BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_G07 (887 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 46 7e-06 SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||M... 42 9e-05 SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 38 0.002 SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||... 37 0.004 SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, wit... 36 0.008 SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family ... 35 0.013 SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosacch... 32 0.13 SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac... 31 0.22 SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1... 31 0.22 SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pomb... 29 0.67 SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1... 28 1.5 SPCC306.09c |cap1|cap|adenylyl cyclase-associated protein Cap1|S... 27 4.7 SPBC146.13c |myo1||myosin type I|Schizosaccharomyces pombe|chr 2... 27 4.7 SPBC13E7.03c |||RNA hairpin binding protein |Schizosaccharomyces... 27 4.7 SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Sc... 26 6.2 SPAPB1A10.15 |||Arv1-like family protein|Schizosaccharomyces pom... 26 6.2 SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyc... 26 6.2 SPAC13G6.06c |||glycine cleavage complex subunit P|Schizosacchar... 26 8.2 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 46.0 bits (104), Expect = 7e-06 Identities = 27/93 (29%), Positives = 27/93 (29%), Gaps = 3/93 (3%) Frame = +3 Query: 618 PPXPXPP---PPXXXXXXXPXXXXPSXXPXPXXPPXXXXPXXPXPPXPPXPXPPXXPXPP 788 PP P P PP P PS P P P P P P PP PP Sbjct: 1140 PPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPP 1199 Query: 789 XXXXXXXXPPSPXXXPXPPXXXXXXPXPPXXXP 887 PP P PP PP P Sbjct: 1200 VPKPSVGVPPVPPPSTAPPVPTPSAGLPPVPVP 1232 Score = 39.5 bits (88), Expect = 6e-04 Identities = 30/104 (28%), Positives = 30/104 (28%), Gaps = 4/104 (3%) Frame = +3 Query: 588 PXXXXPXXXXPPXPXP---PPPXXXXXXXPXXXXPSXXPXPXXPPXXXXPXXPXPPX-PP 755 P P PP P P PP P PS P P P P P P PP Sbjct: 1102 PPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAP-PVPKPSVAAPPVPAPSGAPP 1160 Query: 756 XPXPPXXPXPPXXXXXXXXPPSPXXXPXPPXXXXXXPXPPXXXP 887 P P PP PP P P PP P Sbjct: 1161 VPK-PSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKP 1203 Score = 39.5 bits (88), Expect = 6e-04 Identities = 29/101 (28%), Positives = 29/101 (28%), Gaps = 6/101 (5%) Frame = +3 Query: 588 PXXXXPXXXXPPXPXP---PPPXXXXXXXPXXXXPSXXPXPXXPPXXXXPXXPXP-PXPP 755 P P PP P P PP P PS P P P P P PP Sbjct: 1140 PPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPP 1199 Query: 756 XPXPP--XXPXPPXXXXXXXXPPSPXXXPXPPXXXXXXPXP 872 P P P PP PS P P P P Sbjct: 1200 VPKPSVGVPPVPPPSTAPPVPTPSAGLPPVPVPTAKAPPVP 1240 Score = 38.3 bits (85), Expect = 0.001 Identities = 31/111 (27%), Positives = 31/111 (27%), Gaps = 11/111 (9%) Frame = +3 Query: 588 PXXXXPXXXXPPXPXPP--PPXXXXXXXPXXXXPSXXPXPXXPPXXXXPXXPXPP-XPPX 758 P P P P P PP P PS P P P P P PP Sbjct: 1064 PPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPV 1123 Query: 759 PXP----PXXP----XPPXXXXXXXXPPSPXXXPXPPXXXXXXPXPPXXXP 887 P P P P PP PP P PP PP P Sbjct: 1124 PKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAP 1174 Score = 37.9 bits (84), Expect = 0.002 Identities = 28/102 (27%), Positives = 29/102 (28%), Gaps = 6/102 (5%) Frame = +3 Query: 588 PXXXXPXXXXPPXPXPP---PPXXXXXXXPXXXXPSXXPXPXXPPXXXXP-XXPXPPXPP 755 P P PP P P PP P PS P P P P PP Sbjct: 1092 PPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPPVPKPSVAAPP 1151 Query: 756 XPXPPXXPXPPXXXXXXXXPPSP--XXXPXPPXXXXXXPXPP 875 P P P P P+P P P P PP Sbjct: 1152 VPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPP 1193 Score = 36.7 bits (81), Expect = 0.004 Identities = 26/96 (27%), Positives = 26/96 (27%), Gaps = 6/96 (6%) Frame = +3 Query: 618 PPXPXP---PPPXXXXXXXPXXXXPSXXPX---PXXPPXXXXPXXPXPPXPPXPXPPXXP 779 PP P P PP P P P P P P P P P P Sbjct: 1041 PPVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVA 1100 Query: 780 XPPXXXXXXXXPPSPXXXPXPPXXXXXXPXPPXXXP 887 PP PP P PP PP P Sbjct: 1101 APPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVP 1136 Score = 36.3 bits (80), Expect = 0.006 Identities = 25/90 (27%), Positives = 25/90 (27%), Gaps = 4/90 (4%) Frame = +3 Query: 588 PXXXXPXXXXPPXPXP----PPPXXXXXXXPXXXXPSXXPXPXXPPXXXXPXXPXPPXPP 755 P P PP P P PP P PS P P P P P P P Sbjct: 1159 PPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAP-PVPKPSVGVPPVPPPSTAP 1217 Query: 756 XPXPPXXPXPPXXXXXXXXPPSPXXXPXPP 845 P PP PP P P Sbjct: 1218 PVPTPSAGLPPVPVPTAKAPPVPAPSSEAP 1247 Score = 34.7 bits (76), Expect = 0.018 Identities = 28/106 (26%), Positives = 28/106 (26%), Gaps = 6/106 (5%) Frame = +3 Query: 588 PXXXXPXXXXPPXPXPP--PPXXXXXXXPXXXXPSXX----PXPXXPPXXXXPXXPXPPX 749 P P PP P P PP P S P P P P P P Sbjct: 1022 PPVPLPSADAPPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSG 1081 Query: 750 PPXPXPPXXPXPPXXXXXXXXPPSPXXXPXPPXXXXXXPXPPXXXP 887 P P P PP PP P P PP P Sbjct: 1082 AP-PVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKP 1126 Score = 33.5 bits (73), Expect = 0.041 Identities = 26/91 (28%), Positives = 26/91 (28%), Gaps = 8/91 (8%) Frame = +3 Query: 588 PXXXXPXXXXPPXPXPP---PPXXXXXXXPXXXXPSXXPXPXXPPXXXXP-XXPXPPXPP 755 P P PP P P PP P PS P PP P P PP Sbjct: 1169 PPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPPVPTPSAGLPP 1228 Query: 756 XPXP----PXXPXPPXXXXXXXXPPSPXXXP 836 P P P P P P S P Sbjct: 1229 VPVPTAKAPPVPAPSSEAPSVSTPRSSVPSP 1259 Score = 33.1 bits (72), Expect = 0.054 Identities = 25/93 (26%), Positives = 25/93 (26%), Gaps = 8/93 (8%) Frame = +3 Query: 633 PPPPXXXXXXXPXXXXPSXXPXPXXPPXXXXPXXPXPPXPPXPXP----PXXP----XPP 788 PPP P PS P P P PP P P P P PP Sbjct: 1063 PPPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPP 1122 Query: 789 XXXXXXXXPPSPXXXPXPPXXXXXXPXPPXXXP 887 PP P PP PP P Sbjct: 1123 VPKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAP 1155 Score = 33.1 bits (72), Expect = 0.054 Identities = 27/94 (28%), Positives = 27/94 (28%), Gaps = 8/94 (8%) Frame = +3 Query: 618 PPXPXPP---PPXXXXXXXPXXXXPSXXPXPXXPPXXXXPXX-PXPPXPPXPXP----PX 773 PP P P PP P PS P P P P PP P P P Sbjct: 1121 PPVPKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIP- 1179 Query: 774 XPXPPXXXXXXXXPPSPXXXPXPPXXXXXXPXPP 875 P P PP P P P PP Sbjct: 1180 -PVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPP 1212 Score = 31.9 bits (69), Expect = 0.13 Identities = 22/88 (25%), Positives = 22/88 (25%) Frame = +3 Query: 579 PXXPXXXXPXXXXPPXPXPPPPXXXXXXXPXXXXPSXXPXPXXPPXXXXPXXPXPPXPPX 758 P P PP PP P PS P P P P P P Sbjct: 1179 PPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAP-PVPTPSAGLPPVPVPTAKAP 1237 Query: 759 PXPPXXPXPPXXXXXXXXPPSPXXXPXP 842 P P P PSP P Sbjct: 1238 PVPAPSSEAPSVSTPRSSVPSPHSNASP 1265 Score = 31.5 bits (68), Expect = 0.17 Identities = 19/83 (22%), Positives = 19/83 (22%) Frame = +1 Query: 634 PXPPXXPPXXXXXXXXPPXXXPXXPPXXXXXPXXXXPXPPXXPXPPXXXXPXXXPXXPXX 813 P P P PP P P PP P P P Sbjct: 1025 PLPSADAPPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAPP 1084 Query: 814 XXPPXXXPXXPXXPXPPPPPPPP 882 P P P PP P P Sbjct: 1085 VPAPSGIPPVPKPSVAAPPVPKP 1107 Score = 29.5 bits (63), Expect = 0.67 Identities = 23/99 (23%), Positives = 24/99 (24%), Gaps = 4/99 (4%) Frame = +3 Query: 603 PXXXXPPXPXPPPPXXXXXXXPXXXXPSXXPXPXXPPXXXXPXXPXPPXP-PXPXPP--- 770 P PP P P P P P PP P P PP Sbjct: 986 PPKDHPPSAPLSKPVSTSPAAPLARVPPVPKLSSKAPPVPLPSADAPPIPVPSTAPPVPI 1045 Query: 771 XXPXPPXXXXXXXXPPSPXXXPXPPXXXXXXPXPPXXXP 887 PP P +P P P P P P Sbjct: 1046 PTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAPP 1084 Score = 29.1 bits (62), Expect = 0.88 Identities = 19/75 (25%), Positives = 19/75 (25%), Gaps = 3/75 (4%) Frame = +2 Query: 584 PXPSXXXXXXXXXXPXPPXPPXXXXXXPXXXXXL---PXPXPXXPPXXPXXPXXXPPXPP 754 P PS PP P P P P P P P PP PP Sbjct: 1153 PAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPP 1212 Query: 755 XXXXPXXPXSPXXXP 799 P P P Sbjct: 1213 PSTAPPVPTPSAGLP 1227 Score = 28.3 bits (60), Expect = 1.5 Identities = 20/87 (22%), Positives = 20/87 (22%) Frame = +2 Query: 626 PXPPXPPXXXXXXPXXXXXLPXPXPXXPPXXPXXPXXXPPXPPXXXXPXXPXSPXXXPXX 805 P P P P P P P P P P PP P P Sbjct: 1022 PPVPLPSADAPPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEI-PSIPAPS 1080 Query: 806 XXXXXPXXXXXPXXXXPXXPXPPXXPP 886 P P P PP P Sbjct: 1081 GAPPVPAPSGIPPVPKPSVAAPPVPKP 1107 Score = 28.3 bits (60), Expect = 1.5 Identities = 22/87 (25%), Positives = 22/87 (25%), Gaps = 3/87 (3%) Frame = +1 Query: 631 PPXPPXX---PPXXXXXXXXPPXXXPXXPPXXXXXPXXXXPXPPXXPXPPXXXXPXXXPX 801 PP P PP PP P P P P P P P Sbjct: 1159 PPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPP 1218 Query: 802 XPXXXXPPXXXPXXPXXPXPPPPPPPP 882 P P P P PP P P Sbjct: 1219 VP---TPSAGLPPVPVPTAKAPPVPAP 1242 Score = 27.9 bits (59), Expect = 2.0 Identities = 18/77 (23%), Positives = 18/77 (23%) Frame = +1 Query: 652 PPXXXXXXXXPPXXXPXXPPXXXXXPXXXXPXPPXXPXPPXXXXPXXXPXXPXXXXPPXX 831 PP PP P P P P PP P P P Sbjct: 1012 PPVPKLSSKAPPVPLPSADAPPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAPSS 1071 Query: 832 XPXXPXXPXPPPPPPPP 882 P PP P P Sbjct: 1072 EIPSIPAPSGAPPVPAP 1088 Score = 27.5 bits (58), Expect = 2.7 Identities = 25/93 (26%), Positives = 25/93 (26%), Gaps = 9/93 (9%) Frame = +1 Query: 631 PPXPPXXPPXXXXXXXX------PPXXXPXXPPXXXXXPXXXXPXPPXXPXPPXXXXPXX 792 P PP PP PP P P P P P PP Sbjct: 963 PAAPPSIPPPLPVSNILSSPTSEPPKDHPPSAPLSK--PVSTSPAAPLARVPPVPKLSSK 1020 Query: 793 XPXXPXXXX--PPXXXPXX-PXXPXPPPPPPPP 882 P P PP P P P P PP P Sbjct: 1021 APPVPLPSADAPPIPVPSTAPPVPIPTSTPPVP 1053 Score = 27.5 bits (58), Expect = 2.7 Identities = 22/84 (26%), Positives = 22/84 (26%) Frame = +1 Query: 631 PPXPPXXPPXXXXXXXXPPXXXPXXPPXXXXXPXXXXPXPPXXPXPPXXXXPXXXPXXPX 810 PP P P P P PP P P P PP P P Sbjct: 1169 PPVPA--PSSGIPPVPKPAAGVPPVPPPSEAPPVPK-PSVGVPPVPPPSTAPPV--PTPS 1223 Query: 811 XXXPPXXXPXXPXXPXPPPPPPPP 882 PP P P P P P Sbjct: 1224 AGLPPVPVPTAKAPPVPAPSSEAP 1247 Score = 26.6 bits (56), Expect = 4.7 Identities = 23/85 (27%), Positives = 23/85 (27%), Gaps = 4/85 (4%) Frame = +1 Query: 640 PPXXPPXXXXXXXXPPXXXPXXPPXXXXXPXXXXPXP-PXXPXPPXXXXPXXXPXXPXXX 816 P PP P P P P P P P PP P P Sbjct: 1060 PSAPPPVPAPSSEIPSIPAPSGAPPVPA-PSGIPPVPKPSVAAPPVPKPSVAVPPVPAPS 1118 Query: 817 X-PPXXXPXX--PXXPXPPPPPPPP 882 PP P P P P PP P Sbjct: 1119 GAPPVPKPSVAAPPVPVPSGAPPVP 1143 >SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||Manual Length = 309 Score = 42.3 bits (95), Expect = 9e-05 Identities = 24/82 (29%), Positives = 24/82 (29%), Gaps = 1/82 (1%) Frame = +1 Query: 640 PPXXP-PXXXXXXXXPPXXXPXXPPXXXXXPXXXXPXPPXXPXPPXXXXPXXXPXXPXXX 816 PP P P PP P P P P P P P P P P Sbjct: 124 PPSAPAPPTPQSELRPPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKS 183 Query: 817 XPPXXXPXXPXXPXPPPPPPPP 882 P P PP PPPP Sbjct: 184 PPSAPSLPSAVPPMPPKVPPPP 205 Score = 35.9 bits (79), Expect = 0.008 Identities = 23/67 (34%), Positives = 23/67 (34%), Gaps = 5/67 (7%) Frame = +3 Query: 603 PXXXXPPXPX-PPPPXXXXXXXPXXXXP--SXXPXPXXP--PXXXXPXXPXPPXPPXPXP 767 P PP P PPP P P S P P P P P P P P P Sbjct: 139 PPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMP 198 Query: 768 PXXPXPP 788 P P PP Sbjct: 199 PKVPPPP 205 Score = 31.1 bits (67), Expect = 0.22 Identities = 22/82 (26%), Positives = 22/82 (26%), Gaps = 7/82 (8%) Frame = +3 Query: 621 PXPXPPPPXXXXXXXPXXXXPSXXPXPXXPPXXXXPXXPX-PPXPPXPXPPXXP------ 779 P P PP P P P P P PP P PP P Sbjct: 124 PPSAPAPPTPQSELRPPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKS 183 Query: 780 XPPXXXXXXXXPPSPXXXPXPP 845 P PP P P PP Sbjct: 184 PPSAPSLPSAVPPMPPKVPPPP 205 Score = 29.5 bits (63), Expect = 0.67 Identities = 18/68 (26%), Positives = 19/68 (27%) Frame = +2 Query: 584 PXPSXXXXXXXXXXPXPPXPPXXXXXXPXXXXXLPXPXPXXPPXXPXXPXXXPPXPPXXX 763 P PS P P P P P PP P P PP PP Sbjct: 145 PRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQ--PAAPVKSPPSAPSLPSAVPPMPPKVP 202 Query: 764 XPXXPXSP 787 P +P Sbjct: 203 PPPLSQAP 210 Score = 27.5 bits (58), Expect = 2.7 Identities = 21/82 (25%), Positives = 21/82 (25%), Gaps = 1/82 (1%) Frame = +1 Query: 631 PPXPPXXPPXXXXXXXX-PPXXXPXXPPXXXXXPXXXXPXPPXXPXPPXXXXPXXXPXXP 807 P P PP PP PP P P PP P P Sbjct: 177 PAAPVKSPPSAPSLPSAVPPMPPKVPPPPLSQAPVANTSSRPSSFAPPAGHAPNVTSESP 236 Query: 808 XXXXPPXXXPXXPXXPXPPPPP 873 P P P PP PP Sbjct: 237 KF---PNRGPSIPSASVPPVPP 255 Score = 25.8 bits (54), Expect = 8.2 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 853 PXPPPPPPPP 882 P PPPPPP P Sbjct: 3 PAPPPPPPAP 12 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 37.9 bits (84), Expect = 0.002 Identities = 29/104 (27%), Positives = 29/104 (27%), Gaps = 2/104 (1%) Frame = +3 Query: 570 VXXPXXPXXXXPXXXXPPXPXPPPPXXXXXXXPXXXXPSXXPX-PXXPPXXXXPXXPXPP 746 V P P P P P P P PS P P P P P Sbjct: 385 VSNPPAPPPAIPGRSAPALP-PLGNASRTSTPPVPTPPSLPPSAPPSLPPSAPPSLPMGA 443 Query: 747 XPPXPXPPXXPX-PPXXXXXXXXPPSPXXXPXPPXXXXXXPXPP 875 P PP P PP PP P P PP P P Sbjct: 444 PAAPPLPPSAPIAPPLPAGMPAAPPLPPAAPAPPPAPAPAPAAP 487 Score = 37.1 bits (82), Expect = 0.003 Identities = 26/82 (31%), Positives = 26/82 (31%) Frame = +1 Query: 634 PXPPXXPPXXXXXXXXPPXXXPXXPPXXXXXPXXXXPXPPXXPXPPXXXXPXXXPXXPXX 813 P PP PP PP P PP P PP P P P P P Sbjct: 418 PTPPSLPPSA------PPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPL--PAGMPAAP-- 467 Query: 814 XXPPXXXPXXPXXPXPPPPPPP 879 P P P PPP P P Sbjct: 468 -------PLPPAAPAPPPAPAP 482 Score = 33.5 bits (73), Expect = 0.041 Identities = 22/89 (24%), Positives = 22/89 (24%), Gaps = 2/89 (2%) Frame = +2 Query: 626 PXPPXPPXXXXXX--PXXXXXLPXPXPXXPPXXPXXPXXXPPXPPXXXXPXXPXSPXXXP 799 P PP PP P P P P P PP P P P Sbjct: 337 PPPPPPPRSNAAGSIPLPPQGRSAPPPPPPRSAPSTGRQPPPLSSSRAVSNPPAPPPAIP 396 Query: 800 XXXXXXXPXXXXXPXXXXPXXPXPPXXPP 886 P P P PP PP Sbjct: 397 GRSAPALPPLGNASRTSTPPVPTPPSLPP 425 Score = 31.9 bits (69), Expect = 0.13 Identities = 24/91 (26%), Positives = 24/91 (26%), Gaps = 7/91 (7%) Frame = +1 Query: 631 PPXPPXXPPXXXXXXXXP-----PXXXPXXPPXXXXXPXXXXPXPPXXPXPPXXXXPXXX 795 PP PP P P P P P PP P P Sbjct: 388 PPAPPPAIPGRSAPALPPLGNASRTSTPPVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAP 447 Query: 796 PXXPXXXXPPXXXPXXPXXPXPPP--PPPPP 882 P P P P P PP P PPP Sbjct: 448 PLPPSAPIAPPLPAGMPAAPPLPPAAPAPPP 478 Score = 31.5 bits (68), Expect = 0.17 Identities = 18/68 (26%), Positives = 18/68 (26%) Frame = +3 Query: 621 PXPXPPPPXXXXXXXPXXXXPSXXPXPXXPPXXXXPXXPXPPXPPXPXPPXXPXPPXXXX 800 P P PPP P S P PP P PP P PP Sbjct: 311 PPPPPPPSRRNRGKPPIGNGSSNSSLPPPPPPPRSNAAGSIPLPPQGRSAPPPPPPRSAP 370 Query: 801 XXXXPPSP 824 P P Sbjct: 371 STGRQPPP 378 Score = 29.5 bits (63), Expect = 0.67 Identities = 18/65 (27%), Positives = 18/65 (27%) Frame = +1 Query: 682 PPXXXPXXPPXXXXXPXXXXPXPPXXPXPPXXXXPXXXPXXPXXXXPPXXXPXXPXXPXP 861 PP PP P P PP P P P P P P Sbjct: 233 PPSIPSSRPPERV--PSLSAPAPPPIPPPSNGTVSSPPNSPPRPIAPVSMNPAINSTSKP 290 Query: 862 PPPPP 876 P PPP Sbjct: 291 PLPPP 295 Score = 29.5 bits (63), Expect = 0.67 Identities = 24/93 (25%), Positives = 24/93 (25%), Gaps = 10/93 (10%) Frame = +1 Query: 634 PXPPXXPPXXXXXXXXPPXXXPXXPPXXXXXPXXXXPXPPXXPXPPXXXXPXXXPXXPXX 813 P PP PP PP P P P P PP Sbjct: 251 PAPPPIPPPSNGTVSSPPNSPPRPIAPVSMNPAINSTSKPPLP-PPSSRVSAAALAANKK 309 Query: 814 XXPPXXXPXXPXXPXPP----------PPPPPP 882 PP P PP PPPPPP Sbjct: 310 RPPPPPPPSRRNRGKPPIGNGSSNSSLPPPPPP 342 Score = 29.5 bits (63), Expect = 0.67 Identities = 22/97 (22%), Positives = 23/97 (23%), Gaps = 2/97 (2%) Frame = +3 Query: 603 PXXXXPPXPXPPPPXXXXXXXPXXXXPSXXPXPXXPPXXXXPXXPXPPXPPXPXPPXXPX 782 P P P PP P S P P P PP Sbjct: 355 PQGRSAPPPPPPRSAPSTGRQPPPLSSSRAVSNPPAPPPAIPGRSAPALPPLGNASRTST 414 Query: 783 PPXXXXXXXXPPSPXXXP--XPPXXXXXXPXPPXXXP 887 PP P +P P PP P P P Sbjct: 415 PPVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPP 451 Score = 29.1 bits (62), Expect = 0.88 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +1 Query: 748 PPXXPXPPXXXXPXXXPXXPXXXXPPXXXPXXPXXPXPPPPPPPP 882 PP P P P P PP P PP PP P Sbjct: 230 PPIPPSIPSSRPPERVPSLSAPAPPPIPPPSNGTVSSPPNSPPRP 274 Score = 27.9 bits (59), Expect = 2.0 Identities = 22/90 (24%), Positives = 23/90 (25%) Frame = +3 Query: 618 PPXPXPPPPXXXXXXXPXXXXPSXXPXPXXPPXXXXPXXPXPPXPPXPXPPXXPXPPXXX 797 PP P P P P+ P P PP P P PP P P P Sbjct: 230 PPIPPSIPSSRPPERVPSLSAPA--PPPIPPPSNGTVSSP-PNSPPRPIAPVSMNPAINS 286 Query: 798 XXXXXPPSPXXXPXPPXXXXXXPXPPXXXP 887 P P PP P Sbjct: 287 TSKPPLPPPSSRVSAAALAANKKRPPPPPP 316 Score = 27.9 bits (59), Expect = 2.0 Identities = 24/89 (26%), Positives = 24/89 (26%), Gaps = 2/89 (2%) Frame = +3 Query: 627 PXPPPPXXXXXXXPXXXXPSXXPXPXXPPXXXXPXXPXPPXPPXPXPPXXPXPPXXXXXX 806 P PP P PS P PP PP PP P P P Sbjct: 352 PLPPQGRSAPPPPPPRSAPSTGRQP--PPLSSSRAVSNPPAPP-PAIPGRSAPALPPLGN 408 Query: 807 XXPPSPXXXPXPPXXXXXXP--XPPXXXP 887 S P PP P PP P Sbjct: 409 ASRTSTPPVPTPPSLPPSAPPSLPPSAPP 437 >SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1461 Score = 36.7 bits (81), Expect = 0.004 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = +1 Query: 742 PXPPXX--PXPPXXXXPXXXPXXPXXXXPPXXXPXXPXXPXPPPPPPPP 882 P PP P P P P PP P PPPPPPPP Sbjct: 734 PPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPP 782 Score = 35.5 bits (78), Expect = 0.010 Identities = 23/78 (29%), Positives = 25/78 (32%), Gaps = 6/78 (7%) Frame = +3 Query: 627 PXPPPPXXXXXXXPXXXXPSXXPXPXXPPXXXXPXXPXPPXPP------XPXPPXXPXPP 788 P PPPP P+ P P PP P PP PP P PP P Sbjct: 732 PPPPPPAV------IVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPPAV 785 Query: 789 XXXXXXXXPPSPXXXPXP 842 P+P P P Sbjct: 786 SAGGSRYYAPAPQAEPEP 803 Score = 34.7 bits (76), Expect = 0.018 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = +1 Query: 697 PXXPPXXXXXPXXXXPXPPXXPXPPXXXXPXXXPXXPXXXXPPXXXPXXPXXPXPPPPPP 876 P PP P P P P PP P PP P PPPPPP Sbjct: 732 PPPPPPAVIVPT---PAPAPIPVPPPAPIMGGPP-------PPPPPPGVAGAGPPPPPPP 781 Query: 877 PP 882 PP Sbjct: 782 PP 783 Score = 32.7 bits (71), Expect = 0.072 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 4/55 (7%) Frame = +3 Query: 735 PXPPXP----PXPXPPXXPXPPXXXXXXXXPPSPXXXPXPPXXXXXXPXPPXXXP 887 P PP P P P P P PP PP P PP P PP P Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPP----PPPPPGVAGAGPPPPPPPP 782 Score = 31.5 bits (68), Expect = 0.17 Identities = 20/65 (30%), Positives = 22/65 (33%) Frame = +3 Query: 561 LVRVXXPXXPXXXXPXXXXPPXPXPPPPXXXXXXXPXXXXPSXXPXPXXPPXXXXPXXPX 740 L++ P P P P P PPP P P P P PP P Sbjct: 728 LLKSPPPPPPAVIVPTPAPAPIPVPPPA-------PIMGGP---PPPPPPPGVAGAGPPP 777 Query: 741 PPXPP 755 PP PP Sbjct: 778 PPPPP 782 Score = 31.5 bits (68), Expect = 0.17 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 4/52 (7%) Frame = +3 Query: 618 PPXPXP----PPPXXXXXXXPXXXXPSXXPXPXXPPXXXXPXXPXPPXPPXP 761 PP P P P P P P P PP P PP PP P Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPP 783 Score = 29.5 bits (63), Expect = 0.67 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +3 Query: 681 PSXXPXPXXPPXXXXPXXPXPPXPPXPXPPXXPXPPXXXXXXXXPPSPXXXPXPP 845 P P P P PP P PP P PP PP P PP Sbjct: 733 PPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPP----PPPPP 783 >SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, with EF hand and WH2 motif |Schizosaccharomyces pombe|chr 1|||Manual Length = 1794 Score = 35.9 bits (79), Expect = 0.008 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +1 Query: 727 PXXXXPXPPXXPXPPXXXXPXXXPXXPXXXXPPXXXPXXPXXPXPPPPPPPP 882 P P P PP P P P PP P P P PPPP P Sbjct: 1686 PVSTPPVRPQSAAPPQMSAPTPPPP-PMSVPPPPSAPPMPAGPPSAPPPPLP 1736 Score = 32.3 bits (70), Expect = 0.095 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +3 Query: 699 PXXPPXXXXPXXPXPPXPPXPXPPXXPXPPXXXXXXXXPPSPXXXPXPPXXXXXXPXP 872 P P P P PP P P P PP PPS P P P P Sbjct: 1690 PPVRPQSAAPPQMSAPTPPPP-PMSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVPNP 1746 Score = 31.9 bits (69), Expect = 0.13 Identities = 21/85 (24%), Positives = 25/85 (29%) Frame = +3 Query: 531 IRSPRNRTVCLVRVXXPXXPXXXXPXXXXPPXPXPPPPXXXXXXXPXXXXPSXXPXPXXP 710 IRS ++ ++ P P P P P P S P P P Sbjct: 1664 IRSSKDAAALAAKLFGGMAPAH--PVSTPPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAP 1721 Query: 711 PXXXXPXXPXPPXPPXPXPPXXPXP 785 P P PP P P P P Sbjct: 1722 PMPAGPPSAPPPPLPASSAPSVPNP 1746 Score = 31.9 bits (69), Expect = 0.13 Identities = 20/69 (28%), Positives = 21/69 (30%) Frame = +3 Query: 618 PPXPXPPPPXXXXXXXPXXXXPSXXPXPXXPPXXXXPXXPXPPXPPXPXPPXXPXPPXXX 797 P P PP P P P PP P PP P P P P PP Sbjct: 1683 PAHPVSTPPVRPQSAAPPQMSA---PTPPPPPMSVPPPPSAPPMPAGP--PSAPPPPLPA 1737 Query: 798 XXXXXPPSP 824 P+P Sbjct: 1738 SSAPSVPNP 1746 Score = 31.9 bits (69), Expect = 0.13 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +3 Query: 681 PSXXPXPXXPPXXXXPXXPXPPXPPXPXPPXXPXPPXXXXXXXXPPSPXXXPXPP 845 P P PP P PP PP PP PP PP P P Sbjct: 1690 PPVRPQSAAPPQMSAPT---PPPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAP 1741 Score = 28.3 bits (60), Expect = 1.5 Identities = 17/59 (28%), Positives = 17/59 (28%) Frame = +3 Query: 711 PXXXXPXXPXPPXPPXPXPPXXPXPPXXXXXXXXPPSPXXXPXPPXXXXXXPXPPXXXP 887 P P P PP P P PP PPS P P P P P Sbjct: 1686 PVSTPPVRPQSAAPPQMSAPTPPPPPMSVPP---PPSAPPMPAGPPSAPPPPLPASSAP 1741 Score = 27.1 bits (57), Expect = 3.6 Identities = 15/51 (29%), Positives = 15/51 (29%) Frame = +3 Query: 735 PXPPXPPXPXPPXXPXPPXXXXXXXXPPSPXXXPXPPXXXXXXPXPPXXXP 887 P P P P PP PP P P PP PP P Sbjct: 1683 PAHPVSTPPVRPQSAAPP-QMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPP 1732 Score = 26.6 bits (56), Expect = 4.7 Identities = 16/60 (26%), Positives = 16/60 (26%) Frame = +1 Query: 682 PPXXXPXXPPXXXXXPXXXXPXPPXXPXPPXXXXPXXXPXXPXXXXPPXXXPXXPXXPXP 861 PP P P P PP PP P P PP P P P Sbjct: 1690 PPVRPQSAAPPQMSAP---TPPPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVPNP 1746 >SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 1420 Score = 35.1 bits (77), Expect = 0.013 Identities = 29/108 (26%), Positives = 29/108 (26%), Gaps = 12/108 (11%) Frame = +3 Query: 588 PXXXXPXXXXPPXPXPPPP----XXXXXXXPXXXXPSXXP-XPXXPPXXXXPXXPXPPXP 752 P P PP P PPPP P S P PP P P Sbjct: 179 PATSLPSDYNPPPPPPPPPAVEDQAADANEPDDYYSSGRAVSPEIPPTYTPKQADPLPAP 238 Query: 753 PXPXPPXXPXPPXXXXXXXXPP-------SPXXXPXPPXXXXXXPXPP 875 P P PP P P S P PP P PP Sbjct: 239 PPPPPPTLPPQSTNTSQLPMPSRNVNNLGSQVNIPPPPATPSQPPRPP 286 Score = 29.5 bits (63), Expect = 0.67 Identities = 21/74 (28%), Positives = 21/74 (28%) Frame = +3 Query: 567 RVXXPXXPXXXXPXXXXPPXPXPPPPXXXXXXXPXXXXPSXXPXPXXPPXXXXPXXPXPP 746 R P P P P PPPP P S P P PP Sbjct: 217 RAVSPEIPPTYTPKQADPLPAPPPPP--PPTLPPQSTNTSQLPMPSRNVNNLGSQVNIPP 274 Query: 747 XPPXPXPPXXPXPP 788 P P P P PP Sbjct: 275 PPATPSQP--PRPP 286 Score = 27.9 bits (59), Expect = 2.0 Identities = 20/83 (24%), Positives = 20/83 (24%) Frame = +1 Query: 634 PXPPXXPPXXXXXXXXPPXXXPXXPPXXXXXPXXXXPXPPXXPXPPXXXXPXXXPXXPXX 813 P P PP P PP P P P Sbjct: 167 PPPSFQPPSAAAPATSLPSDYNPPPPPPPPPAVEDQAADANEPDDYYSSGRAVSPEIPPT 226 Query: 814 XXPPXXXPXXPXXPXPPPPPPPP 882 P P P P PPPP PP Sbjct: 227 YTPKQADPL-PAPPPPPPPTLPP 248 Score = 27.5 bits (58), Expect = 2.7 Identities = 14/41 (34%), Positives = 14/41 (34%), Gaps = 3/41 (7%) Frame = +1 Query: 769 PXXXXPXXXPXXPXXXXPPXXXPXXPXXPX---PPPPPPPP 882 P P P PP P PPPPPPPP Sbjct: 156 PTVSAPNSMVSPPPSFQPPSAAAPATSLPSDYNPPPPPPPP 196 Score = 26.6 bits (56), Expect = 4.7 Identities = 13/42 (30%), Positives = 13/42 (30%) Frame = +1 Query: 751 PXXPXPPXXXXPXXXPXXPXXXXPPXXXPXXPXXPXPPPPPP 876 P P P P P P P PPPPPP Sbjct: 156 PTVSAPNSMVSPPPSFQPPSAAAPATSLPSDYNPPPPPPPPP 197 Score = 25.8 bits (54), Expect = 8.2 Identities = 11/29 (37%), Positives = 11/29 (37%) Frame = +3 Query: 681 PSXXPXPXXPPXXXXPXXPXPPXPPXPXP 767 PS P P P PP PP P P Sbjct: 169 PSFQPPSAAAPATSLPSDYNPPPPPPPPP 197 >SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosaccharomyces pombe|chr 1|||Manual Length = 1002 Score = 31.9 bits (69), Expect = 0.13 Identities = 20/68 (29%), Positives = 20/68 (29%), Gaps = 9/68 (13%) Frame = +1 Query: 706 PPXXXXXPXXXXPXPPXXPXPPXXXXPXXXPXXPXXXXPPXXXPXXPXXPXPPPP----- 870 PP P P PP P P P PP P PPPP Sbjct: 209 PPPMHHKPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEP 268 Query: 871 ----PPPP 882 PPPP Sbjct: 269 GEHMPPPP 276 Score = 31.9 bits (69), Expect = 0.13 Identities = 20/68 (29%), Positives = 20/68 (29%), Gaps = 9/68 (13%) Frame = +1 Query: 706 PPXXXXXPXXXXPXPPXXPXPPXXXXPXXXPXXPXXXXPPXXXPXXPXXPXPPPP----- 870 PP P P PP P P P PP P PPPP Sbjct: 235 PPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEP 294 Query: 871 ----PPPP 882 PPPP Sbjct: 295 GEHMPPPP 302 Score = 31.9 bits (69), Expect = 0.13 Identities = 20/68 (29%), Positives = 20/68 (29%), Gaps = 9/68 (13%) Frame = +1 Query: 706 PPXXXXXPXXXXPXPPXXPXPPXXXXPXXXPXXPXXXXPPXXXPXXPXXPXPPPP----- 870 PP P P PP P P P PP P PPPP Sbjct: 261 PPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEP 320 Query: 871 ----PPPP 882 PPPP Sbjct: 321 GEHMPPPP 328 Score = 31.5 bits (68), Expect = 0.17 Identities = 26/100 (26%), Positives = 26/100 (26%), Gaps = 1/100 (1%) Frame = +3 Query: 579 PXXPXXXXPXXXXPPXPXPPPPXXXXXXXPXXXXPSXXPXPXXPPXXXXPXXPXPPXPPX 758 P P P PP P P P P P PP P PP P Sbjct: 208 PPPPMHHKPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPP--PPMHHEPGEHMPPPPMH 265 Query: 759 PXP-PXXPXPPXXXXXXXXPPSPXXXPXPPXXXXXXPXPP 875 P P PP P P P P PP Sbjct: 266 HEPGEHMPPPPMHHEPGEHMPPPPMHHEP---GEHMPPPP 302 Score = 31.5 bits (68), Expect = 0.17 Identities = 26/100 (26%), Positives = 26/100 (26%), Gaps = 1/100 (1%) Frame = +3 Query: 579 PXXPXXXXPXXXXPPXPXPPPPXXXXXXXPXXXXPSXXPXPXXPPXXXXPXXPXPPXPPX 758 P P P PP P P P P P PP P PP P Sbjct: 234 PPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPP--PPMHHEPGEHMPPPPMH 291 Query: 759 PXP-PXXPXPPXXXXXXXXPPSPXXXPXPPXXXXXXPXPP 875 P P PP P P P P PP Sbjct: 292 HEPGEHMPPPPMHHEPGEHMPPPPMHHEP---GEHMPPPP 328 Score = 31.5 bits (68), Expect = 0.17 Identities = 16/55 (29%), Positives = 16/55 (29%) Frame = +1 Query: 706 PPXXXXXPXXXXPXPPXXPXPPXXXXPXXXPXXPXXXXPPXXXPXXPXXPXPPPP 870 PP P P PP P P P PP P PPPP Sbjct: 287 PPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 341 Score = 30.7 bits (66), Expect = 0.29 Identities = 22/83 (26%), Positives = 22/83 (26%), Gaps = 1/83 (1%) Frame = +3 Query: 579 PXXPXXXXPXXXXPPXPXPPPPXXXXXXXPXXXXPSXXPXPXXPPXXXXPXXPXPPXPPX 758 P P P PP P P P P P PP P PP P Sbjct: 260 PPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPP--PPMHHEPGEHMPPPPMH 317 Query: 759 PXP-PXXPXPPXXXXXXXXPPSP 824 P P PP P P Sbjct: 318 HEPGEHMPPPPMHHEPGEHMPPP 340 Score = 29.5 bits (63), Expect = 0.67 Identities = 25/97 (25%), Positives = 25/97 (25%), Gaps = 1/97 (1%) Frame = +3 Query: 588 PXXXXPXXXXPPXPXPPPPXXXXXXXPXXXXPSXXPXPXXPPXXXXPXXPXPPXPPXPXP 767 P P PP P P P P P PP P PP P P Sbjct: 198 PAHHEPGEHMPPPPMHHKPGEHMPPPPMHHEPGEHMPP--PPMHHEPGEHMPPPPMHHEP 255 Query: 768 -PXXPXPPXXXXXXXXPPSPXXXPXPPXXXXXXPXPP 875 P PP P P P P PP Sbjct: 256 GEHMPPPPMHHEPGEHMPPPPMHHEP---GEHMPPPP 289 Score = 28.3 bits (60), Expect = 1.5 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 9/61 (14%) Frame = +1 Query: 727 PXXXXPXPPXXPXPPXXXXPXXXPXXPXXXXPPXXXPXXPXXPXPPPP---------PPP 879 P P PP P P P PP P PPPP PPP Sbjct: 203 PGEHMPPPPMHHKPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPP 262 Query: 880 P 882 P Sbjct: 263 P 263 Score = 25.8 bits (54), Expect = 8.2 Identities = 19/67 (28%), Positives = 19/67 (28%), Gaps = 8/67 (11%) Frame = +1 Query: 706 PPXXXXXPXXXXPXPPXX-------PXPPXXXXPXXX-PXXPXXXXPPXXXPXXPXXPXP 861 PP P P PP P PP P P P P P P P Sbjct: 274 PPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEP 333 Query: 862 PPPPPPP 882 PPP Sbjct: 334 GEHMPPP 340 >SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 2363 Score = 31.1 bits (67), Expect = 0.22 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 805 PXXXXPPXXXPXXPXXPXPPPPPPPP 882 P PP P P PPPPPPP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 29.9 bits (64), Expect = 0.51 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 681 PSXXPXPXXPPXXXXPXXPXPPXPP 755 P P P PP P P PP PP Sbjct: 6 PGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 27.9 bits (59), Expect = 2.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 735 PXPPXPPXPXPPXXPXPP 788 P PP PP PP P PP Sbjct: 10 PPPPPPPGFEPPSQPPPP 27 Score = 26.2 bits (55), Expect = 6.2 Identities = 10/25 (40%), Positives = 10/25 (40%) Frame = +3 Query: 681 PSXXPXPXXPPXXXXPXXPXPPXPP 755 P P P PP P PP PP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPP 29 >SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 857 Score = 31.1 bits (67), Expect = 0.22 Identities = 21/83 (25%), Positives = 21/83 (25%) Frame = +1 Query: 634 PXPPXXPPXXXXXXXXPPXXXPXXPPXXXXXPXXXXPXPPXXPXPPXXXXPXXXPXXPXX 813 P PP P P P P P P P P P Sbjct: 515 PQPPAAPVVPEAPSVHQPPAAPVAPEVPSAPQRPAAPVVPEAPSVPQRPAVPVVPEALSV 574 Query: 814 XXPPXXXPXXPXXPXPPPPPPPP 882 PP P P P P PP P Sbjct: 575 PQPP-VAPVAPEVPSVPQPPVAP 596 Score = 25.8 bits (54), Expect = 8.2 Identities = 20/85 (23%), Positives = 20/85 (23%), Gaps = 2/85 (2%) Frame = +1 Query: 634 PXPPXXPPXXXXXXXXPPXXXPXXPPXXXXXPXXXXPXPPXXPXPPXXXXPXXXPXXPXX 813 P P P P P P P P P P P P Sbjct: 620 PQRPAVPVVPEAPSVPQPPAAPVVPEVPSVPQRPAVPVVPEAPSVPQPPAAPVVPEVPSV 679 Query: 814 XXPP--XXXPXXPXXPXPPPPPPPP 882 PP P P PP PP Sbjct: 680 PQPPAVPVVPEAGQLNEPVVPPLPP 704 >SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 331 Score = 29.5 bits (63), Expect = 0.67 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +3 Query: 618 PPXPXPPPPXXXXXXXPXXXXPSXXPXPXXPPXXXXPXXPXPPXPPXPXPP 770 P P P P P P P P P P P P PP P P Sbjct: 99 PEEPLPREPPLPNEPVPEEPLPGEPPLPDEP----VPEEPLPGEPPLPNEP 145 Score = 27.9 bits (59), Expect = 2.0 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 742 PXPPXXPXPPXXXXPXXXPXXPXXXXPPXXXPXXPXXPXPPPPPPP 879 P P PP P P P PP P P P PP P Sbjct: 99 PEEPLPREPPLPNEPV--PEEPLPGEPPLPDEPVPEEPLPGEPPLP 142 Score = 26.6 bits (56), Expect = 4.7 Identities = 13/44 (29%), Positives = 13/44 (29%) Frame = +3 Query: 711 PXXXXPXXPXPPXPPXPXPPXXPXPPXXXXXXXXPPSPXXXPXP 842 P P P P P P P PP P P P P Sbjct: 99 PEEPLPREPPLPNEPVPEEPLPGEPPLPDEPVPEEPLPGEPPLP 142 >SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1|||Manual Length = 1841 Score = 28.3 bits (60), Expect = 1.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 844 PXXPXPPPPPPP 879 P P PPPPPPP Sbjct: 942 PAFPPPPPPPPP 953 Score = 26.6 bits (56), Expect = 4.7 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +1 Query: 859 PPPPPPPP 882 PPPPPPPP Sbjct: 945 PPPPPPPP 952 >SPCC306.09c |cap1|cap|adenylyl cyclase-associated protein Cap1|Schizosaccharomyces pombe|chr 3|||Manual Length = 551 Score = 26.6 bits (56), Expect = 4.7 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +1 Query: 859 PPPPPPPP 882 PPPPPPPP Sbjct: 306 PPPPPPPP 313 Score = 26.6 bits (56), Expect = 4.7 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +1 Query: 859 PPPPPPPP 882 PPPPPPPP Sbjct: 307 PPPPPPPP 314 Score = 26.2 bits (55), Expect = 6.2 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 853 PXPPPPPPP 879 P PPPPPPP Sbjct: 306 PPPPPPPPP 314 >SPBC146.13c |myo1||myosin type I|Schizosaccharomyces pombe|chr 2|||Manual Length = 1217 Score = 26.6 bits (56), Expect = 4.7 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +1 Query: 859 PPPPPPPP 882 PPPPPPPP Sbjct: 1095 PPPPPPPP 1102 >SPBC13E7.03c |||RNA hairpin binding protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 713 Score = 26.6 bits (56), Expect = 4.7 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +1 Query: 859 PPPPPPPP 882 PPPPPPPP Sbjct: 370 PPPPPPPP 377 >SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Schizosaccharomyces pombe|chr 1|||Manual Length = 1995 Score = 26.2 bits (55), Expect = 6.2 Identities = 18/74 (24%), Positives = 19/74 (25%), Gaps = 1/74 (1%) Frame = +3 Query: 627 PXPPPPXXXXXXXPXXXXPSXXPXPXXPPXXXXPXXPXPPXP-PXPXPPXXPXPPXXXXX 803 P PPPP P P+ P PP P P P P P Sbjct: 1882 PPPPPPMALPKAGPPSAAPTSALPPAGPPAGATAISGNPGMPAPVPLTGKETAVPLSSMP 1941 Query: 804 XXXPPSPXXXPXPP 845 P PP Sbjct: 1942 NAPPSVASNAKLPP 1955 >SPAPB1A10.15 |||Arv1-like family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 220 Score = 26.2 bits (55), Expect = 6.2 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = -1 Query: 152 LVNVLASEPTQRTTK-AKIINFCISIVSFELQVTESK 45 L N L++ + TK AK++NFCI I F + + S+ Sbjct: 63 LFNSLSARTFRNLTKCAKVVNFCILISLFNVFLVWSR 99 >SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 587 Score = 26.2 bits (55), Expect = 6.2 Identities = 17/62 (27%), Positives = 17/62 (27%) Frame = +3 Query: 603 PXXXXPPXPXPPPPXXXXXXXPXXXXPSXXPXPXXPPXXXXPXXPXPPXPPXPXPPXXPX 782 P PP P P P P P PP P P P P P Sbjct: 501 PGVPLPPIPGAPGMPNLNMSQP----PMVPPGMALPPGMPAPFPGYPAVPAMPGIPGATA 556 Query: 783 PP 788 PP Sbjct: 557 PP 558 Score = 25.8 bits (54), Expect = 8.2 Identities = 18/70 (25%), Positives = 19/70 (27%), Gaps = 2/70 (2%) Frame = +3 Query: 618 PPXPXPPP--PXXXXXXXPXXXXPSXXPXPXXPPXXXXPXXPXPPXPPXPXPPXXPXPPX 791 PP PP P P + P PP P P P P P P P Sbjct: 494 PPTTFAPPGVPLPPIPGAPGMPNLNMSQPPMVPPGMALPPGMPAPFPGYPAVPAMPGIPG 553 Query: 792 XXXXXXXPPS 821 P S Sbjct: 554 ATAPPGAPGS 563 >SPAC13G6.06c |||glycine cleavage complex subunit P|Schizosaccharomyces pombe|chr 1|||Manual Length = 1017 Score = 25.8 bits (54), Expect = 8.2 Identities = 22/120 (18%), Positives = 48/120 (40%), Gaps = 1/120 (0%) Frame = -1 Query: 407 AHFAALVMSSVRRSEHLTLQSLPGLAPLLHQYRSLIWNNP*SFEPLRFVFVLDVSRL-LS 231 A+ + ++ +R + L + +A L + L++ N + F+LD + Sbjct: 828 AYMRMMGLAGLRDASKAALLNANYMAKRLSSHYKLVYTNKNNL--CAHEFILDAREFKAT 885 Query: 230 CSTRHTQFLMRFSSKPCFLSSCTRPHLVNVLASEPTQRTTKAKIINFCISIVSFELQVTE 51 T R + + P + N L EPT+ + ++ FC +++S ++ E Sbjct: 886 AGVDATDIAKRLQDYSFHAPTLSWP-IANTLMIEPTESESMYEMDRFCDALISIRQEIRE 944 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,579,024 Number of Sequences: 5004 Number of extensions: 52309 Number of successful extensions: 774 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 152 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 350 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 446488370 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -