BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_G03 (942 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||M... 28 1.7 SPAC19D5.01 |pyp2||tyrosine phosphatase Pyp2|Schizosaccharomyces... 27 2.9 SPCC794.11c |||ENTH domain protein Ent3|Schizosaccharomyces pomb... 27 5.1 SPBC16A3.18 |cip1||RNA-binding protein Cip1|Schizosaccharomyces ... 26 6.7 SPAC1002.14 |itt1||ubiquitin-protein ligase E3 |Schizosaccharomy... 26 6.7 SPAPB21F2.03 |||ribosome biogenesis protein |Schizosaccharomyces... 26 8.8 >SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||Manual Length = 309 Score = 28.3 bits (60), Expect = 1.7 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -3 Query: 295 PAFPKSPSSFCPKVPKTLPPPICLSQVTSRGCR 197 P+ P PS+ P PK PPP+ + V + R Sbjct: 185 PSAPSLPSAVPPMPPKVPPPPLSQAPVANTSSR 217 >SPAC19D5.01 |pyp2||tyrosine phosphatase Pyp2|Schizosaccharomyces pombe|chr 1|||Manual Length = 711 Score = 27.5 bits (58), Expect = 2.9 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = -3 Query: 286 PKSPS-SFCPKVPKTLPPPICLSQVTS 209 P SP SF +VP +PPP+C V S Sbjct: 165 PISPDYSFPLRVPINIPPPLCTPSVVS 191 >SPCC794.11c |||ENTH domain protein Ent3|Schizosaccharomyces pombe|chr 3|||Manual Length = 476 Score = 26.6 bits (56), Expect = 5.1 Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Frame = +3 Query: 240 GKVFGTLGQNDDGLFGKAGYNR-EIFNDDRGKLTGQAYGTRVLGPGGDSTNYG 395 GK G +G + D + +R F RG +Y TRV G GG T+YG Sbjct: 166 GKFIG-VGSDGDSRISTSSKSRFPSFGSSRG-----SYRTRVYGDGGGFTDYG 212 >SPBC16A3.18 |cip1||RNA-binding protein Cip1|Schizosaccharomyces pombe|chr 2|||Manual Length = 490 Score = 26.2 bits (55), Expect = 6.7 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +2 Query: 497 GSG*EHPLFCXWYGLEGVRSQKTXRPTPSXDPP 595 GSG PL+ W G + S + P PS P Sbjct: 58 GSGSSAPLYPKWSGALSLASSRAASPAPSDSFP 90 >SPAC1002.14 |itt1||ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 435 Score = 26.2 bits (55), Expect = 6.7 Identities = 12/38 (31%), Positives = 16/38 (42%) Frame = -3 Query: 526 AEKWVFLSRSHTPEPDAVIPDLPPICLFRSIVACAFLF 413 AEKWV L+ P D V+ + C + F F Sbjct: 357 AEKWVLLNGQRCPTCDRVVERIDGCCHMNCLCGTHFCF 394 >SPAPB21F2.03 |||ribosome biogenesis protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 172 Score = 25.8 bits (54), Expect = 8.8 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = -3 Query: 331 LPRSSLKISLL*PAFPKSPSSFCPKVPKTLPPPICLSQVTSRGCRLEGCPLIE 173 +P++ ++SL A + PSS P ++P S VTS L PL E Sbjct: 1 MPKAKKRVSLASKASSRLPSSGKPSQQASIPNVELSSTVTSNSQVLNNDPLKE 53 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,192,756 Number of Sequences: 5004 Number of extensions: 64773 Number of successful extensions: 148 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 145 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 148 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 479324640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -