BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_G07 (887 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 27 0.30 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 26 0.53 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 25 0.70 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 25 0.70 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 25 0.70 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 25 0.70 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 25 0.70 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 25 0.92 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 25 0.92 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 25 0.92 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 25 0.92 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 25 0.92 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 24 1.6 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 4.9 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 26.6 bits (56), Expect = 0.30 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +1 Query: 859 PPPPPPPP 882 PPPPPPPP Sbjct: 1355 PPPPPPPP 1362 Score = 23.4 bits (48), Expect = 2.8 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 853 PXPPPPPP 876 P PPPPPP Sbjct: 1355 PPPPPPPP 1362 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 25.8 bits (54), Expect = 0.53 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 853 PXPPPPPPPP 882 P P PPPPPP Sbjct: 339 PKPAPPPPPP 348 Score = 25.4 bits (53), Expect = 0.70 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 844 PXXPXPPPPPP 876 P P PPPPPP Sbjct: 338 PPKPAPPPPPP 348 Score = 23.0 bits (47), Expect = 3.7 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +3 Query: 618 PPXPXPPPP 644 PP P PPPP Sbjct: 338 PPKPAPPPP 346 Score = 22.6 bits (46), Expect = 4.9 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 853 PXPPPPPPPP 882 P P PPPPP Sbjct: 338 PPKPAPPPPP 347 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 25.4 bits (53), Expect = 0.70 Identities = 11/41 (26%), Positives = 24/41 (58%) Frame = +1 Query: 166 HELRKHGFEENLMRNWVCLVEHESSRDTSKTNTNRNGSKDY 288 +E +K+ N +RN +H SSR + + + +R+ +++Y Sbjct: 205 NESKKYATSSNSLRNRTHGFQHTSSRYSRERSCSRDRNREY 245 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 25.4 bits (53), Expect = 0.70 Identities = 11/41 (26%), Positives = 24/41 (58%) Frame = +1 Query: 166 HELRKHGFEENLMRNWVCLVEHESSRDTSKTNTNRNGSKDY 288 +E +K+ N +RN +H SSR + + + +R+ +++Y Sbjct: 194 NESKKYATSSNSLRNRTHGFQHTSSRYSRERSCSRDRNREY 234 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 25.4 bits (53), Expect = 0.70 Identities = 11/41 (26%), Positives = 24/41 (58%) Frame = +1 Query: 166 HELRKHGFEENLMRNWVCLVEHESSRDTSKTNTNRNGSKDY 288 +E +K+ N +RN +H SSR + + + +R+ +++Y Sbjct: 210 NESKKYATSSNSLRNRTHGFQHTSSRYSRERSCSRDRNREY 250 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 25.4 bits (53), Expect = 0.70 Identities = 11/41 (26%), Positives = 24/41 (58%) Frame = +1 Query: 166 HELRKHGFEENLMRNWVCLVEHESSRDTSKTNTNRNGSKDY 288 +E +K+ N +RN +H SSR + + + +R+ +++Y Sbjct: 205 NESKKYATSSNSLRNRTHGFQHTSSRYSRERSCSRDRNREY 245 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 25.4 bits (53), Expect = 0.70 Identities = 11/41 (26%), Positives = 24/41 (58%) Frame = +1 Query: 166 HELRKHGFEENLMRNWVCLVEHESSRDTSKTNTNRNGSKDY 288 +E +K+ N +RN +H SSR + + + +R+ +++Y Sbjct: 205 NESKKYATSSNSLRNRTHGFQHTSSRYSRERSCSRDRNREY 245 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 25.0 bits (52), Expect = 0.92 Identities = 11/41 (26%), Positives = 23/41 (56%) Frame = +1 Query: 166 HELRKHGFEENLMRNWVCLVEHESSRDTSKTNTNRNGSKDY 288 +E +K+ N +RN +H SSR + + +R+ +++Y Sbjct: 205 NESKKYATSSNSLRNRTHDFQHTSSRYSRERRCSRDRNREY 245 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 25.0 bits (52), Expect = 0.92 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +1 Query: 169 ELRKHGFEENLMRNWVCLVEHESSRDTSKTNTNRNGSKDY 288 E +K+ N +RN +H SSR + + + +R+ +++Y Sbjct: 195 ESKKYATSSNSLRNRTHGFQHTSSRYSRERSCSRDRNREY 234 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 25.0 bits (52), Expect = 0.92 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +1 Query: 169 ELRKHGFEENLMRNWVCLVEHESSRDTSKTNTNRNGSKDY 288 E +K+ N +RN +H SSR + + + +R+ +++Y Sbjct: 206 ESKKYATSSNSLRNRTHGFQHTSSRYSRERSCSRDRNREY 245 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 25.0 bits (52), Expect = 0.92 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +1 Query: 169 ELRKHGFEENLMRNWVCLVEHESSRDTSKTNTNRNGSKDY 288 E +K+ N +RN +H SSR + + + +R+ +++Y Sbjct: 206 ESKKYATSSNSLRNRTHGFQHTSSRYSRERSCSRDRNREY 245 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 25.0 bits (52), Expect = 0.92 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +1 Query: 169 ELRKHGFEENLMRNWVCLVEHESSRDTSKTNTNRNGSKDY 288 E +K+ N +RN +H SSR + + + +R+ +++Y Sbjct: 195 ESKKYATSSNSLRNRTHGFQHTSSRYSRERSCSRDRNREY 234 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +1 Query: 844 PXXPXPPPPPPPP 882 P P PPPPPP Sbjct: 1852 PVSGSPEPPPPPP 1864 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 22.6 bits (46), Expect = 4.9 Identities = 13/43 (30%), Positives = 13/43 (30%) Frame = +1 Query: 751 PXXPXPPXXXXPXXXPXXPXXXXPPXXXPXXPXXPXPPPPPPP 879 P P P P P PP P P PP PP Sbjct: 16 PSSGAPGPQPSPHQSPQAPQRGSPPNPSQGPP--PGGPPGAPP 56 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 212,870 Number of Sequences: 438 Number of extensions: 7904 Number of successful extensions: 32 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 28662543 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -