BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_G06 (983 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 4.2 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 4.2 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 5.6 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 7.4 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 22 9.8 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 23.0 bits (47), Expect = 4.2 Identities = 11/32 (34%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +3 Query: 108 MIFVLALLAMANAQGNGYEPIDNRP-YIVNPP 200 +IFV A A+ +A G+G++ P +++ PP Sbjct: 6 LIFVGAAAAVTSAGGHGFDAHLRGPSFVMEPP 37 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 23.0 bits (47), Expect = 4.2 Identities = 11/32 (34%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +3 Query: 108 MIFVLALLAMANAQGNGYEPIDNRP-YIVNPP 200 +IFV A A+ +A G+G++ P +++ PP Sbjct: 6 LIFVGAAAAVTSAGGHGFDAHLRGPSFVMEPP 37 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.6 bits (46), Expect = 5.6 Identities = 13/45 (28%), Positives = 17/45 (37%) Frame = +1 Query: 169 LTTARTSLILPKTTTLMETATNLSTTVHITWTVPKADLTSSLPLS 303 +TT T+ TTT T N + T P+ D LS Sbjct: 658 ITTITTTTTTTTTTTTTTTTPNTTQNASATTPPPQVDEVDDKELS 702 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.2 bits (45), Expect = 7.4 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +2 Query: 248 CILRGPSPRPTLLQA 292 C+LR +P P +L+A Sbjct: 1106 CVLRASTPAPVVLEA 1120 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.8 bits (44), Expect = 9.8 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +3 Query: 924 PPXXGXPLPPPP 959 PP G P+PP P Sbjct: 410 PPSAGAPMPPIP 421 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 242,440 Number of Sequences: 438 Number of extensions: 7977 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 32532591 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -