BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_G01 (928 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 24 1.9 AM292365-1|CAL23177.1| 313|Tribolium castaneum gustatory recept... 24 1.9 AM292325-1|CAL23137.2| 309|Tribolium castaneum gustatory recept... 24 1.9 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 23.8 bits (49), Expect = 1.9 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +3 Query: 288 STAPPEDALGNRFGDD 335 +T+PP L NRFG++ Sbjct: 131 NTSPPSPILSNRFGEN 146 >AM292365-1|CAL23177.1| 313|Tribolium castaneum gustatory receptor candidate 44 protein. Length = 313 Score = 23.8 bits (49), Expect = 1.9 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 5/49 (10%) Frame = -1 Query: 217 IIATQRTVIFMMLIVYRRKFYKNNNHEILTANLWKSIEL-----ISKIH 86 I AT ++ +ML ++RR NN I+ W S+ + IS+IH Sbjct: 165 ISATVCFMMLLMLEIWRRFTILNNYLTIVLGETWTSLSVYHLVEISEIH 213 >AM292325-1|CAL23137.2| 309|Tribolium castaneum gustatory receptor candidate 4 protein. Length = 309 Score = 23.8 bits (49), Expect = 1.9 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 5/49 (10%) Frame = -1 Query: 217 IIATQRTVIFMMLIVYRRKFYKNNNHEILTANLWKSIEL-----ISKIH 86 I AT ++ +ML ++RR NN I+ W S+ + IS+IH Sbjct: 161 ISATVCFMMLLMLEIWRRFTILNNYLTIVLGETWTSLSVYHLVEISEIH 209 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,376 Number of Sequences: 336 Number of extensions: 2483 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 25961683 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -