSLTPPPPQQHSQPPVAPLVPPGPPYAPPAQIPSSLLPTNLPP 75 Query: 970 XPPF 981 PPF Sbjct: 76 PPPF 79 >At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 310 Score = 35.5 bits (78), Expect = 0.054 Identities = 19/53 (35%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPP--LXXXXXPPPPPPXPPF 981 PP PPPPP P P P PP PP + PPP PP+ Sbjct: 23 PPPPPPPPQQPAKEEENQPKTSPTP-PPHWMRYPPTVIIPHQMMYAPPPFPPY 74 >At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 432 Score = 35.5 bits (78), Expect = 0.054 Identities = 19/53 (35%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPP--LXXXXXPPPPPPXPPF 981 PP PPPPP P P P PP PP + PPP PP+ Sbjct: 23 PPPPPPPPQQPAKEEENQPKTSPTP-PPHWMRYPPTVIIPHQMMYAPPPFPPY 74 >At1g45090.1 68414.m05169 Ulp1 protease family protein similar to At5g28270, At2g12100, At2g05450, At2g16180, At2g06750; contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 1210 Score = 35.5 bits (78), Expect = 0.054 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGG-GGXGG 828 GG GG G G GG GG G G P GG G G G GG G Sbjct: 423 GGPSGGDGEGGPSGGDGEGGPSGGDGEGG-PSGGDGEGGPNGADGEGGPNG 472 >At1g31750.1 68414.m03895 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 176 Score = 35.5 bits (78), Expect = 0.054 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PPPP PP G P PP PP PPPP PP Sbjct: 25 PPGAYPPPPQG--AYPPPGGYPPQGYPPPPHGYPP---AAYPPPPGAYPP 69 Score = 31.1 bits (67), Expect = 1.2 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 7/62 (11%) Frame = +1 Query: 817 PXXXPPXP----PPP---PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PP P PPP PP P PP G P PP PP P P P P Sbjct: 26 PGAYPPPPQGAYPPPGGYPPQGYPP--PPHGYPPAAYPPPPGAYPP---AGYPGPSGPRP 80 Query: 976 PF 981 F Sbjct: 81 GF 82 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPP PPP P P P P P P Sbjct: 30 PPPPQGAYPPPGGYPPQGYPPPPHGYPPAAYPPPPGAYPPAGYPGPSGP 78 >At3g05470.1 68416.m00599 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 884 Score = 28.7 bits (61), Expect(2) = 0.061 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +1 Query: 829 PPXPPPPPPXP 861 PP PPPPPP P Sbjct: 369 PPPPPPPPPLP 379 Score = 28.3 bits (60), Expect = 8.2 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 832 PXPPPPPPXPXP 867 P PPPPPP P P Sbjct: 368 PPPPPPPPPPLP 379 Score = 28.3 bits (60), Expect = 8.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPP 912 P PPPP P P G P PP Sbjct: 426 PRPPPPPPPPQQLQVAGINKTPPPP 450 Score = 25.4 bits (53), Expect(2) = 0.061 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 952 PPPPPPXPPF 981 PPPPPP P F Sbjct: 372 PPPPPPLPQF 381 >At1g72600.1 68414.m08395 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 135 Score = 27.9 bits (59), Expect(2) = 0.070 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +1 Query: 838 PPPPPPXPXPXAXPP 882 PPPPPP P + PP Sbjct: 39 PPPPPPPPLSLSPPP 53 Score = 26.2 bits (55), Expect(2) = 0.070 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 829 PPXPPPPPP 855 PP PPPPPP Sbjct: 38 PPPPPPPPP 46 >At5g65390.1 68418.m08224 arabinogalactan-protein (AGP7) Length = 130 Score = 35.1 bits (77), Expect = 0.072 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 4/53 (7%) Frame = +1 Query: 829 PPXPPPPPP--XPXPXAXPPXGXXPXP--XPPXXPPXPPLXXXXXPPPPPPXP 975 PP PPP P P PP P P PP P P PP P P Sbjct: 34 PPPVATPPPAATPAPTTTPPPAVSPAPTSSPPSSAPSPSSDAPTASPPAPEGP 86 Score = 29.5 bits (63), Expect = 3.6 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP 960 P PP P P P A PP P P P P PPP Sbjct: 60 PTSSPPSSAPSPSSDAPTASPPAPEGPGVSPGELAPTP--SDASAPPP 105 Score = 29.1 bits (62), Expect = 4.7 Identities = 19/64 (29%), Positives = 20/64 (31%), Gaps = 2/64 (3%) Frame = +3 Query: 789 PXAXLTLPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXP--XPPPXPPXPXPXXPXXPPPX 962 P +T P PP P P PP P PP P P P PP Sbjct: 28 PTTTVTPPPVATPPPAATPAP-----TTTPPPAVSPAPTSSPPSSAPSPSSDAPTASPPA 82 Query: 963 PPXP 974 P P Sbjct: 83 PEGP 86 >At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 175 Score = 35.1 bits (77), Expect = 0.072 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PPPP P + PP P PP P PP PPP Sbjct: 61 PYGNPPPPSPQ-YSPPPPPSQSSPPRSRCPPVPTTGCCNQPPGPPP 105 Score = 30.3 bits (65), Expect = 2.0 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Frame = +2 Query: 812 NXPPPXPX-XPPPPPXXXXXXRP--PPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 N PPP P PPPPP R PP P P P PS PP P Sbjct: 64 NPPPPSPQYSPPPPPSQSSPPRSRCPPVPTTGCCNQP--PGPPPS-TMYSPPYP 114 Score = 29.1 bits (62), Expect = 4.7 Identities = 19/61 (31%), Positives = 19/61 (31%), Gaps = 6/61 (9%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXP--PPXPPXPXPXXPXXPPP----XPPX 971 P P PPPP PP P PP P P PPP PP Sbjct: 54 PRLQRYSPYGNPPPPSPQYSPPPPPSQSSPPRSRCPPVPTTGCCNQPPGPPPSTMYSPPY 113 Query: 972 P 974 P Sbjct: 114 P 114 Score = 28.7 bits (61), Expect = 6.2 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 7/53 (13%) Frame = +3 Query: 828 PPXXPPPPPXXXXX---RXPPXXXXXXPXPPPXPPXPXPXXPXXP----PPXP 965 P PPPPP R PP PP PP P P PP P Sbjct: 70 PQYSPPPPPSQSSPPRSRCPPVPTTGCCNQPPGPPPSTMYSPPYPYFYTPPYP 122 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 881 GGXAXGXGXGGGGGGXGGXXXG 816 GG G G GGGGGG G G Sbjct: 128 GGGQGGGGQGGGGGGAEGGTTG 149 >At3g01560.1 68416.m00086 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 511 Score = 35.1 bits (77), Expect = 0.072 Identities = 20/65 (30%), Positives = 22/65 (33%), Gaps = 4/65 (6%) Frame = +1 Query: 799 YSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP----PP 966 +S Q P PP P PPP P P P PP P PP P Sbjct: 279 FSSQQEPYCPPPSHPQPPPSNPPPYQAPQTQTPHQPSYQSPPQQPQYPQQPPPSSGYNPE 338 Query: 967 PXPPF 981 PP+ Sbjct: 339 EQPPY 343 Score = 30.7 bits (66), Expect = 1.5 Identities = 32/148 (21%), Positives = 49/148 (33%), Gaps = 13/148 (8%) Frame = +1 Query: 574 ETTSTNVSR-EEMEFTTESNVRDVDVGLETAHXTNEIAKAVEATTYAVHLQRRCRVLADS 750 E S +S+ E E+ V D+ V ++ +H + + K + V +Q ++L D Sbjct: 150 EGVSARLSQLETRTHNLENLVDDLKVSVDNSHGSTD-GKMRQLKNILVEVQSGVQLLKDK 208 Query: 751 YHXINLXVXX----TDYLXLYSLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXX 918 + + + +SL P P P P P P P P Sbjct: 209 QEILEAQLSKHQVSNQHAKTHSLHVDPTAQSPAPVPMQQFPLTSFPQPPSSTAAPSQPPS 268 Query: 919 PPXPP--------LXXXXXPPPPPPXPP 978 PP PPP P PP Sbjct: 269 SQLPPQLPTQFSSQQEPYCPPPSHPQPP 296 >At2g26410.1 68415.m03169 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 516 Score = 35.1 bits (77), Expect = 0.072 Identities = 17/50 (34%), Positives = 19/50 (38%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 P PP P P + P P PP P P P PPPP P + Sbjct: 35 PLEETPPVDPSPSSV----HRPYPPPPPLPDFAPQPLLPPPSPPPPPPAY 80 Score = 34.7 bits (76), Expect = 0.095 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 900 PXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PPP P P PPP PP PP Sbjct: 52 PYPPPPPLPDFAPQPLLPPPSPPPPP 77 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 4/39 (10%) Frame = +1 Query: 829 PPXPPPPP----PXPXPXAXPPXGXXPXPXPPXXPPXPP 933 PP P P P P P P P PP PP PP Sbjct: 40 PPVDPSPSSVHRPYPPPPPLPDFAPQPLLPPPSPPPPPP 78 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXP 944 PP P P PP P P PP P P P Sbjct: 40 PPVDPSPSSVHRPYPPPPPLPDFAPQPLLPPPSPPPPPP 78 >At2g16630.1 68415.m01909 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 359 Score = 35.1 bits (77), Expect = 0.072 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P PP P P P PP P PP P PP PP Sbjct: 155 PVMPPPQVPVMPPPQVPVKPHPKVPVISPDPPATLP-PPKVPVISPDPPTTLPP 207 Score = 31.9 bits (69), Expect = 0.67 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPX-GXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PP P PP P PP P P P P PP PPP P Sbjct: 151 PPTAPVMPPPQVPVMPPPQVPVKPHPKVPVISPDPP---ATLPPPKVP 195 Score = 31.5 bits (68), Expect = 0.88 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 900 PXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PP P P P P PPP P P Sbjct: 149 PKPPTAPVMPPPQVPVMPPPQVPVKP 174 Score = 31.5 bits (68), Expect = 0.88 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXPXPXAXP-PXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 Q P PP P P P P P P P P P PP PPP P Sbjct: 161 QVPVMPPPQVPVKPHPKVPVISPDPPATLPPPKVPVISPDPP---TTLPPPLVP 211 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/50 (32%), Positives = 17/50 (34%), Gaps = 1/50 (2%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPP-PXPPXPXPXXPXXPPPXPPXP 974 PP P PP + P P PP PP P PP P P Sbjct: 159 PPQVPVMPPPQVPVKPHPKVPVISPDPPATLPPPKVPVISPDPPTTLPPP 208 Score = 30.3 bits (65), Expect = 2.0 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 Q P P P P P PP P PP P PPL PP P F Sbjct: 169 QVPVKPHPKVPVISPDPPATLPPPKVPVISPDPPTTLP-PPLVPVINLPPVTSPPQF 224 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PPP P PP P P P PP P PP Sbjct: 185 PPATLPPPKVPVISPDPPTTLPPPLVPVINLPPVTSPPQFKLPPLPQIPP 234 >At1g55540.1 68414.m06356 proline-rich family protein contains proline rich extensin domain, INTERPRO:IPR002965 Length = 915 Score = 35.1 bits (77), Expect = 0.072 Identities = 21/52 (40%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = -3 Query: 977 GGXGGGGGG-XXXXXRGGXGGXXG-GXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG G G GG +G GG G G G GG A G GGG GG Sbjct: 847 GGLGSGTGGFGGFAPQGSSGGFAGAAGGGGFGGFGGQAQGQAGGGGFSAFGG 898 Score = 34.7 bits (76), Expect = 0.095 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXG 830 GG G G G GG GGG G GG G GG G Sbjct: 822 GGFAALASGSGGFAGAAPGGGGGGFGGLGSGTGGFGGFAPQGSSGGFAG 870 Score = 34.7 bits (76), Expect = 0.095 Identities = 22/66 (33%), Positives = 23/66 (34%), Gaps = 5/66 (7%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGG-----XGXXXXXXGGXRXXXXXGGGGGXXGGXXX 818 G GG GG G G G G G GG G GG GGG GG Sbjct: 842 GGGGFGGLGSGTGGFGGFAPQGSSGGFAGAAGGGGFGGFGGQAQGQAGGGGFSAFGGNSG 901 Query: 817 XVGRVS 800 G+ S Sbjct: 902 ATGKPS 907 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -2 Query: 963 GXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG G G G GG G GG G GG G GG Sbjct: 830 GSGGFAGAAPGGGGGGFGGLGSGTGGFGG----FAPQGSSGGFAGAAGG 874 >At1g52030.2 68414.m05870 myrosinase-binding protein, putative (F-ATMBP) identical to SP|Q9SAV1 Myrosinase binding protein-like f-AtMBP [Arabidopsis thaliana]; similar to myrosinase binding protein GI:1711295 from [Brassica napus]; contains Pfam PF01419: Jacalin-like lectin domain; identical to cDNA myrosinase-binding protein-like protein (MBP1.2) GI:6760446 Length = 642 Score = 35.1 bits (77), Expect = 0.072 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +1 Query: 847 PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P P P P P P P P+ P P P PP Sbjct: 291 PLPAPTPAPAPAPAPAPAPAPSPAPASAPVPAPAPTPAPAPAPP 334 Score = 32.3 bits (70), Expect = 0.51 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP 924 P P P P P P P + P P P P PP Sbjct: 299 PAPAPAPAPAPAPSPAPASAPVPAPAPTPAPAPAPP 334 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 3/42 (7%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXP---PXXPPXPP 933 P P P P P P P P P P P P P PP Sbjct: 293 PAPTPAPAPAPAPAPAPAPSPAPASAPVPAPAPTPAPAPAPP 334 >At1g52030.1 68414.m05869 myrosinase-binding protein, putative (F-ATMBP) identical to SP|Q9SAV1 Myrosinase binding protein-like f-AtMBP [Arabidopsis thaliana]; similar to myrosinase binding protein GI:1711295 from [Brassica napus]; contains Pfam PF01419: Jacalin-like lectin domain; identical to cDNA myrosinase-binding protein-like protein (MBP1.2) GI:6760446 Length = 642 Score = 35.1 bits (77), Expect = 0.072 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +1 Query: 847 PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P P P P P P P P+ P P P PP Sbjct: 291 PLPAPTPAPAPAPAPAPAPAPSPAPASAPVPAPAPTPAPAPAPP 334 Score = 32.3 bits (70), Expect = 0.51 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP 924 P P P P P P P + P P P P PP Sbjct: 299 PAPAPAPAPAPAPSPAPASAPVPAPAPTPAPAPAPP 334 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 3/42 (7%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXP---PXXPPXPP 933 P P P P P P P P P P P P P PP Sbjct: 293 PAPTPAPAPAPAPAPAPAPSPAPASAPVPAPAPTPAPAPAPP 334 >At5g35190.1 68418.m04170 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 328 Score = 34.7 bits (76), Expect = 0.095 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 5/55 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PPP PPPP + PPP PP P P PP PP Sbjct: 224 PPPYVYNSPPPPYFSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPEVSYKSPPPPP 278 Score = 33.1 bits (72), Expect = 0.29 Identities = 19/56 (33%), Positives = 22/56 (39%), Gaps = 6/56 (10%) Frame = +1 Query: 832 PXPPPPPPXPXP--XAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP----PPPXPPF 981 P PP P P + PP P PP P P + PPP PP PP+ Sbjct: 207 PSPPYYSPSPKVDYKSPPPPYVYNSPPPPYFSPSPKVDYKSPPPPYVYSSPPPPPY 262 Score = 33.1 bits (72), Expect = 0.29 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 PP P P PP P PP P P + PPPP Sbjct: 234 PPYFSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPEVSYKSPPPPP 278 Score = 33.1 bits (72), Expect = 0.29 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 13/63 (20%) Frame = +1 Query: 829 PPXP-----PPPPPXPXPXAXPPXGXXPXPXPPXXPPX--------PPLXXXXXPPPPPP 969 PP P PPPPP P P P PP P PPL PPPPP Sbjct: 248 PPPPYVYSSPPPPPYYSPS--PEVSYKSPPPPPYYSPSLEVSYKSPPPLFVYNFPPPPPF 305 Query: 970 XPP 978 P Sbjct: 306 YSP 308 Score = 31.9 bits (69), Expect = 0.67 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 82 PPPPYYSPSPKEDYKSPPPPYVYNSPPPPYYSPSPKVDYK-SPPPPYVYNSPPPPY 136 Score = 31.9 bits (69), Expect = 0.67 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 107 PPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVEYK-SPPPPYVYNSPPPPY 161 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 83 PPPYYSPSPKEDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYNSPPPP 135 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 108 PPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPPYVYNSPPPP 160 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/55 (32%), Positives = 21/55 (38%), Gaps = 7/55 (12%) Frame = +1 Query: 838 PPPP----PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXPPF 981 PPPP P + PP P PP P P + PPP P PP+ Sbjct: 157 PPPPYYSLSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKFSPPPYVYNSPSPPY 211 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 4/53 (7%) Frame = +3 Query: 831 PXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP----XPPXPP 977 P P P PP P PP P P PPP PP PP Sbjct: 209 PPYYSPSPKVDYKSPPPPYVYNSPPPPYFSPSPKVDYKSPPPPYVYSSPPPPP 261 Score = 29.9 bits (64), Expect = 2.7 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 183 PPPYYSPSPKVDYKFSPPPYVYNSPSPPYYSPSPKVDYKSPPPPYVYNSPPPP 235 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP 959 PP P P PP P PP P P PPP Sbjct: 234 PPYFSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPEVSYKSPPPP 277 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/53 (30%), Positives = 17/53 (32%), Gaps = 4/53 (7%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PP PP P P PP P Sbjct: 99 PPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPP 151 Score = 28.3 bits (60), Expect = 8.2 Identities = 21/64 (32%), Positives = 22/64 (34%), Gaps = 13/64 (20%) Frame = +1 Query: 829 PPXP----PPPPPXPXPXAXPPXGXXPXPXPPXXPPXP-----PLXXXXXPPPP----PP 969 PP P PPPP P P P PP P P PPPP P Sbjct: 123 PPPPYVYNSPPPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSLSPKVDYKSPPPPYVYNSP 182 Query: 970 XPPF 981 PP+ Sbjct: 183 PPPY 186 Score = 28.3 bits (60), Expect = 8.2 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 806 SXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 S PPP P P PPP PP P P PP P Sbjct: 270 SYKSPPPPPYYSPS--LEVSYKSPPPLFVYNFPPPPPFYSPSPKVSYKSPPAP 320 >At5g25590.1 68418.m03045 expressed protein contains Pfam profile PF04783: Protein of unknown function (DUF630) Length = 775 Score = 34.7 bits (76), Expect = 0.095 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +1 Query: 901 PXPPXXPPXPPLXXXXXPPPPPPXPPF 981 P P PP PP+ PPPPPP P F Sbjct: 85 PASPQPPPPPPIENL--PPPPPPLPKF 109 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 906 PPPXPPXPXPXXPXXPPPXPPXPP 977 P P PP P P PPP P P Sbjct: 88 PQPPPPPPIENLPPPPPPLPKFSP 111 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 812 NXPPPXPXXPPPPPXXXXXXRPPP 883 N P P PPPPP PPP Sbjct: 82 NVDPASPQPPPPPPIENLPPPPPP 105 Score = 28.7 bits (61), Expect = 6.2 Identities = 22/75 (29%), Positives = 26/75 (34%), Gaps = 3/75 (4%) Frame = +1 Query: 706 YAVHLQRRCRVLADSYHXINLXVXXTDYLX---LYSLXQXPXXXPPXPPPPPPXPXPXAX 876 YA+ L+ L+D H + D L Y P P PPPP P Sbjct: 41 YAIALKNTGAALSDYGHGESDQKALDDVLLDQQHYEKQSRNNVDPASPQPPPPPPIENLP 100 Query: 877 PPXGXXPXPXPPXXP 921 PP P P P P Sbjct: 101 PP----PPPLPKFSP 111 >At4g08230.1 68417.m01358 glycine-rich protein Length = 113 Score = 34.7 bits (76), Expect = 0.095 Identities = 19/34 (55%), Positives = 19/34 (55%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGG 876 GG GGGGGG GG GG GG G G P GG Sbjct: 60 GGMGGGGGGG-----GGSGGGGGGRG-GGPPRGG 87 Score = 33.1 bits (72), Expect = 0.29 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGG 905 GG G GGG G G G GG GGG Sbjct: 59 GGGMGGGGGGGGGSGGGGGGRGGG 82 Score = 31.5 bits (68), Expect = 0.88 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 896 GXXPXGGXAXGXGXGGGGGGXGG 828 G GG G G GGGGGG GG Sbjct: 59 GGGMGGGGGGGGGSGGGGGGRGG 81 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 881 GGXAXGXGXGGGGGGXGGXXXG 816 GG G G GGG GG GG G Sbjct: 60 GGMGGGGGGGGGSGGGGGGRGG 81 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 881 GGXAXGXGXGGGGGGXGGXXXG 816 GG G G GGGG G GG G Sbjct: 59 GGGMGGGGGGGGGSGGGGGGRG 80 >At3g54590.1 68416.m06040 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 743 Score = 34.7 bits (76), Expect = 0.095 Identities = 19/55 (34%), Positives = 22/55 (40%), Gaps = 7/55 (12%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXPPF 981 PPPP P P + PP P PP P P + PPP P PP+ Sbjct: 405 PPPPTYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 459 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/55 (34%), Positives = 22/55 (40%), Gaps = 7/55 (12%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXPPF 981 PPPP P P + PP P PP P P + PPP P PP+ Sbjct: 80 PPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPY 134 Score = 33.9 bits (74), Expect = 0.17 Identities = 19/56 (33%), Positives = 22/56 (39%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPP----PPPXPPF 981 PPPP P P + PP P PP P P + PPP PP P + Sbjct: 355 PPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTY 410 Score = 33.5 bits (73), Expect = 0.22 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 3/60 (5%) Frame = +3 Query: 807 LPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 LP PP P P PP P PP P P PPP P PP Sbjct: 49 LPYVDSSPPPTYTPAPEVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPP 108 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 130 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYK-SPPPPYVYSSPPPPY 184 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 155 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYK-SPPPPYVYSSPPPPY 209 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 180 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYK-SPPPPYVYSSPPPPY 234 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 205 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYK-SPPPPYVYSSPPPPY 259 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 230 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYK-SPPPPYVYSSPPPPY 284 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 255 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYK-SPPPPYVYSSPPPPY 309 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 280 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYK-SPPPPYVYSSPPPPY 334 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 380 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVYYK-SPPPPYVYSSPPPPY 434 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 430 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYK-SPPPPYVYSSPPPPY 484 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 455 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYK-SPPPPYVYSSPPPPY 509 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 480 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYK-SPPPPYVYSSPPPPY 534 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 505 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYK-SPPPPYVYSSPPPPY 559 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 530 PPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYK-SPPPPYVYNSPPPPY 584 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 580 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYK-SPPPPYVYSSPPPPY 634 Score = 31.9 bits (69), Expect = 0.67 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 105 PPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYK-SPPPPYVYSSPPPPY 159 Score = 31.9 bits (69), Expect = 0.67 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = +1 Query: 829 PPXPP--PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP 960 PP PP P P + PP P PP P P + PPP Sbjct: 671 PPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPP 716 Score = 31.5 bits (68), Expect = 0.88 Identities = 20/57 (35%), Positives = 23/57 (40%), Gaps = 9/57 (15%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP-----PPXPPF 981 PPPP P P + PP P PP P P + PPPP PP P + Sbjct: 305 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYK-SPPPPYVYSSPPPPTY 360 Score = 31.5 bits (68), Expect = 0.88 Identities = 21/64 (32%), Positives = 24/64 (37%), Gaps = 13/64 (20%) Frame = +1 Query: 829 PPXP----PPPPPXPXP------XAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPP 969 PP P PPPP P + PP P PP P P + PPP P Sbjct: 321 PPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSP 380 Query: 970 XPPF 981 PP+ Sbjct: 381 PPPY 384 Score = 31.5 bits (68), Expect = 0.88 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 331 PPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPP 383 Score = 31.5 bits (68), Expect = 0.88 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 381 PPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVYYKSPPPPYVYSSPPPP 433 Score = 31.5 bits (68), Expect = 0.88 Identities = 16/45 (35%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPP 960 PPPP P P + PP P PP P P + PPP Sbjct: 605 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 649 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/66 (28%), Positives = 22/66 (33%), Gaps = 5/66 (7%) Frame = +1 Query: 799 YSLXQXPXXXPPXPPP--PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---P 963 Y P PP P P + PP P PP P P + PPP Sbjct: 44 YKTPPLPYVDSSPPPTYTPAPEVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYS 103 Query: 964 PPXPPF 981 P PP+ Sbjct: 104 SPPPPY 109 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/55 (34%), Positives = 22/55 (40%), Gaps = 7/55 (12%) Frame = +1 Query: 838 PPPP--PPXPXP--XAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXPPF 981 PPPP P P + PP P PP P P + PPP P PP+ Sbjct: 555 PPPPYYSPSPKVHYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 609 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 81 PPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPP 133 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 106 PPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 158 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 131 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPP 183 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 156 PPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 208 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 181 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPP 233 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 206 PPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 258 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 231 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 283 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 256 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 308 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 281 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 333 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 306 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 358 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 356 PPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPP 408 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 406 PPPTYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPP 458 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 431 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPP 483 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 456 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPP 508 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 481 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPP 533 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 506 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPP 558 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 531 PPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYNSPPPP 583 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 556 PPPYYSPSPKVHYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPP 608 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 581 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPP 633 Score = 29.9 bits (64), Expect = 2.7 Identities = 17/58 (29%), Positives = 19/58 (32%), Gaps = 4/58 (6%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPP----PXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 H + PPP PPP P + PP PP P P PP P Sbjct: 542 HYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPP 599 Score = 29.9 bits (64), Expect = 2.7 Identities = 18/59 (30%), Positives = 20/59 (33%), Gaps = 5/59 (8%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 H + PPP PPPP + PPP PP P P PP P Sbjct: 567 HYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYY-SPSPKVYYKSPPPP 624 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP 959 PP P P PP P PP P P PPP Sbjct: 606 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 649 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP 959 PP P P PP P PP P P PPP Sbjct: 673 PPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPP 716 Score = 29.1 bits (62), Expect = 4.7 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 H PPP P P P PP P PP P P PP P Sbjct: 666 HVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSP---PPPYYSPSPKVYYKSPPPP 716 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 72 PPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYS-PSPKVDYKSPPPP 124 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/53 (30%), Positives = 17/53 (32%), Gaps = 4/53 (7%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PP PP P P PP P Sbjct: 97 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPP 149 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 122 PPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYS-PSPKVEYKSPPPP 174 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 147 PPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYS-PSPKVDYKSPPPP 199 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 172 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYS-PSPKVEYKSPPPP 224 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 197 PPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYS-PSPKVDYKSPPPP 249 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 222 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYS-PSPKVDYKSPPPP 274 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 247 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYS-PSPKVDYKSPPPP 299 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 272 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYS-PSPKVDYKSPPPP 324 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 297 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYS-PSPKVDYKSPPPP 349 Score = 28.7 bits (61), Expect = 6.2 Identities = 19/58 (32%), Positives = 21/58 (36%), Gaps = 11/58 (18%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPP-------PPPXPP 978 PPPP P P + PP P PP P P + PPP PP P Sbjct: 330 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSP 387 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 347 PPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYS-PSPKVEYKSPPPP 399 Score = 28.7 bits (61), Expect = 6.2 Identities = 18/58 (31%), Positives = 19/58 (32%), Gaps = 5/58 (8%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PPP PPPP + PPP PP P P PP P P Sbjct: 597 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYY-SPSPKVYYKSPPPPYYSP 653 Score = 28.7 bits (61), Expect = 6.2 Identities = 18/55 (32%), Positives = 20/55 (36%), Gaps = 9/55 (16%) Frame = +1 Query: 838 PPPP----PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP-----PPPXP 975 PPPP P P + P P PP P P + P P PPP P Sbjct: 621 PPPPYVYSSPPPPYYSPSPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPP 675 Score = 28.3 bits (60), Expect = 8.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 497 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYS-PSPKVHYKSPPPP 549 Score = 28.3 bits (60), Expect = 8.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 522 PPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYS-PSPKVHYKSPPPP 574 Score = 28.3 bits (60), Expect = 8.2 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +1 Query: 850 PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP P PP P P PP PPPP P Sbjct: 662 PPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 704 >At3g54580.1 68416.m06039 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 951 Score = 34.7 bits (76), Expect = 0.095 Identities = 19/55 (34%), Positives = 22/55 (40%), Gaps = 7/55 (12%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXPPF 981 PPPP P P + PP P PP P P + PPP P PP+ Sbjct: 455 PPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 509 Score = 33.9 bits (74), Expect = 0.17 Identities = 19/56 (33%), Positives = 22/56 (39%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPP----PPPXPPF 981 PPPP P P + PP P PP P P + PPP PP P + Sbjct: 180 PPPPTYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTY 235 Score = 33.9 bits (74), Expect = 0.17 Identities = 19/56 (33%), Positives = 22/56 (39%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPP----PPPXPPF 981 PPPP P P + PP P PP P P + PPP PP P + Sbjct: 230 PPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTY 285 Score = 33.9 bits (74), Expect = 0.17 Identities = 19/56 (33%), Positives = 22/56 (39%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPP----PPPXPPF 981 PPPP P P + PP P PP P P + PPP PP P + Sbjct: 280 PPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPTY 335 Score = 33.9 bits (74), Expect = 0.17 Identities = 19/56 (33%), Positives = 22/56 (39%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPP----PPPXPPF 981 PPPP P P + PP P PP P P + PPP PP P + Sbjct: 405 PPPPTYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTY 460 Score = 33.9 bits (74), Expect = 0.17 Identities = 19/56 (33%), Positives = 22/56 (39%), Gaps = 5/56 (8%) Frame = +1 Query: 829 PPXPPP--PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXPPF 981 PP PP P P + PP P PP P P + PPP P PP+ Sbjct: 696 PPPPPCYSPSPKVVYKSPPPPYVYSSPPPPHYSPSPKVYYKSPPPPYVYSSPPPPY 751 Score = 33.5 bits (73), Expect = 0.22 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 3/60 (5%) Frame = +3 Query: 807 LPTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 LP PP P P PP P PP P P PPP P PP Sbjct: 49 LPYIDSSPPPTYSPAPEVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPP 108 Score = 32.7 bits (71), Expect = 0.38 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 596 PPPPYHSPSPKVQYKSPPPPYVYSSPPPPYYSPSPKVYYK-SPPPPYVYSSPPPPY 650 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 480 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYK-SPPPPYVYSSPPPPY 534 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 546 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYK-SPPPPYVYSSPPPPY 600 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 571 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYHSPSPKVQYK-SPPPPYVYSSPPPPY 625 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 621 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYK-SPPPPYVYSSPPPPY 675 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 763 PPPPYYAPTPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYK-SPPPPYVYSSPPPPY 817 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 813 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYK-SPPPPYVYSSPPPPY 867 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 838 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYK-SPPPPYVYSSPPPPY 892 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 863 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP-VVDYKSPPPPYVYSSPPPPY 917 Score = 31.9 bits (69), Expect = 0.67 Identities = 16/45 (35%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPP 960 PPPP P P + PP P PP P P + PPP Sbjct: 722 PPPPHYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPP 766 Score = 31.5 bits (68), Expect = 0.88 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 81 PPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPP 133 Score = 31.5 bits (68), Expect = 0.88 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 106 PPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPP 158 Score = 31.5 bits (68), Expect = 0.88 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 131 PPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPP 183 Score = 31.5 bits (68), Expect = 0.88 Identities = 21/64 (32%), Positives = 24/64 (37%), Gaps = 13/64 (20%) Frame = +1 Query: 829 PPXP----PPPPPXPXP------XAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPP 969 PP P PPPP P + PP P PP P P + PPP P Sbjct: 146 PPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSP 205 Query: 970 XPPF 981 PP+ Sbjct: 206 PPPY 209 Score = 31.5 bits (68), Expect = 0.88 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 156 PPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPP 208 Score = 31.5 bits (68), Expect = 0.88 Identities = 21/64 (32%), Positives = 24/64 (37%), Gaps = 13/64 (20%) Frame = +1 Query: 829 PPXP----PPPPPXPXP------XAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPP 969 PP P PPPP P + PP P PP P P + PPP P Sbjct: 196 PPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSP 255 Query: 970 XPPF 981 PP+ Sbjct: 256 PPPY 259 Score = 31.5 bits (68), Expect = 0.88 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 206 PPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPP 258 Score = 31.5 bits (68), Expect = 0.88 Identities = 21/64 (32%), Positives = 24/64 (37%), Gaps = 13/64 (20%) Frame = +1 Query: 829 PPXP----PPPPPXPXP------XAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPP 969 PP P PPPP P + PP P PP P P + PPP P Sbjct: 246 PPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSP 305 Query: 970 XPPF 981 PP+ Sbjct: 306 PPPY 309 Score = 31.5 bits (68), Expect = 0.88 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 256 PPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPP 308 Score = 31.5 bits (68), Expect = 0.88 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 306 PPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPP 358 Score = 31.5 bits (68), Expect = 0.88 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 331 PPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPP 383 Score = 31.5 bits (68), Expect = 0.88 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 356 PPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPP 408 Score = 31.5 bits (68), Expect = 0.88 Identities = 21/64 (32%), Positives = 24/64 (37%), Gaps = 13/64 (20%) Frame = +1 Query: 829 PPXP----PPPPPXPXP------XAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPP 969 PP P PPPP P + PP P PP P P + PPP P Sbjct: 371 PPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSP 430 Query: 970 XPPF 981 PP+ Sbjct: 431 PPPY 434 Score = 31.5 bits (68), Expect = 0.88 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 381 PPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPP 433 Score = 31.5 bits (68), Expect = 0.88 Identities = 21/64 (32%), Positives = 24/64 (37%), Gaps = 13/64 (20%) Frame = +1 Query: 829 PPXP----PPPPPXPXP------XAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPP 969 PP P PPPP P + PP P PP P P + PPP P Sbjct: 421 PPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSP 480 Query: 970 XPPF 981 PP+ Sbjct: 481 PPPY 484 Score = 31.5 bits (68), Expect = 0.88 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 431 PPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPP 483 Score = 31.5 bits (68), Expect = 0.88 Identities = 16/45 (35%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPP 960 PPPP P P + PP P PP P P + PPP Sbjct: 505 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 549 Score = 31.5 bits (68), Expect = 0.88 Identities = 18/55 (32%), Positives = 21/55 (38%), Gaps = 7/55 (12%) Frame = +1 Query: 838 PPPP----PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXPPF 981 PPPP P P + P P PP P P + PPP P PP+ Sbjct: 521 PPPPYVYSSPPPPYYSPSPKVYYKSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 575 Score = 31.5 bits (68), Expect = 0.88 Identities = 18/55 (32%), Positives = 21/55 (38%), Gaps = 7/55 (12%) Frame = +1 Query: 838 PPPP----PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXPPF 981 PPPP P P + P P PP P P + PPP P PP+ Sbjct: 738 PPPPYVYSSPPPPYYSPSPKVHYKSPPPPYYAPTPKVHYKSPPPPYVYSSPPPPY 792 Score = 31.5 bits (68), Expect = 0.88 Identities = 19/55 (34%), Positives = 22/55 (40%), Gaps = 7/55 (12%) Frame = +1 Query: 838 PPPP--PPXPXP--XAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXPPF 981 PPPP P P + PP P PP P P + PPP P PP+ Sbjct: 788 PPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPY 842 Score = 31.5 bits (68), Expect = 0.88 Identities = 20/57 (35%), Positives = 23/57 (40%), Gaps = 9/57 (15%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP-----PPXPPF 981 PPPP P P + PP P PP P P + PPPP PP P + Sbjct: 888 PPPPYYSPSPVVDYKSPPPPYVYSSPPPPYYSPSPKVEYK-SPPPPYVYKSPPPPSY 943 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 597 PPPYHSPSPKVQYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPP 649 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 698 PPPCYSPSPKVVYKSPPPPYVYSSPPPPHYSPSPKVYYKSPPPPYVYSSPPPP 750 Score = 30.7 bits (66), Expect = 1.5 Identities = 21/65 (32%), Positives = 24/65 (36%), Gaps = 14/65 (21%) Frame = +1 Query: 829 PPXP----PPPPPXPXP------XAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP----PP 966 PP P PPPP P + PP P PP P P + PPP P Sbjct: 71 PPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSP 130 Query: 967 PXPPF 981 P P + Sbjct: 131 PPPTY 135 Score = 30.7 bits (66), Expect = 1.5 Identities = 21/65 (32%), Positives = 24/65 (36%), Gaps = 14/65 (21%) Frame = +1 Query: 829 PPXP----PPPPPXPXP------XAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP----PP 966 PP P PPPP P + PP P PP P P + PPP P Sbjct: 96 PPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSP 155 Query: 967 PXPPF 981 P P + Sbjct: 156 PPPTY 160 Score = 30.7 bits (66), Expect = 1.5 Identities = 21/65 (32%), Positives = 24/65 (36%), Gaps = 14/65 (21%) Frame = +1 Query: 829 PPXP----PPPPPXPXP------XAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP----PP 966 PP P PPPP P + PP P PP P P + PPP P Sbjct: 121 PPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSP 180 Query: 967 PXPPF 981 P P + Sbjct: 181 PPPTY 185 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 181 PPPTYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPP 233 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 231 PPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPP 283 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 281 PPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 333 Score = 30.7 bits (66), Expect = 1.5 Identities = 21/65 (32%), Positives = 24/65 (36%), Gaps = 14/65 (21%) Frame = +1 Query: 829 PPXP----PPPPPXPXP------XAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP----PP 966 PP P PPPP P + PP P PP P P + PPP P Sbjct: 296 PPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSP 355 Query: 967 PXPPF 981 P P + Sbjct: 356 PPPTY 360 Score = 30.7 bits (66), Expect = 1.5 Identities = 21/65 (32%), Positives = 24/65 (36%), Gaps = 14/65 (21%) Frame = +1 Query: 829 PPXP----PPPPPXPXP------XAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP----PP 966 PP P PPPP P + PP P PP P P + PPP P Sbjct: 321 PPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSP 380 Query: 967 PXPPF 981 P P + Sbjct: 381 PPPTY 385 Score = 30.7 bits (66), Expect = 1.5 Identities = 21/65 (32%), Positives = 24/65 (36%), Gaps = 14/65 (21%) Frame = +1 Query: 829 PPXP----PPPPPXPXP------XAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP----PP 966 PP P PPPP P + PP P PP P P + PPP P Sbjct: 346 PPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSP 405 Query: 967 PXPPF 981 P P + Sbjct: 406 PPPTY 410 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 406 PPPTYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPP 458 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 456 PPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPP 508 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 481 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPP 533 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 547 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPP 599 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 572 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYHSPSPKVQYKSPPPPYVYSSPPPP 624 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 622 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPP 674 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 764 PPPYYAPTPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPP 816 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/58 (29%), Positives = 19/58 (32%), Gaps = 4/58 (6%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPP----PXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 H + PPP PPP P + PP PP P P PP P Sbjct: 775 HYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPP 832 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 789 PPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPP 841 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/59 (30%), Positives = 20/59 (33%), Gaps = 5/59 (8%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 H + PPP PPPP + PPP PP P P PP P Sbjct: 800 HYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYS-PSPKVDYKSPPPP 857 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 814 PPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 866 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 839 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 891 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 864 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPVVDYKSPPPPYVYSSPPPP 916 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 889 PPPYYSPSPVVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYKSPPPP 941 Score = 30.3 bits (65), Expect = 2.0 Identities = 19/67 (28%), Positives = 22/67 (32%), Gaps = 6/67 (8%) Frame = +1 Query: 799 YSLXQXPXXXPPXPPP--PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---- 960 Y P PP P P + PP P PP P P + PPP Sbjct: 44 YKTPPLPYIDSSPPPTYSPAPEVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYS 103 Query: 961 PPPXPPF 981 PP P + Sbjct: 104 SPPPPTY 110 Score = 29.5 bits (63), Expect = 3.6 Identities = 19/58 (32%), Positives = 21/58 (36%), Gaps = 11/58 (18%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPP-------PPPXPP 978 PPPP P P + PP P PP P P + PPP PP P Sbjct: 155 PPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPYYSP 212 Score = 29.5 bits (63), Expect = 3.6 Identities = 19/58 (32%), Positives = 21/58 (36%), Gaps = 11/58 (18%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPP-------PPPXPP 978 PPPP P P + PP P PP P P + PPP PP P Sbjct: 380 PPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPYYSP 437 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP 959 PP P P PP P PP P P PPP Sbjct: 506 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 549 Score = 29.5 bits (63), Expect = 3.6 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 4/54 (7%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP----XPPXPP 977 PP P P PP P PP P P P P PP PP Sbjct: 647 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPP 700 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP 959 PP P P PP P PP P P PPP Sbjct: 723 PPPHYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPP 766 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/53 (30%), Positives = 17/53 (32%), Gaps = 4/53 (7%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PP PP P P PP P Sbjct: 563 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYHSPSPKVQYKSPPPP 615 Score = 29.1 bits (62), Expect = 4.7 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +2 Query: 803 HSXNXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 H PPP P P P PP P PP P P PP P Sbjct: 691 HVCVCPPPPPCYSPSPKVVYKSPPPPYVYSSP---PPPHYSPSPKVYYKSPPPP 741 Score = 29.1 bits (62), Expect = 4.7 Identities = 18/58 (31%), Positives = 19/58 (32%), Gaps = 5/58 (8%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PPP PPPP + PPP PP P P PP P P Sbjct: 714 PPPYVYSSPPPPHYSPSPKVYYKSPPPPYVYSSPPPPYYS-PSPKVHYKSPPPPYYAP 770 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 172 PPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPYYS-PSPKVEYKSPPPP 224 Score = 28.7 bits (61), Expect = 6.2 Identities = 19/58 (32%), Positives = 21/58 (36%), Gaps = 11/58 (18%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPP-------PPPXPP 978 PPPP P P + PP P PP P P + PPP PP P Sbjct: 205 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSP 262 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 222 PPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYS-PSPKVEYKSPPPP 274 Score = 28.7 bits (61), Expect = 6.2 Identities = 19/58 (32%), Positives = 21/58 (36%), Gaps = 11/58 (18%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPP-------PPPXPP 978 PPPP P P + PP P PP P P + PPP PP P Sbjct: 255 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSP 312 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 272 PPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYS-PSPKVDYKSPPPP 324 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 397 PPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPYYS-PSPKVEYKSPPPP 449 Score = 28.7 bits (61), Expect = 6.2 Identities = 19/58 (32%), Positives = 21/58 (36%), Gaps = 11/58 (18%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPP-------PPPXPP 978 PPPP P P + PP P PP P P + PPP PP P Sbjct: 430 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSP 487 Score = 28.7 bits (61), Expect = 6.2 Identities = 18/58 (31%), Positives = 19/58 (32%), Gaps = 5/58 (8%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXPPXXP 976 PPP PPPP + PPP PP P P PP P P Sbjct: 497 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYY-SPSPKVYYKSPPPPYYSP 553 Score = 28.7 bits (61), Expect = 6.2 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +1 Query: 850 PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP P PP P P PP PPPP P Sbjct: 687 PPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYSSPPPPHYSP 729 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 830 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYS-PSPKVDYKSPPPP 882 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/53 (30%), Positives = 17/53 (32%), Gaps = 4/53 (7%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXX----RPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PP PP P P PP P Sbjct: 880 PPPYVYSSPPPPYYSPSPVVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPP 932 >At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 Zinc finger, C3HC4 type (RING finger) Length = 359 Score = 34.7 bits (76), Expect = 0.095 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +1 Query: 919 PPXPPLXXXXXPPPPPPXPP 978 PP PP PPPPPP PP Sbjct: 24 PPPPPYYYLDPPPPPPPFPP 43 >At2g43800.1 68415.m05445 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 894 Score = 34.7 bits (76), Expect = 0.095 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXP 930 PP PPP PP P P PP PP P Sbjct: 87 PPPPPPSPPHPNPFFPSSDPTSTASHPPPAPPPP 120 Score = 32.3 bits (70), Expect = 0.51 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 8/33 (24%) Frame = +3 Query: 900 PXPPPXPPXPXPXXP--------XXPPPXPPXP 974 P PPP PP P P P PPP PP P Sbjct: 88 PPPPPSPPHPNPFFPSSDPTSTASHPPPAPPPP 120 Score = 31.5 bits (68), Expect = 0.88 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PPPPPP P P P P P P PPP PP P Sbjct: 87 PPPPPPSP-----------PHPNP-FFPSSDPTSTASHPPPAPPPP 120 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXP 944 PP PP P P P P P PP P P Sbjct: 89 PPPPSPPHPNPFFPSSDPTSTASHPPPAPPPPASLPTFP 127 Score = 28.3 bits (60), Expect = 8.2 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +1 Query: 796 LYSLXQXPXXXPPXPPPPPPXPXPXAXP-PXGXXPXPXPPXXPPXP 930 L+S P PP PP P P P + P P P PP P Sbjct: 80 LFSSVANPPPPPPSPPHPNPF-FPSSDPTSTASHPPPAPPPPASLP 124 >At2g28440.1 68415.m03455 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains similarity to vegetative cell wall protein gp1 [Chlamydomonas reinhardtii] gi|12018147|gb|AAG45420; + Length = 268 Score = 34.7 bits (76), Expect = 0.095 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 Q P P P PP P A P P P P PPPPPP P Sbjct: 105 QPPSSSPEADSPLPPSSSPEANSPQSPASSPKPESLADSP------SPPPPPPQP 153 Score = 31.9 bits (69), Expect = 0.67 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP P P P + P P P P P PPPPP P Sbjct: 106 PPSSSPEADSPLPPSSSPEANSPQS--PASSPKPESLADSPSPPPPPPQP 153 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/46 (30%), Positives = 15/46 (32%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 PP PPP P P + P P P P P P P Sbjct: 146 PPPPPPQPESPSSPSYPEPAPVPAPSDDDSDDDPEPETEYFPSPAP 191 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 2/56 (3%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPX--GXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P PP P A P P P P P P PP PP Sbjct: 95 PSSSPEVDSPQPPSSSPEADSPLPPSSSPEANSPQSPASSPKPESLADSPSPPPPP 150 Score = 29.9 bits (64), Expect = 2.7 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Frame = +1 Query: 829 PPXPPPPPPXPX-PXAXP-PXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PP P P P + P P P PP PP P P P P P Sbjct: 118 PPSSSPEANSPQSPASSPKPESLADSPSPPPPPPQPESPSSPSYPEPAPVP 168 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPP--PXXXXXRXPPXXXXXXPXPPPXPP-XPXPXXPXXPPPXPPXPP 977 PP P P P P PPP PP P P P P P P Sbjct: 118 PPSSSPEANSPQSPASSPKPESLADSPSPPPPPPQPESPSSPSYPEPAPVPAP 170 >At1g79480.1 68414.m09263 hypothetical protein low similarity to beta-1,3-glucanase-like protein GI:9758115 from [Arabidopsis thaliana] Length = 356 Score = 34.7 bits (76), Expect = 0.095 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP P PP PP P PP P PP PP P PP Sbjct: 162 PPVTVPNPPESSSNPNPPESSS-NPNPPITIPYPPESSSPNPPEIVPSPP 210 Score = 31.5 bits (68), Expect = 0.88 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP P PP PP P PP P P PP P PP Sbjct: 162 PPVTVPNPPESSSNPNPP-ESSSNPNPPITIPYPPESSSPNPPEIVPSPP 210 Score = 29.5 bits (63), Expect = 3.6 Identities = 16/54 (29%), Positives = 17/54 (31%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P PP P P P P P P PP+ P P PP Sbjct: 153 PPESSSNPNPPVTVPNP---PESSSNPNPPESSSNPNPPITIPYPPESSSPNPP 203 Score = 28.3 bits (60), Expect = 8.2 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP P PP G P PP P P PP Sbjct: 66 PNTPPSSSYPGLSPPPGPITLPNPPDSSSNPNSNPNPPESSSNPNPP 112 >At1g30780.1 68414.m03763 F-box family protein Length = 482 Score = 34.7 bits (76), Expect = 0.095 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXXPXPXPPXXPP-XPPLXXXXXPPPPPPXPPF 981 PPPPP P PP P PP P P P P PPF Sbjct: 71 PPPPPPDLPLLAPPLPDVPLLPPPAFPDFEKPRLPVPVWPSLPEYPPF 118 Score = 29.1 bits (62), Expect = 4.7 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 2/51 (3%) Frame = +2 Query: 818 PPPXPXXP-PPPPXXXXXXRPPPXXXXPXXXPPXXPXP-XPSXPXXXPPXP 964 PPP P P PP PPP P P P P PS P PP P Sbjct: 72 PPPPPDLPLLAPPLPDVPLLPPP--AFPDFEKPRLPVPVWPSLP-EYPPFP 119 >At5g07540.2 68418.m00864 glycine-rich protein (GRP16) oleosin; glycine-rich protein 16 (GRP16) PMID:11431566 Length = 190 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G GG G G GG G G GG G GGG GG G G Sbjct: 110 GASGGASGDKPGEMSGAGGPSGDK-PGGASGGGDKPGGASGGGPGGASGGAVG 161 >At4g37900.1 68417.m05360 glycine-rich protein Length = 787 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGG 837 GG GG GGG G GG G G G + G G GGG G Sbjct: 720 GGCGGCGGGGGCGGGGRCGGMTKIEGCGGGSCTGGSTGCGNCGGGCG 766 Score = 30.3 bits (65), Expect = 2.0 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = -2 Query: 981 EXGXXGGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 E G GG GG G G G G GG G G GG G GGG Sbjct: 712 EGGHCGGCGGC--GGCGGGGGCGGGGRCGGMTKIEGCGGGSCTGGSTGCGNCGGG 764 Score = 29.5 bits (63), Expect = 3.6 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 955 GGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 GG G G G GG GGG G G GGG GG Sbjct: 713 GGHCGGCG-GCGGCGGGGGCGGGGRCGGMTKIEGCGGGSCTGG 754 >At4g08400.1 68417.m01388 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 513 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/54 (35%), Positives = 22/54 (40%), Gaps = 6/54 (11%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPP--PPPXPPF 981 PPPP P P + PP P PP P P + PPP P PP+ Sbjct: 217 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYYRSPPPPY 270 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/54 (35%), Positives = 21/54 (38%), Gaps = 6/54 (11%) Frame = +1 Query: 838 PPPPPPXPXPXAX---PPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXPPF 981 PPPP P P PP P PP P P + PPP P PP+ Sbjct: 242 PPPPYYSPSPKVNYKSPPPPYYRSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 295 Score = 33.1 bits (72), Expect = 0.29 Identities = 20/66 (30%), Positives = 23/66 (34%), Gaps = 5/66 (7%) Frame = +1 Query: 799 YSLXQXPXXXPPXPPP--PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---P 963 Y P P PP P P + PP P PP P P + PPP Sbjct: 255 YKSPPPPYYRSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYS 314 Query: 964 PPXPPF 981 P PP+ Sbjct: 315 SPPPPY 320 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 142 PPPPYYSPSPKGDYKSPPPPYVYSSPPPPYYSPSPKVDYK-SPPPPYVYSSPPPPY 196 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 167 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYK-SPPPPYVYSSPPPPY 221 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 192 PPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYK-SPPPPYVYSSPPPPY 246 Score = 32.3 bits (70), Expect = 0.51 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP P P PP P PP P P PPP PP Sbjct: 218 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYYRSPP 267 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 291 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYK-SPPPPYVYSSPPPPY 345 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 316 PPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYK-SPPPPYVYSSPPPPY 370 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 341 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYK-SPPPPYVYNSPPPPY 395 Score = 31.9 bits (69), Expect = 0.67 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 366 PPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYK-SPPPPYIYNSPPPPY 420 Score = 31.9 bits (69), Expect = 0.67 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 391 PPPPYYSPSPKVDYKSPPPPYIYNSPPPPYYSPSPKVNYK-TPPPPYVYSSPPPPY 445 Score = 31.9 bits (69), Expect = 0.67 Identities = 20/56 (35%), Positives = 22/56 (39%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPXAX----PPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P PP P PP P P + PPPP P PP+ Sbjct: 416 PPPPYYSPSPKVNYKTPPPPYVYSSPPPPYYSPSPKVNYK-SPPPPYVYSSPPPPY 470 Score = 31.5 bits (68), Expect = 0.88 Identities = 20/56 (35%), Positives = 22/56 (39%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P PPPP P PP+ Sbjct: 117 PPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPK-GDYKSPPPPYVYSSPPPPY 171 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/59 (30%), Positives = 18/59 (30%), Gaps = 3/59 (5%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 P PP P P PP P PP P P PPP P PP Sbjct: 261 PYYRSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 319 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 68 PPSYYSPSPKVDYKSPPPSYVYSSPPPPYYSPSPKVDYKSLPPPYVYSSPPPP 120 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 93 PPPYYSPSPKVDYKSLPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPP 145 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 118 PPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKGDYKSPPPPYVYSSPPPP 170 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 143 PPPYYSPSPKGDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 195 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 168 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPP 220 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 193 PPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 245 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 292 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPP 344 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 317 PPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 369 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 342 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPP 394 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 367 PPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYIYNSPPPP 419 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 392 PPPYYSPSPKVDYKSPPPPYIYNSPPPPYYSPSPKVNYKTPPPPYVYSSPPPP 444 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 417 PPPYYSPSPKVNYKTPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPP 469 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 4/53 (7%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP----XPPXP 974 PP P P PP P PP P P PPP PP P Sbjct: 442 PPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPNVDYKSPPPPYVYSSPPTP 494 Score = 29.5 bits (63), Expect = 3.6 Identities = 19/54 (35%), Positives = 21/54 (38%), Gaps = 8/54 (14%) Frame = +1 Query: 838 PPPP--PPXPXP--XAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP----PPPXP 975 PPPP P P + PP P PP P P + PPP PP P Sbjct: 441 PPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPNVDYKSPPPPYVYSSPPTP 494 Score = 29.1 bits (62), Expect = 4.7 Identities = 17/54 (31%), Positives = 19/54 (35%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P+ PP P Sbjct: 433 PPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYS-PSPNVDYKSPPPP 485 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 109 PPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYS-PSPKGDYKSPPPP 161 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 134 PPPYVYSSPPPPYYSPSPKGDYKSPPPPYVYSSPPPPYYS-PSPKVDYKSPPPP 186 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 159 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYS-PTPKVDYKSPPPP 211 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 184 PPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYS-PSPKVDYKSPPPP 236 Score = 28.7 bits (61), Expect = 6.2 Identities = 19/58 (32%), Positives = 21/58 (36%), Gaps = 11/58 (18%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPP-------PPPXPP 978 PPPP P P + PP P PP P P + PPP PP P Sbjct: 266 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 323 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 283 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYS-PTPKVDYKSPPPP 335 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 308 PPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYS-PSPKVDYKSPPPP 360 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 333 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYS-PSPKVDYKSPPPP 385 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/53 (30%), Positives = 17/53 (32%), Gaps = 4/53 (7%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PP PP P P PP P Sbjct: 358 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPP 410 Score = 28.3 bits (60), Expect = 8.2 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 P P P P + PP P P P PP PPPP Sbjct: 52 PKYTPHPKPSIYSSSPPPSYYSPSPKVDYKSP-PPSYVYSSPPPP 95 Score = 28.3 bits (60), Expect = 8.2 Identities = 17/52 (32%), Positives = 18/52 (34%), Gaps = 6/52 (11%) Frame = +3 Query: 840 PPP---PPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PPP P + PP P PP P P PPP P PP Sbjct: 243 PPPYYSPSPKVNYKSPPPPYYRSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 294 >At3g53330.1 68416.m05884 plastocyanin-like domain-containing protein similar to mavicyanin SP:P80728 from [Cucurbita pepo] Length = 310 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 P P PPPP P P P PP P PPPP PF Sbjct: 135 PITPSPPPPSKTHEPSRP-NTPPPPPPPSKTHEPSRRITPSPPPPSKILPF 184 Score = 32.7 bits (71), Expect = 0.38 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +2 Query: 812 NXPPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 N P P PPP R P P PP PS P PP PP Sbjct: 112 NGHDPLAITPSPPPPSKTHERSRPITPSP---PPPSKTHEPSRPNTPPPPPP 160 Score = 32.3 bits (70), Expect = 0.51 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 P PPPP P P P PP P PPPPP Sbjct: 121 PSPPPPSKTHERSRPI--TPSPPPPSKTHEPSRPNTPPPPPPP 161 Score = 31.9 bits (69), Expect = 0.67 Identities = 20/63 (31%), Positives = 21/63 (33%), Gaps = 9/63 (14%) Frame = +1 Query: 817 PXXXPPXPPPPPPX-----PXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP----PPPP 969 P P PPPP P + PP P P PP PP P P P Sbjct: 116 PLAITPSPPPPSKTHERSRPITPSPPPPSKTHEPSRPNTPPPPPPPSKTHEPSRRITPSP 175 Query: 970 XPP 978 PP Sbjct: 176 PPP 178 >At3g29390.1 68416.m03693 hydroxyproline-rich glycoprotein family protein sequencing discrepancy between cDNA and genomic sequence prevents representation of entire coding sequence Length = 578 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 PP P P P PP P PP PL PPPP Sbjct: 481 PPPPKTIAPPPSKTMSPPSSKSMLPPPPRSKTMSPLSSKSMLPPPP 526 >At3g21215.1 68416.m02681 RNA-binding protein, putative contains RNA recognition motif, Pfam:PF00076; contains AT-AC splice sites at intron 8 Length = 339 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P P P PP G P PP P PP P P PP Sbjct: 170 PSPFHPPPPPVWGPPHGYMA----PAPPPYDPYAGYHAPPVPMPTPP 212 Score = 32.3 bits (70), Expect = 0.51 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 3/48 (6%) Frame = +2 Query: 800 THSXNXPPPXPXXPPP---PPXXXXXXRPPPXXXXPXXXPPXXPXPXP 934 THS P P PPP PP PPP P P P P Sbjct: 164 THSVYSPSPFHPPPPPVWGPPHGYMAPAPPPYDPYAGYHAPPVPMPTP 211 Score = 31.9 bits (69), Expect = 0.67 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP 960 PP PPPP A PP P P PP P L PP Sbjct: 14 PPAGAPPPPAAVSSAAPP---HPPPIHHHPPPPPVLVDNHNRPP 54 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +3 Query: 831 PXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 P PPPPP P P PPP P P P P P PP Sbjct: 172 PFHPPPPPVWG-----PPHGYMAPAPPPYDPYAGYHAP--PVPMPTPPP 213 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 810 PTXXXXPPXXPPPPPXXXXXRXPPXXXXXXPXPPPXP 920 P PP PPPP PP PPP P Sbjct: 8 PYHQQWPPAGAPPPPAAVSSAAPPHPPPIHHHPPPPP 44 Score = 29.5 bits (63), Expect = 3.6 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 824 PXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 P P PPPPP PP PP P P P PP Sbjct: 170 PSPFHPPPPPVWG-----PPHGYMAPAPPPYDPYAGYHAPPVPMPTPP 212 Score = 28.3 bits (60), Expect = 8.2 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 2/37 (5%) Frame = +1 Query: 859 PXPXAXPPXGXXPXP--XPPXXPPXPPLXXXXXPPPP 963 P PP G P P PP PP PPPP Sbjct: 8 PYHQQWPPAGAPPPPAAVSSAAPPHPPPIHHHPPPPP 44 >At3g15400.1 68416.m01954 anther development protein, putative similar to anther development protein ATA20 GB:AAC50042 GI:2708813 from [Arabidopsis thaliana] Length = 416 Score = 34.3 bits (75), Expect = 0.13 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXG-GXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G G G GG G G G G G G GG G G G GG G G Sbjct: 208 GRGYGSGGSGVGYGVGIGSSGGSGFGEGIGSSGGNGFGEGIGSSGGSGFGEGIG 261 Score = 33.9 bits (74), Expect = 0.17 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGG 840 G G GG G GG G G G G G G GGG G Sbjct: 235 GIGSSGGNGFGEGIGSSGGSGFGEGIGSSGGSGFGEGIGSGGGTG 279 Score = 33.5 bits (73), Expect = 0.22 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G G GG G GG G G G G G G GG G G G Sbjct: 223 GIGSSGGSGFGEGIGSSGGNGFGEGIGSSGGSGFGEGIGSSGGSGFGEGIGSG 275 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/59 (32%), Positives = 20/59 (33%), Gaps = 1/59 (1%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGG-GXGXXXXXXGGXRXXXXXGGGGGXXGGXXXXVG 809 G G G G G G G GG G G GG G GGG G +G Sbjct: 229 GSGFGEGIGSSGGNGFGEGIGSSGGSGFGEGIGSSGGSGFGEGIGSGGGTGIGIGEGIG 287 Score = 29.1 bits (62), Expect = 4.7 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 974 GXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGG 846 G G GG G GG G G G G G G G G Sbjct: 247 GIGSSGGSGFGEGIGSSGGSGFGEGIGSGGGTGIGIGEGIGSG 289 >At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 34.3 bits (75), Expect = 0.13 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGX-GGXGGGXGXXXXXXGGXRXXXXXGGGGG 839 G G GG GG G G G GG GGG G G R GGG Sbjct: 311 GSAGYGGHYGGYGGPGGTGVYGGLGGGYGGPGTGSGQYRMPPSSMPGGG 359 >At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 34.3 bits (75), Expect = 0.13 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGX-GGXGGGXGXXXXXXGGXRXXXXXGGGGG 839 G G GG GG G G G GG GGG G G R GGG Sbjct: 311 GSAGYGGHYGGYGGPGGTGVYGGLGGGYGGPGTGSGQYRMPPSSMPGGG 359 >At3g06780.1 68416.m00805 glycine-rich protein Length = 201 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = -3 Query: 977 GGXGGGGGGXXXXX-RGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 GG G G G GG G G G G G GGGGGG G Sbjct: 92 GGDGDDAGDFGRFLLEGDFGGSDGPFGFGGGGNDGGGKGWNYGGGGGGFG 141 >At2g10940.2 68415.m01168 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 291 Score = 34.3 bits (75), Expect = 0.13 Identities = 24/75 (32%), Positives = 26/75 (34%), Gaps = 11/75 (14%) Frame = +3 Query: 786 LPXAXLTLPTXXXXP---PXXPPPPPXXXXXRXPPXXXXXXPXPP------PXPPXPXPX 938 LP +T+P P P P PP PP P PP P PP P Sbjct: 76 LPVPPVTIPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVPK 135 Query: 939 XPXXPPPXP--PXPP 977 P P P P PP Sbjct: 136 LPVPPVTVPKLPLPP 150 Score = 33.9 bits (74), Expect = 0.17 Identities = 24/75 (32%), Positives = 26/75 (34%), Gaps = 11/75 (14%) Frame = +3 Query: 786 LPXAXLTLPTXXXXP---PXXPPPPPXXXXXRXPPXXXXXXPXPP------PXPPXPXPX 938 LP +T+P P P P PP PP P PP P PP P Sbjct: 46 LPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPVPPVTIPKLPVPPVTVPKLPVPPVTVPK 105 Query: 939 XPXXPPPXP--PXPP 977 P P P P PP Sbjct: 106 LPVPPVTVPKLPVPP 120 Score = 30.3 bits (65), Expect = 2.0 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 8/57 (14%) Frame = +3 Query: 831 PXXPPPPPXXXXXRXPPXXXXXXPXPP------PXPPXPXPXXPXXPPPXP--PXPP 977 P P PP PP P PP P PP P P P P P PP Sbjct: 44 PKLPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPVPPVTIPKLPVPPVTVPKLPVPP 100 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P PP P PP P PP P PL P PP P Sbjct: 110 PVTVPKLPVPPVTVPK-LPVPPVTVPKLPVPPVTVPKLPLPPISGLPIPPVVGP 162 Score = 29.5 bits (63), Expect = 3.6 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXP--PXPPLXXXXXPPPPPPXPP 978 P P P PP P PP P P P P P PPL PP PP Sbjct: 130 PVTVPKLPVPPVTVP-KLPLPPISGLPIP-PVVGPNLPLPPLPIVGPILPPGTTPP 183 Score = 29.1 bits (62), Expect = 4.7 Identities = 19/56 (33%), Positives = 20/56 (35%), Gaps = 3/56 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXX-P--PXPPLXXXXXPPPPPPXP 975 P P P PP P PP P PP P P PP+ P PP P Sbjct: 50 PVTVPKLPVPPVTVPK-LPVPPVTVPKLPVPPVTIPKLPVPPVTVPKLPVPPVTVP 104 Score = 29.1 bits (62), Expect = 4.7 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXP---PXPPLXXXXXPPPPPPXP 975 P P P PP P PP P PP P PP+ P PP P Sbjct: 60 PVTVPKLPVPPVTVPK-LPVPPVTIPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVP 114 Score = 29.1 bits (62), Expect = 4.7 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXP---PXPPLXXXXXPPPPPPXP 975 P P P PP P PP P PP P PP+ P PP P Sbjct: 70 PVTVPKLPVPPVTIPK-LPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVP 124 Score = 29.1 bits (62), Expect = 4.7 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXP---PXPPLXXXXXPPPPPPXP 975 P P P PP P PP P PP P PP+ P PP P Sbjct: 80 PVTIPKLPVPPVTVPK-LPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVP 134 Score = 29.1 bits (62), Expect = 4.7 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXP---PXPPLXXXXXPPPPPPXP 975 P P P PP P PP P PP P PP+ P PP P Sbjct: 90 PVTVPKLPVPPVTVPK-LPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVP 144 Score = 28.3 bits (60), Expect = 8.2 Identities = 20/60 (33%), Positives = 21/60 (35%), Gaps = 6/60 (10%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXP---PXPPLXXXXXPPPP---PPXPP 978 P P P PP P PP P PP P PP+ P PP P PP Sbjct: 100 PVTVPKLPVPPVTVPK-LPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPLPPISGLPIPP 158 >At2g10940.1 68415.m01167 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 291 Score = 34.3 bits (75), Expect = 0.13 Identities = 24/75 (32%), Positives = 26/75 (34%), Gaps = 11/75 (14%) Frame = +3 Query: 786 LPXAXLTLPTXXXXP---PXXPPPPPXXXXXRXPPXXXXXXPXPP------PXPPXPXPX 938 LP +T+P P P P PP PP P PP P PP P Sbjct: 76 LPVPPVTIPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVPK 135 Query: 939 XPXXPPPXP--PXPP 977 P P P P PP Sbjct: 136 LPVPPVTVPKLPLPP 150 Score = 33.9 bits (74), Expect = 0.17 Identities = 24/75 (32%), Positives = 26/75 (34%), Gaps = 11/75 (14%) Frame = +3 Query: 786 LPXAXLTLPTXXXXP---PXXPPPPPXXXXXRXPPXXXXXXPXPP------PXPPXPXPX 938 LP +T+P P P P PP PP P PP P PP P Sbjct: 46 LPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPVPPVTIPKLPVPPVTVPKLPVPPVTVPK 105 Query: 939 XPXXPPPXP--PXPP 977 P P P P PP Sbjct: 106 LPVPPVTVPKLPVPP 120 Score = 30.3 bits (65), Expect = 2.0 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 8/57 (14%) Frame = +3 Query: 831 PXXPPPPPXXXXXRXPPXXXXXXPXPP------PXPPXPXPXXPXXPPPXP--PXPP 977 P P PP PP P PP P PP P P P P P PP Sbjct: 44 PKLPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPVPPVTIPKLPVPPVTVPKLPVPP 100 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P P P PP P PP P PP P PL P PP P Sbjct: 110 PVTVPKLPVPPVTVPK-LPVPPVTVPKLPVPPVTVPKLPLPPISGLPIPPVVGP 162 Score = 29.5 bits (63), Expect = 3.6 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXP--PXPPLXXXXXPPPPPPXPP 978 P P P PP P PP P P P P P PPL PP PP Sbjct: 130 PVTVPKLPVPPVTVP-KLPLPPISGLPIP-PVVGPNLPLPPLPIVGPILPPGTTPP 183 Score = 29.1 bits (62), Expect = 4.7 Identities = 19/56 (33%), Positives = 20/56 (35%), Gaps = 3/56 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXX-P--PXPPLXXXXXPPPPPPXP 975 P P P PP P PP P PP P P PP+ P PP P Sbjct: 50 PVTVPKLPVPPVTVPK-LPVPPVTVPKLPVPPVTIPKLPVPPVTVPKLPVPPVTVP 104 Score = 29.1 bits (62), Expect = 4.7 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXP---PXPPLXXXXXPPPPPPXP 975 P P P PP P PP P PP P PP+ P PP P Sbjct: 60 PVTVPKLPVPPVTVPK-LPVPPVTIPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVP 114 Score = 29.1 bits (62), Expect = 4.7 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXP---PXPPLXXXXXPPPPPPXP 975 P P P PP P PP P PP P PP+ P PP P Sbjct: 70 PVTVPKLPVPPVTIPK-LPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVP 124 Score = 29.1 bits (62), Expect = 4.7 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXP---PXPPLXXXXXPPPPPPXP 975 P P P PP P PP P PP P PP+ P PP P Sbjct: 80 PVTIPKLPVPPVTVPK-LPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVP 134 Score = 29.1 bits (62), Expect = 4.7 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXP---PXPPLXXXXXPPPPPPXP 975 P P P PP P PP P PP P PP+ P PP P Sbjct: 90 PVTVPKLPVPPVTVPK-LPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVP 144 Score = 28.3 bits (60), Expect = 8.2 Identities = 20/60 (33%), Positives = 21/60 (35%), Gaps = 6/60 (10%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXP---PXPPLXXXXXPPPP---PPXPP 978 P P P PP P PP P PP P PP+ P PP P PP Sbjct: 100 PVTVPKLPVPPVTVPK-LPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPLPPISGLPIPP 158 >At2g05380.1 68415.m00566 glycine-rich protein (GRP3S) identical to cDNA glycine-rich protein 3 short isoform (GRP3S) GI:4206766 Length = 116 Score = 34.3 bits (75), Expect = 0.13 Identities = 21/47 (44%), Positives = 21/47 (44%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGG 837 GG G GGG GG GG GG G GG G G GGGG Sbjct: 42 GGFGDNGGGRYQGG-GGHGGHGGG---GYQGGGGRYQGGGGRQGGGG 84 Score = 33.5 bits (73), Expect = 0.22 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -2 Query: 966 GGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGG 820 GG G G G G GG G GGGR GGGG G GG Sbjct: 41 GGGFGDNGGGRYQGGGGHGGHGGGGYQGGGGRYQ-----GGGGRQGGGG 84 Score = 31.1 bits (67), Expect = 1.2 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 GG G GGG G G GG GGG GG R GGGG GG Sbjct: 42 GGFGDNGGGRY-QGGGGHGGHGGG----GYQGGGGRYQ----GGGGRQGG 82 >At1g76930.2 68414.m08956 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 256 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 4/51 (7%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP----PPPP 969 PP PP P PP P P P PP+ PP PPPP Sbjct: 71 PPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPP 121 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/51 (35%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP----PPPP 969 PP PP P + PP P P P PP+ PP PPPP Sbjct: 87 PPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 137 Score = 33.5 bits (73), Expect = 0.22 Identities = 22/60 (36%), Positives = 24/60 (40%), Gaps = 13/60 (21%) Frame = +1 Query: 829 PPXP----PPPP-----PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP----PPPP 969 PP P PPPP P P + PP P P P PP+ PP PPPP Sbjct: 94 PPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 153 Score = 32.7 bits (71), Expect = 0.38 Identities = 19/52 (36%), Positives = 21/52 (40%), Gaps = 8/52 (15%) Frame = +1 Query: 838 PPPP----PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP----PPPP 969 PPPP P P + PP P P P PP+ PP PPPP Sbjct: 30 PPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 81 Score = 32.7 bits (71), Expect = 0.38 Identities = 19/52 (36%), Positives = 21/52 (40%), Gaps = 8/52 (15%) Frame = +1 Query: 838 PPPP----PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP----PPPP 969 PPPP P P + PP P P P PP+ PP PPPP Sbjct: 46 PPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPP 97 Score = 32.7 bits (71), Expect = 0.38 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PPP PP P PP P P PPP PP Sbjct: 72 PPVYKSPPPPVKYYSPPP--VYKSPPPPVYKSPPPPVKHYSPPPVYKSPP 119 Score = 31.5 bits (68), Expect = 0.88 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PPP PP P PP P P PPP PP Sbjct: 56 PPVYKSPPPPVKHYSPPP--VYKSPPPPVKYYSPPPVYKSPPPPVYKSPP 103 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/51 (35%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP----PPPP 969 PP PPP + PP P P P PP+ PP PPPP Sbjct: 56 PPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSP-PPVYKSPPPPVYKSPPPP 105 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PPP + PP PP P P PPP PP Sbjct: 88 PPVYKSPPP--PVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPP 135 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/51 (33%), Positives = 19/51 (37%), Gaps = 4/51 (7%) Frame = +1 Query: 838 PPPP----PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PPPP P P + PP P P P PP+ PP PP Sbjct: 62 PPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPP 112 Score = 29.9 bits (64), Expect = 2.7 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 6/56 (10%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXP------XPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PPP + PP P P PP PP PPP PP Sbjct: 40 PPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPP 95 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PPP PP P PP P P PPP P Sbjct: 96 PPVYKSPPPPVKHYSPPPVYKS--PPPPVKHYSPPPVYKSPPPPVKHYSP 143 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PPP PP P PP P P PPP P Sbjct: 112 PPVYKSPPPPVKHYSPPP--VYKSPPPPVKHYSPPPVYKSPPPPVKHYSP 159 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP 959 PP PPP PP P PP P P PPP Sbjct: 40 PPVYKSPPPPVKHYSPPP--VYKSPPPPVKHYSPPPVYKSPPPP 81 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/50 (32%), Positives = 18/50 (36%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PPP + PP P P P PP+ PP PP Sbjct: 112 PPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSP-PPVYKSPPPPVKHYSPP 160 >At1g76930.1 68414.m08955 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 293 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 4/51 (7%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP----PPPP 969 PP PP P PP P P P PP+ PP PPPP Sbjct: 71 PPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPP 121 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/51 (35%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP----PPPP 969 PP PP P + PP P P P PP+ PP PPPP Sbjct: 87 PPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 137 Score = 33.5 bits (73), Expect = 0.22 Identities = 22/60 (36%), Positives = 24/60 (40%), Gaps = 13/60 (21%) Frame = +1 Query: 829 PPXP----PPPP-----PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP----PPPP 969 PP P PPPP P P + PP P P P PP+ PP PPPP Sbjct: 94 PPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 153 Score = 32.7 bits (71), Expect = 0.38 Identities = 19/52 (36%), Positives = 21/52 (40%), Gaps = 8/52 (15%) Frame = +1 Query: 838 PPPP----PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP----PPPP 969 PPPP P P + PP P P P PP+ PP PPPP Sbjct: 30 PPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 81 Score = 32.7 bits (71), Expect = 0.38 Identities = 19/52 (36%), Positives = 21/52 (40%), Gaps = 8/52 (15%) Frame = +1 Query: 838 PPPP----PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP----PPPP 969 PPPP P P + PP P P P PP+ PP PPPP Sbjct: 46 PPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPP 97 Score = 32.7 bits (71), Expect = 0.38 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PPP PP P PP P P PPP PP Sbjct: 72 PPVYKSPPPPVKYYSPPP--VYKSPPPPVYKSPPPPVKHYSPPPVYKSPP 119 Score = 31.5 bits (68), Expect = 0.88 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PPP PP P PP P P PPP PP Sbjct: 56 PPVYKSPPPPVKHYSPPP--VYKSPPPPVKYYSPPPVYKSPPPPVYKSPP 103 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/51 (35%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP----PPPP 969 PP PPP + PP P P P PP+ PP PPPP Sbjct: 56 PPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSP-PPVYKSPPPPVYKSPPPP 105 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PPP + PP PP P P PPP PP Sbjct: 88 PPVYKSPPP--PVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPP 135 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/51 (33%), Positives = 19/51 (37%), Gaps = 4/51 (7%) Frame = +1 Query: 838 PPPP----PPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PPPP P P + PP P P P PP+ PP PP Sbjct: 62 PPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPP 112 Score = 29.9 bits (64), Expect = 2.7 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 6/56 (10%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXP------XPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PPP + PP P P PP PP PPP PP Sbjct: 40 PPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPP 95 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PPP PP P PP P P PPP P Sbjct: 96 PPVYKSPPPPVKHYSPPPVYKS--PPPPVKHYSPPPVYKSPPPPVKHYSP 143 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXPP 977 PP PPP PP P PP P P PPP P Sbjct: 112 PPVYKSPPPPVKHYSPPP--VYKSPPPPVKHYSPPPVYKSPPPPVKHYSP 159 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP 959 PP PPP PP P PP P P PPP Sbjct: 40 PPVYKSPPPPVKHYSPPP--VYKSPPPPVKHYSPPPVYKSPPPP 81 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/50 (32%), Positives = 18/50 (36%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP PPP + PP P P P PP+ PP PP Sbjct: 112 PPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSP-PPVYKSPPPPVKHYSPP 160 >At1g70250.1 68414.m08082 receptor serine/threonine kinase, putative similar to to receptor serine/threonine kinase PR5K gi|1235680|gb|AAC49208 Length = 799 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +1 Query: 844 PPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PPPP P PP P PP P PP P P P P Sbjct: 101 PPPP---PDLFPPPSAQMLPPPPASSPAPPSPPSSSRPRPLPRP 141 >At1g11130.1 68414.m01274 leucine-rich repeat family protein / protein kinase family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to leucine-rich repeat transmembrane protein kinase 2 [Zea mays] gi|3360291|gb|AAC27895 Length = 768 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 3/50 (6%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXP---XPXPPXXPPXPPLXXXXXPPPPPP 969 PP PP P P PP P P P PL PPP PP Sbjct: 249 PPPPPVVDPPPATHRAPPVPRIPPVSGVPPAPFAPFAPLQPQQHPPPSPP 298 Score = 28.3 bits (60), Expect = 8.2 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 8/53 (15%) Frame = +1 Query: 844 PPPPXPXPXAXPPXGXXPXPXPPXXPP---XPPLXXXXXPP-----PPPPXPP 978 PPPP P PP P P PP PP P PPP PP Sbjct: 249 PPPP---PVVDPPPATHRAPPVPRIPPVSGVPPAPFAPFAPLQPQQHPPPSPP 298 Score = 28.3 bits (60), Expect = 8.2 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPP 968 PP PPP P P P P PPP PP Sbjct: 252 PPVVDPPPATHRAPPVPRIPPVSGVPPAPFAPFAPLQPQQHPPPSPP 298 >At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 554 Score = 34.3 bits (75), Expect = 0.13 Identities = 23/60 (38%), Positives = 23/60 (38%), Gaps = 11/60 (18%) Frame = +1 Query: 832 PXPPPP------PPXPXPXAXPPXGXXPXPXPPXX---PPXPPLXXXXXP--PPPPPXPP 978 P PPPP PP P P A P PP PP PPL PPP PP Sbjct: 222 PLPPPPGRAALPPPPPLPMAVRKGVAAPPLPPPGTAALPPPPPLPMAAGKGVAAPPPPPP 281 Score = 34.3 bits (75), Expect = 0.13 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 9/58 (15%) Frame = +1 Query: 829 PPXP-----PPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PP P PPPPP P A PP P PP P PPPP P Sbjct: 224 PPPPGRAALPPPPPLPMAVRKGVAAPPLPPPGTAALPPPPPLPMAAGKGVAAPPPPPP 281 Score = 32.3 bits (70), Expect = 0.51 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +1 Query: 841 PPPPPXPXPXAXP--PXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 PPPPP P A P P P PP PPPPP Sbjct: 194 PPPPPPPGNAAIPVEPPLTMSAEKESYAPLPPPPGRAALPPPPP 237 Score = 32.3 bits (70), Expect = 0.51 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 4/49 (8%) Frame = +3 Query: 840 PPPPPXXXXXRX----PPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 PPPPP R PP PP PP P P PP P Sbjct: 233 PPPPPLPMAVRKGVAAPPLPPPGTAALPPPPPLPMAAGKGVAAPPPPPP 281 Score = 31.5 bits (68), Expect = 0.88 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 PP PPPP P PP P PP PPPP P Sbjct: 194 PPPPPPPGNAAIP-VEPPLTMSAEKESYAPLPPPPGRAALPPPPPLP 239 Score = 29.5 bits (63), Expect = 3.6 Identities = 16/54 (29%), Positives = 18/54 (33%), Gaps = 4/54 (7%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXPP 967 PP PPPPP + PP PP P P + P PP Sbjct: 226 PPGRAALPPPPPLPMAVRKGVAAPPLPPPGTAALPPPPPLPMAAGKGVAAPPPP 279 >At5g25550.1 68418.m03040 leucine-rich repeat family protein / extensin family protein similar to leucine-rich repeat/extensin 1 (GI:13809918) [Arabidopsis thaliana]; contains Pfam PF00560: Leucine Rich Repeat domains Length = 433 Score = 33.9 bits (74), Expect = 0.17 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = +1 Query: 847 PPPXPXPXAXPPXGXXPXPXPPXX---PPXPPLXXXXXPPPPPP 969 PPP + P P P P PP P PPPPPP Sbjct: 382 PPPSQISPSSQPLAPAPSPTSPPLSTPPPARPCPPVYSPPPPPP 425 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 PP P P A P P PP P PP+ PPPP P Sbjct: 383 PPSQISPSSQPLAPAPSPTSP-PLSTPPPARPCPPVYSP-PPPPPLSLAP 430 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/42 (30%), Positives = 13/42 (30%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXRPPPXXXXPXXXPPXXPXPXPSXP 943 P P P P P PPP P P P P P Sbjct: 389 PSSQPLAPAPSPTSPPLSTPPPARPCPPVYSPPPPPPLSLAP 430 >At5g06640.1 68418.m00750 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 689 Score = 33.9 bits (74), Expect = 0.17 Identities = 19/55 (34%), Positives = 22/55 (40%), Gaps = 7/55 (12%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXPPF 981 PPPP P P + PP P PP P P + PPP P PP+ Sbjct: 162 PPPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKIEYKSPPPPYVYSSPPPPY 216 Score = 32.7 bits (71), Expect = 0.38 Identities = 17/54 (31%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXPPF 981 PP P P + PP P PP P P + PPP P PP+ Sbjct: 88 PPSYYSPSPKVNYKSPPPPNVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 141 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 112 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYK-SPPPPYVYSSPPPPY 166 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 137 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYK-SPPPPYVYNSPPPPY 191 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 187 PPPPYYSPSPKIEYKSPPPPYVYSSPPPPYYSPSPKVDYK-SPPPPYVYNSPPPPY 241 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 237 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYFSPSPKVEYK-SPPPPYVYNSPPPPY 291 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 287 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVYYK-SPPPPYVYSSPPPPY 341 Score = 32.3 bits (70), Expect = 0.51 Identities = 19/53 (35%), Positives = 21/53 (39%), Gaps = 9/53 (16%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPP-----PPP 969 PPPP P P + PP P PP P P + PPP PPP Sbjct: 337 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPP 389 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 412 PPPPYYSPSPKVAYKSPPPPYVYSSPPPPYYSPSPKVDYK-SPPPPYVYSSPPPPY 466 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 437 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYK-SPPPPYVYSSPPPPY 491 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 462 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYK-SPPPPYVYSSPPPPY 516 Score = 31.9 bits (69), Expect = 0.67 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 212 PPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYK-SPPPPYVYSSPPPPY 266 Score = 31.5 bits (68), Expect = 0.88 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P PP P P + PPPP P PP+ Sbjct: 262 PPPPYFSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKVEYK-SPPPPYVYSSPPPPY 316 Score = 31.5 bits (68), Expect = 0.88 Identities = 19/55 (34%), Positives = 22/55 (40%), Gaps = 7/55 (12%) Frame = +1 Query: 838 PPPP--PPXPXP--XAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP---PPPXPPF 981 PPPP P P + PP P PP P P + PPP P PP+ Sbjct: 312 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 366 Score = 31.5 bits (68), Expect = 0.88 Identities = 16/45 (35%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPP 960 PPPP P P + PP P PP P P + PPP Sbjct: 487 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYHSPSPKVNYKSPPPP 531 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 88 PPSYYSPSPKVNYKSPPPPNVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 140 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 113 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 165 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 138 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYNSPPPP 190 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 188 PPPYYSPSPKIEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPP 240 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 213 PPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 265 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 238 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYFSPSPKVEYKSPPPPYVYNSPPPP 290 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 288 PPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPP 340 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 313 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 365 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 388 PPQYYSPSPKVAYKSPPPPYVYSSPPPPYYSPSPKVAYKSPPPPYVYSSPPPP 440 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 413 PPPYYSPSPKVAYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 465 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 438 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPP 490 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 463 PPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPP 515 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 538 PPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPP 590 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 163 PPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKIEYKSPPPPYVYSSPPPP 215 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP---XPPXPP 977 PP P P PP P PP P P PPP P PP Sbjct: 263 PPPYFSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPPYVYSSPPPP 315 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 4/53 (7%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP----XPPXP 974 PP P P PP P PP P P PPP PP P Sbjct: 563 PPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPMVDYKSTPPPYVYSFPPLP 615 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP 959 PP P P PP P PP P P PPP Sbjct: 338 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 381 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP 959 PP P P PP P PP P P PPP Sbjct: 488 PPPYYSPSPKVEYKSPPPPYVYSSPPPPYHSPSPKVNYKSPPPP 531 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP 959 PP P P PP P PP P P PPP Sbjct: 638 PPLYYSPSPKVHYKSPPPPYVYNSPPPPYYSPSPKVTYKSPPPP 681 Score = 29.1 bits (62), Expect = 4.7 Identities = 19/56 (33%), Positives = 22/56 (39%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP P P P P + PPPP P PP+ Sbjct: 362 PPPPYYSPSPKVDYKSPPPPYVYSSPPPQYYSPSPKVAYK-SPPPPYVYSSPPPPY 416 Score = 29.1 bits (62), Expect = 4.7 Identities = 19/56 (33%), Positives = 22/56 (39%), Gaps = 8/56 (14%) Frame = +1 Query: 838 PPPPPPXPXPX----AXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP----PPXPPF 981 PPPP P P + PP PP P P + PPPP P PP+ Sbjct: 512 PPPPYHSPSPKVNYKSPPPPYVYSSHPPPYYSPSPKVNYK-SPPPPYVYSSPPPPY 566 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/44 (31%), Positives = 16/44 (36%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP 960 PP P P + PP P PP P P + PPP Sbjct: 638 PPLYYSPSPKVHYKSPPPPYVYNSPPPPYYSPSPKVTYKSPPPP 681 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/53 (30%), Positives = 17/53 (32%), Gaps = 4/53 (7%) Frame = +2 Query: 818 PPPXPXXPPPP----PXXXXXXRPPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPP P + PP PP P P PP P Sbjct: 104 PPPNVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 156 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 129 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYS-PSPKVEYKSPPPP 181 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/53 (30%), Positives = 17/53 (32%), Gaps = 4/53 (7%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PP PP P P PP P Sbjct: 154 PPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKIEYKSPPPP 206 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 179 PPPYVYNSPPPPYYSPSPKIEYKSPPPPYVYSSPPPPYYS-PSPKVDYKSPPPP 231 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/53 (30%), Positives = 17/53 (32%), Gaps = 4/53 (7%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PP PP P P PP P Sbjct: 204 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPP 256 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/53 (30%), Positives = 17/53 (32%), Gaps = 4/53 (7%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PP PP P P PP P Sbjct: 254 PPPYVYSSPPPPYFSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPP 306 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 304 PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYS-PSPKVDYKSPPPP 356 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 329 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYS-PSPKVDYKSPPPP 381 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/53 (30%), Positives = 17/53 (32%), Gaps = 4/53 (7%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PP PP P P PP P Sbjct: 354 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPQYYSPSPKVAYKSPPPP 406 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 404 PPPYVYSSPPPPYYSPSPKVAYKSPPPPYVYSSPPPPYYS-PSPKVDYKSPPPP 456 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 429 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYS-PSPKVEYKSPPPP 481 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 818 PPPXPXXPPPPPXXXXXXR-----PPPXXXXPXXXPPXXPXPXPSXPXXXPPXP 964 PPP PPPP + PPP PP P P PP P Sbjct: 454 PPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYS-PSPKVEYKSPPPP 506 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +1 Query: 847 PPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPP 960 PPP + PP P P P PP PPP Sbjct: 503 PPPPYVYSSPPPPYHSPSPKVNYKSPPPPYVYSSHPPP 540 >At4g03120.1 68417.m00425 proline-rich family protein similar to U1 small nuclear ribonucleoprotein C; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 207 Score = 33.9 bits (74), Expect = 0.17 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 6/61 (9%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP-XPPLXXXXXPPPP-----PPXPP 978 P P P PP P P G P P PP P+ PPP PP PP Sbjct: 116 PQMMAPPGAPLPPPPQNGILRPPGMAPIPGQGGGPPGMAPIPGQGGGPPPNYNGLPPPPP 175 Query: 979 F 981 + Sbjct: 176 Y 176 Score = 31.5 bits (68), Expect = 0.88 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXP-PXPPLXXXXXPPPPPPXP 975 P P P P P PP G PP P P PP PP P P Sbjct: 91 PMGMRPPVLPRPMMPPQGYMPPPGVPQMMAPPGAPLPPPPQNGILRPPGMAPIP 144 Score = 30.7 bits (66), Expect = 1.5 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 6/55 (10%) Frame = +1 Query: 817 PXXXPPXPPP----PPPXPXPXAXPPXGXXPXPXPP--XXPPXPPLXXXXXPPPP 963 P PP P PP P P PP G P P P PP PL PPPP Sbjct: 82 PMMLPPGSMPMGMRPPVLPRP-MMPPQGYMPPPGVPQMMAPPGAPL-----PPPP 130 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 5/55 (9%) Frame = +3 Query: 828 PPXXP-PPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPP----XPPXPP 977 PP P PPPP R P P P P PPP PP PP Sbjct: 121 PPGAPLPPPPQNGILRPPGMAPIPGQGGGPPGMAPIPGQGGGPPPNYNGLPPPPP 175 Score = 29.5 bits (63), Expect = 3.6 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 5/50 (10%) Frame = +1 Query: 844 PPPPXPXPXAXPPXGXXPXPXP-PXXPPX----PPLXXXXXPPPPPPXPP 978 P PP P P G P P P PP PP PP P PP Sbjct: 79 PRPPMMLPPGSMPMGMRPPVLPRPMMPPQGYMPPPGVPQMMAPPGAPLPP 128 >At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacyanin 3 GI:3395770 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain; identical to cDNA uclacyanin 3 (UCC3)GI:3395769 Length = 222 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 P PP PP P P + PP P PP PPP P PP Sbjct: 148 PSSPPSPPSPPSP-SLPPSSLPPSASPPTNGTP---DSETLTPPPAPLPP 193 Score = 31.9 bits (69), Expect = 0.67 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPP---PPPPXPP 978 P P PP P + PP P P PP PP PP PP PP Sbjct: 125 PSTPSSPPSTPSTPSSPP-STPSTPSSPPSPPSPP--SPSLPPSSLPPSASPP 174 Score = 29.5 bits (63), Expect = 3.6 Identities = 17/61 (27%), Positives = 18/61 (29%), Gaps = 2/61 (3%) Frame = +3 Query: 801 LTLPTXXXXPPXXPP--PPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 L +P P P PP PP PP P P P P P P Sbjct: 114 LAVPVLAAAPSPSTPSSPPSTPSTPSSPPSTPSTPSSPPSPPSPPSPSLPPSSLPPSASP 173 Query: 975 P 977 P Sbjct: 174 P 174 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/59 (28%), Positives = 18/59 (30%) Frame = +1 Query: 802 SLXQXPXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPP 978 S P P P PP P + PP P P P PP PP P Sbjct: 126 STPSSPPSTPSTPSSPPSTPSTPSSPPS-----PPSPPSPSLPPSSLPPSASPPTNGTP 179 >At3g25500.1 68416.m03171 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 1051 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +1 Query: 817 PXXXPPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPP 966 P PP P PP P P P P P P PL PPP P Sbjct: 32 PIDSPP-PSPPSPPPLPKLPFSSTTPPSSSDPNASPFFPLYPSSPPPPSP 80 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/49 (30%), Positives = 15/49 (30%), Gaps = 1/49 (2%) Frame = +1 Query: 832 PXPPPPPPXPXPXAXPPXGXXPXPXPPXXPP-XPPLXXXXXPPPPPPXP 975 P PPP P P P P P P PPPP P Sbjct: 32 PIDSPPPSPPSPPPLPKLPFSSTTPPSSSDPNASPFFPLYPSSPPPPSP 80 Score = 28.7 bits (61), Expect = 6.2 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +1 Query: 829 PPXPPPPPPXP 861 PP PPPPPP P Sbjct: 526 PPPPPPPPPLP 536 Score = 23.4 bits (48), Expect(2) = 8.5 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 952 PPPPPPXP 975 PPPPPP P Sbjct: 529 PPPPPPLP 536 Score = 23.0 bits (47), Expect(2) = 8.5 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +1 Query: 841 PPPPPXPXP 867 PPPPP P P Sbjct: 526 PPPPPPPPP 534 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 33.9 bits (74), Expect = 0.17 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = +1 Query: 811 QXPXXXPPXPPPPPPXP---XPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPP 963 Q P PP P PP P + PP P PP PP P P PP Sbjct: 5 QSPENSPPSPTPPSPSSSDNQQQSSPPPSDSSSPSPP-APPPPDDSSNGSPQPP 57 Score = 28.7 bits (61), Expect = 6.2 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 912 PXPPXPXPXXPXXPPPXPP 968 P PP P P PPP PP Sbjct: 267 PPPPPPGSWQPSPPPPPPP 285 Score = 28.3 bits (60), Expect = 8.2 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 919 PPXPPLXXXXXPPPPPP 969 PP PP PPPPPP Sbjct: 268 PPPPPGSWQPSPPPPPP 284 >At3g05220.1 68416.m00569 heavy-metal-associated domain-containing protein similar to farnesylated protein 1 (GI:23304411) {Hordeum vulgare subsp. spontaneum}; contains Pfam profile PF00403: Heavy-metal-associated domain Length = 577 Score = 33.9 bits (74), Expect = 0.17 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GGGGGG G G P GG G GGG GG Sbjct: 77 GGGGGGGGGKGFPNLNGQFANL-NMGGNNKPKGGKESNQVKGKAGGGGGG 125 Score = 29.5 bits (63), Expect = 3.6 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGG 837 GG GGG G G GG G G P G G G G G Sbjct: 404 GGGGGGNKGNHNHSAKGIGGGPMGPGGPMGPGGPMGQGGPMGMMGPG 450 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 GG GG GGG G G GG G GG GG Sbjct: 76 GGGGGGGGGGKGFPNLNGQFANLNMGGNNKPKGGKESNQVKGKAGGGGGG 125 >At2g34670.1 68415.m04259 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 561 Score = 33.9 bits (74), Expect = 0.17 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 912 PXPPXPXPXXPXXPPPXPPXPP 977 P PP P P P PPP PP P Sbjct: 73 PLPPSPPPTLPPSPPPPPPFSP 94 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 922 PXPPLXXXXXPPPPPPXPPF 981 P PP PP PPP PPF Sbjct: 73 PLPPSPPPTLPPSPPPPPPF 92 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 919 PPXPPLXXXXXPPPPPPXPP 978 PP PP PPPPPP P Sbjct: 75 PPSPPPTLPPSPPPPPPFSP 94 Score = 28.3 bits (60), Expect = 8.2 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 909 PPXPPXPXPXXPXXPPPXPP 968 PP PP P P PPP P Sbjct: 75 PPSPPPTLPPSPPPPPPFSP 94 >At2g04190.1 68415.m00404 meprin and TRAF homology domain-containing protein / MATH domain-containing protein similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 411 Score = 33.9 bits (74), Expect = 0.17 Identities = 26/62 (41%), Positives = 26/62 (41%), Gaps = 8/62 (12%) Frame = -3 Query: 977 GGXGGGGG-GXXXXXR-GGXGGXXGGXGXGXXPX---GGXAXGXGXGGGGG---GXGGXX 822 GG GGG G G R G G G G P GG G G GGGGG G GG Sbjct: 33 GGRGGGPGRGYGGGPRVHGPGYGIGSRGPDPGPGFFFGGAGPGPGYGGGGGHGPGYGGGG 92 Query: 821 XG 816 G Sbjct: 93 DG 94 Score = 29.5 bits (63), Expect = 3.6 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -2 Query: 966 GGXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G GG G G G G GG GGGG G GGG Sbjct: 42 GYGGGPRVHGPGYGIGSRGPDPGPGFFFGGAGPGPGYGGGGGHGPGYGGG 91 Score = 28.3 bits (60), Expect = 8.2 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -2 Query: 954 GXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXG 829 G G G G G GG G GGG GGG G Sbjct: 66 GFFFGGAGPGPGYGGGGGHGPGYGGGGDGRGYGSETGGGNHG 107 >At1g63550.1 68414.m07184 hypothetical protein low similarity to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam profile: PF01657 Domain of unknown function DUF26 Length = 299 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PPP P P P + PP P P P PPL PP P P Sbjct: 226 PPPSPSAPPPRSPPPKSSPPSSLP--QTPSPPL--VFTPPQNVPNP 267 Score = 31.5 bits (68), Expect = 0.88 Identities = 13/29 (44%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +1 Query: 829 PPXPPPPPP-XPXPXAXPPXGXXPXPXPP 912 PP P PPP P P + PP P PP Sbjct: 227 PPSPSAPPPRSPPPKSSPPSSLPQTPSPP 255 >At1g24490.1 68414.m03084 60 kDa inner membrane family protein similar to chloroplast membrane protein (ALBINO3) (GI:3927828) [Arabidopsis thaliana] Length = 1013 Score = 33.9 bits (74), Expect = 0.17 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 6/64 (9%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXP--XGGXAXGXGXGGGGG----GXGGXXXGXWX 807 GG G G G G G G G P GG GGGGG G GG G Sbjct: 389 GGSGNGTNSTSTSGGGSPSPGGGSGSPPSTGGGSGSPPSTGGGGGSPSKGGGGGKSGKSG 448 Query: 806 SEXS 795 E S Sbjct: 449 EEKS 452 Score = 33.1 bits (72), Expect = 0.29 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -2 Query: 963 GXGGXXXGXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G G G G GG GGG GGGGG GGG Sbjct: 392 GNGTNSTSTSGGGSPSPGGGSGSPPSTGGGSGSPPSTGGGGGSPSKGGG 440 Score = 31.5 bits (68), Expect = 0.88 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -1 Query: 973 GXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGG 839 G G G G G GGG G GG GGGGG Sbjct: 389 GGSGNGTNSTSTSGGGSPSPGGGSGSPPSTGGGSGSPPSTGGGGG 433 >At1g13020.1 68414.m01510 eukaryotic translation initiation factor, putative (EIF4B5) eukaryotic initiation factor 4B (GI:6739522) {Arabidopsis thaliana}; EST gb|T22808 comes from this gene Length = 549 Score = 33.9 bits (74), Expect = 0.17 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -3 Query: 932 GGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GG GG G G G G G G G GG GG Sbjct: 186 GGGGGSFGGGGGGG---AGSYGGGGAGAGSGGGGG 217 Score = 33.5 bits (73), Expect = 0.22 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXG 899 G G GG GGG G G G G G G G Sbjct: 188 GGGSFGGGGGGGAGSYGGGGAGAGSGGG 215 Score = 31.9 bits (69), Expect = 0.67 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGG 905 GG GG G G G G G G GGG Sbjct: 193 GGGGGGGAGSYGGGGAGAGSGGGG 216 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXG 894 G GGGGGG GG G G G G Sbjct: 190 GSFGGGGGGGAGSYGGGGAGAGSGGGGG 217 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 982 GXGGXGGXGGGXXGXXGXGXGGXGGGXG 899 G GG GGG G G GG G G G Sbjct: 186 GGGGGSFGGGGGGGAGSYGGGGAGAGSG 213 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 967 GGXGGGXXGXXGXGXGGXGGGXGXXXXXXGG 875 GG GG G G G G GGG GG Sbjct: 186 GGGGGSFGGGGGGGAGSYGGGGAGAGSGGGG 216 Score = 29.1 bits (62), Expect = 4.7 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGGXXXG 816 G G +G G GG G GG G GGGG G G G Sbjct: 167 GKGKKSLPSFDQGRQGSRYGGGGGSFGGGGGGGAG-SYGGGGAGAGSGGGG 216 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -2 Query: 942 GXEGXGXGXXGGXXXGXXXXGGGRXXXXXXGGGGGXXGXGGG 817 G +G G GG G GGG GG G G GGG Sbjct: 179 GRQGSRYGGGGGSFGGG---GGGGAGSYGGGGAGAGSGGGGG 217 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 3/31 (9%) Frame = -1 Query: 982 GXGGX--GGXGGGXXGXXGXGXG-GXGGGXG 899 G GG GG GGG G G G G GGG G Sbjct: 187 GGGGSFGGGGGGGAGSYGGGGAGAGSGGGGG 217 >At5g41440.1 68418.m05033 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 124 Score = 26.2 bits (55), Expect(2) = 0.21 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 829 PPXPPPPPP 855 PP PPPPPP Sbjct: 35 PPPPPPPPP 43 Score = 26.2 bits (55), Expect(2) = 0.21 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 952 PPPPPPXPP 978 PPPPPP PP Sbjct: 36 PPPPPPPPP 44 >At5g51300.2 68418.m06360 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 33.5 bits (73), Expect = 0.22 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 16/62 (25%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAX--PPXGXXPXPXP--------------PXXPPXPPLXXXXXPPP 960 PP PP PP P P PP P P P PP P PPP Sbjct: 561 PPIAPPGPPAPQPPTQGYPPSNQPPGAYPSQQYATGGYSTAPVPWGPPVPSYSPYALPPP 620 Query: 961 PP 966 PP Sbjct: 621 PP 622 Score = 29.5 bits (63), Expect = 3.6 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 3/51 (5%) Frame = +1 Query: 838 PPPPPPXPXPXAX---PPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 PPPPP P PP G P PP PP P P F Sbjct: 618 PPPPPGSYHPVHGQHMPPYGMQYPPPPPHVTQAPPPGTTQNPSSSEPQQSF 668 >At5g51300.1 68418.m06359 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 33.5 bits (73), Expect = 0.22 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 16/62 (25%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAX--PPXGXXPXPXP--------------PXXPPXPPLXXXXXPPP 960 PP PP PP P P PP P P P PP P PPP Sbjct: 561 PPIAPPGPPAPQPPTQGYPPSNQPPGAYPSQQYATGGYSTAPVPWGPPVPSYSPYALPPP 620 Query: 961 PP 966 PP Sbjct: 621 PP 622 Score = 29.5 bits (63), Expect = 3.6 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 3/51 (5%) Frame = +1 Query: 838 PPPPPPXPXPXAX---PPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXPPF 981 PPPPP P PP G P PP PP P P F Sbjct: 618 PPPPPGSYHPVHGQHMPPYGMQYPPPPPHVTQAPPPGTTQNPSSSEPQQSF 668 >At4g19920.1 68417.m02918 disease resistance protein (TIR class), putative domain signature TIR exists, suggestive of a disease resistance protein. Length = 274 Score = 33.5 bits (73), Expect = 0.22 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PP PPP P P + P P PP P P PP P Sbjct: 3 PPSPPPPPIPESRPRPLTPPVLLTRPRPPLPYARPLQPPQSLPPRP 48 Score = 32.3 bits (70), Expect = 0.51 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +1 Query: 829 PPXPPPPPPXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPP 969 P PPPP P P P P PP P PP P P Sbjct: 4 PSPPPPPIPESRPRPLTPPVLLTRPRPPLPYARPLQPPQSLPPRPRP 50 Score = 29.5 bits (63), Expect = 3.6 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 831 PXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXPXXPPPXPPXP 974 P PPPPP P P P P P P P PP P Sbjct: 3 PPSPPPPPIPESRPRPLTPPVLLTRPRPPLPYARPLQP--PQSLPPRP 48 >At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At3g25690, At5g61090 [Arabidopsis thaliana] Length = 681 Score = 33.5 bits (73), Expect = 0.22 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 3/48 (6%) Frame = +1 Query: 841 PPPPPXPXPXAXPPXGXX---PXPXPPXXPPXPPLXXXXXPPPPPPXP 975 PPPPP P P PP PP P PPPP P Sbjct: 297 PPPPPLTSPQTPSPTVSTFNTKSSLRSQPPPPPPSPEHKAPAPPPPPP 344 Score = 33.1 bits (72), Expect = 0.29 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 6/48 (12%) Frame = +3 Query: 840 PPPPPXXXXXRXPPXXXXXXPX------PPPXPPXPXPXXPXXPPPXP 965 PPPPP P PPP PP P P PPP P Sbjct: 297 PPPPPLTSPQTPSPTVSTFNTKSSLRSQPPPPPPSPEHKAPAPPPPPP 344 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 33.5 bits (73), Expect = 0.22 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGG 840 GG G GG RGG G G G G GG GG GG Sbjct: 192 GGYGSERGGGYGSERGGGYGSERGGGYGSERGGGYGSQRSGGGYGG 237 Score = 32.3 bits (70), Expect = 0.51 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXG 831 GG G GG RGG G G G G GG G G G G Sbjct: 200 GGYGSERGGGYGSERGGGYGSERGGGYGSQRSGGGYGGSQRSSYGSGSG 248 Score = 31.5 bits (68), Expect = 0.88 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = -3 Query: 977 GGXGGG-GGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGG 840 GG G GGG GG G G G G G G G G G Sbjct: 208 GGYGSERGGGYGSERGGGYGSQRSGGGYGGSQRSSYGSGSGSGSGSG 254 >At1g77030.1 68414.m08970 glycine-rich protein Length = 349 Score = 33.5 bits (73), Expect = 0.22 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGG---GGGXGG 828 GG GG GG RGG GG G G G + G GG GG GG Sbjct: 208 GGRGGARGGRGGGARGGRGGSR-DFGGGGRDFGSSSDRGGRSGGRDFGGRRGG 259 Score = 33.5 bits (73), Expect = 0.22 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 4/54 (7%) Frame = -3 Query: 977 GGXGG----GGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GG GGGG GG GG G G G GGG GG Sbjct: 223 GGRGGSRDFGGGGRDFGSSSDRGGRSGGRDFGGRRGGASTSSRGGKRGGGRGGG 276 Score = 33.1 bits (72), Expect = 0.29 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -1 Query: 976 GGXGGXGGGXXGXXGXGXGGXGGGXGXXXXXXGGXRXXXXXGGGGGXXGG 827 GG GG GG G G GG GG GG R GG GG Sbjct: 205 GGRGGRGGARGGRGGGARGGRGGS----RDFGGGGRDFGSSSDRGGRSGG 250 Score = 31.9 bits (69), Expect = 0.67 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGGGXGG 828 GG GG GG RGG GG G G GG G GG G Sbjct: 205 GGRGGRGGA-----RGGRGGGARGGRGGSRDFGGGGRDFGSSSDRGGRSG 249 Score = 28.3 bits (60), Expect = 8.2 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = -3 Query: 935 RGGXGGXXGG-XGXGXXPXGGXAXGXGXGGGGGGXG 831 RGG GG G G G GG GGGG G Sbjct: 204 RGGRGGRGGARGGRGGGARGGRGGSRDFGGGGRDFG 239 >At1g27090.1 68414.m03302 glycine-rich protein Length = 420 Score = 33.5 bits (73), Expect = 0.22 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 8/55 (14%) Frame = -3 Query: 968 GGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAX--------GXGXGGGGGGXGG 828 GGGG RGG GG G GG G G GGGGGG G Sbjct: 351 GGGGYQNGRGGRGGGGGYQNGRYESYDQSGGNGYQRNYYNNRGRGRGGGGGGGNG 405 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 977 GGXGGGGGGXXXXXRGGXGGXXGGXGXGXXPXGGXAXGXGXGGGGG 840 G G GGGG R GG G G G GGGGG Sbjct: 358 GRGGRGGGGGYQNGRYESYDQSGGNGYQRNYYNNRGRGRGGGGGGG 403 >At4g39680.1 68417.m05614 SAP domain-containing protein contains Pfam domain PF02037: SAP domain Length = 633 Score = 33.1 bits (72), Expect = 0.29 Identities = 18/50 (36%), Positives = 20/50 (40%), Gaps = 2/50 (4%) Frame = +1 Query: 832 PXPPPPP--PXPXPXAXPPXGXXPXPXPPXXPPXPPLXXXXXPPPPPPXP 975 P PP P P + PP P P PP P + PPPPP P Sbjct: 542 PLPPQPQHQPQAQTLSRPPPTALP-PPPPLAKPPHVVERLPLPPPPPIAP 590 Score = 33.1 bits (72), Expect = 0.29 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = +1 Query: 838 PPPPPPXPXPXAXPPXGXXPXPXPPXXP-PXPPLXXXXXP-PPPPPXPP 978 P PP P P A P PP P PP P PPPPP P Sbjct: 542 PLPPQPQHQPQAQTLSRPPPTALPPPPPLAKPPHVVERLPLPPPPPIAP 590 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 828 PPXXPPPPPXXXXXRXPPXXXXXXPXPPPXPPXPXPXXP 944 P PPPPP PP P PPP P P P Sbjct: 561 PTALPPPPPLAK----PPHVVERLPLPPPPPIAPEEQEP 595 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,940,804 Number of Sequences: 28952 Number of extensions: 649386 Number of successful extensions: 41708 Number of sequences better than 10.0: 476 Number of HSP's better than 10.0 without gapping: 2379 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14502 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2382734760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -